The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology



SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Info Description
Allergen ID 23
Allergen Scientific Name Hol l 1
Allergen Species - Systematic Name Holcus lanatus
Allergen Species - Common Name velvet grass
Allergen Common source grass
Allergen Common name Poales
Allergen Keywords Fragmented
Allergen IUIS (Yes=1, No=0) 1

Hol l 1 : There are iso allergen in the table! Click on each iso-allergen for more information.

ID Allergen Name
1 Hol l 1.0101
2 Hol l 1.0102
Hol l 1 - References
ID Reference
Pubmed ID: 9215246
Schramm G, Bufe A, Petersen A, Haas H, Schlaak M, Becker WM. Mapping of IgE-binding epitopes on the recombinant major group I allergen of velvet grass pollen, rHol l 1. J Allergy Clin Immunol. 1997 Jun;99(6 Pt 1):781-7.
Pubmed ID: 8768803
Schramm G, Petersen A, Bufe A, Schlaak M, Becker WM. Identification and characterization of the major allergens of velvet grass (Holcus lanatus), Hol l 1 and Hol l 5. Int Arch Allergy Immunol. 1996 Aug;110(4):354-63.
Hol l 1 - Protein Sequences
Source Link to source
SwissProt P43216
GenBank 3860384
Hol l 1 - Theoretical Model Structure
Model ID PDB file PDB Snapshot PDB Snapshot 90 PDB Snapshot 180 PDB Snapshot 270 3D PDB View
162 GetModel Model Pic Model Pic Model Pic Model Pic Click here
807 GetModel Model Pic Model Pic Model Pic Model Pic Click here
Hol l 1 - Sequence Search :
Sequence Header Sequence
Hol l 1
SDAP Sequence ID: 162
SDAP Allergen ID: 23
MASSSRSVLLLVAALFAVFLGSAHGIAKVPPGPNITATYGDEWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAYEAK
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Hol l 1
SDAP Sequence ID: 807
SDAP Allergen ID: 23
MASSSLVLLVVALFAVFLGTAHGIAKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPESCSGEPIVVHITDDNEEPIAAYHLDLSGKAFGAMAKKGEEQKLRSAGELELKFRRVKCEYPKGTKVTFHVEKGSNPNYLALLVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKVEAEDVIPEGWKADTAYESK
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Hol l 1 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Hol l 1 93.35 0.8 1N10_A 93.75 240 263 24 - 263 2 - 241 0 469 Download (SI: 807)
Hol l 1 93.1 0.8 1N10_A 92.917 240 265 26 - 265 2 - 241 0 468 Download (SI: 162)
Hol l 1 - Alphafold Theoretical Model Structure
Model Structure
807_relaxed_rank_1_model_3.pdb


Coverage Plddt
Hol l 1 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
P43216 Click here to process the data
3860384 Click here to process the data
Hol l 1 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
162 23 81 143 80 158 PF03330 DPBB_1 Domain CL0199 Lytic transglycolase
162 23 173 253 173 253 PF01357 Expansin_C Domain CL0159 Expansin C-terminal domain
807 23 79 141 78 156 PF03330 DPBB_1 Domain CL0199 Lytic transglycolase
807 23 170 251 170 251 PF01357 Expansin_C Domain CL0159 Expansin C-terminal domain
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Hol l 1 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
No epitope information found!
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.