The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview

Search SDAP

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language

About SDAP
General Information
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
MMDB - Entrez
NCBI - Entrez

Protein Classification

Bioinformatics Servers
Peptide Match @ PIR
ClustalW @ EMBL - EBI

                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun ( Secure access to SDAP is available from

Allergen Info Description
Allergen ID 842
Allergen Scientific Name Len c 1.0101
Allergen Species - Systematic Name Lens culinaris
Allergen Species - Common Name lentil
Allergen Common source foods
Allergen Common name
Allergen Keywords vicilin, Len c 3.02
Allergen IUIS (Yes=1, No=0) 1
Len c 1.0101 - References
ID Reference
No reference found!
Len c 1.0101 - Protein Sequences
Source Link to source
GenBank 29539109
Len c 1.0101 - Sequence Search :
Sequence Header Sequence
Len c 1.0101
SDAP Sequence ID: 1244
SDAP Allergen ID: 842
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Len c 1.0101 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Len c 1.0101 87.4 0.82 7U1H_A 100 412 418 1 - 412 20 - 431 0 825 Download (SI: 1244)
Len c 1.0101 - Alphafold Theoretical Model Structure
Model Structure

Coverage Plddt
Len c 1.0101 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
29539109 Click here to process the data
Len c 1.0101 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
1244 842 54 164 17 167 PF00190 Cupin_1 Domain CL0029 Cupin
1244 842 227 390 227 398 PF00190 Cupin_1 Domain CL0029 Cupin
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Len c 1.0101 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
1 313-348 EEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAIN IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
2 340-366 PAGHPVAINASSDLNLIGFGINAKNNQ IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
3 355-379 LIGFGINAKNNQRNFLAGEEDNVIS IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
4 373-399 EEDNVISQIQRPVKELAFPGSSREVDR IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search

Epitope Reference ( ID 35): A. Vereda, D.A. Andreae, J. Lin, W.G. Shreffler, M.D. Ibanez, J. Cuesta-Herranz, L. Bardina, and H.A.Sampson, Identification of IgE sequential epitopes of lentil (Len c 1) by means of peptide microarray immunoassay. J. Allergy Clin. Immunol. 2010, 126, 596-601.
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.