The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology



SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Info Description
Allergen ID 130
Allergen Scientific Name Mus m 1.0101
Allergen Species - Systematic Name Mus musculus
Allergen Species - Common Name Mouse
Allergen Common source animals
Allergen Common name
Allergen Keywords Major urinary protein II; MUP; Alpha-2U-globulin; BS6
Allergen IUIS (Yes=1, No=0) 1
Mus m 1.0101 - References
ID Reference
Pubmed ID: 3097107
Lorusso JR, Moffat S, Ohman JL Jr, Immunologic and biochemical properties of the major mouse urinary allergen (Mus m 1). J Allergy Clin Immunol. 1986 Nov;78(5 Pt 1):928-37.
Pubmed ID: 3004935
Clark AJ, Ghazal P, Bingham RW, Barrett D, Bishop JO. Sequence structures of a mouse major urinary protein gene and pseudogene compared. EMBO J. 1985 Dec 1;4(12):3159-65.
Pubmed ID: 1279439
Bocskei Z, Groom CR, Flower DR, Wright CE, Phillips SE, Cavaggioni A, Findlay JB, North AC. Pheromone binding to two rodent urinary proteins revealed by X-ray crystallography. Nature. 1992 Nov 12;360(6400):186-8.
Pubmed ID: 11316880
Timm DE, Baker LJ, Mueller H, Zidek L, Novotny MV. Structural basis of pheromone binding to mouse major urinary protein (MUP-I). Protein Sci. 2001 May;10(5):997-1004.
Pubmed ID: 6329733
Clark AJ, Clissold PM, Al Shawi R, Beattie P, Bishop J. Structure of mouse major urinary protein genes: different splicing configurations in the 3'-non-coding region. EMBO J. 1984 May;3(5):1045-52.
Pubmed ID: 12466851
Okazaki Y, Furuno M, Kasukawa T, et. al., Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs. Nature. 2002 Dec 5;420(6915):563-73.
Pubmed ID: 12477932
Strausberg RL, Feingold EA, Grouse LH, et. al., Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903.
Mus m 1.0101 - Protein Sequences
Source Link to source
SwissProt P02762
Mus m 1.0101 - PDB Structure
PDB Id PDB Name PDB Entry Deposition Date Experiment Type Observation
130 145 1MUP 21-SEP-92 X-ray diffraction resolution 2.4 A complex with 2-(sec-butyl)thiazoline
1MUP.pdb


Mus m 1.0101 - Sequence Search :
Sequence Header Sequence
Mus m 1.0101
SDAP Sequence ID: 189
SDAP Allergen ID: 130
MKMLLLLCLGLTLVCVHAEEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Mus m 1.0101 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Mus m 1 90.5 0.78 1I04_A 100 180 180 1 - 180 1 - 180 0 371 Download (SI: 189)
Mus m 1.0101 - Alphafold Theoretical Model Structure
Model Structure
189_relaxed_rank_1_model_3.pdb


Coverage Plddt
Mus m 1.0101 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
P02762 Click here to process the data
Mus m 1.0101 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
189 130 34 171 34 173 PF00061 Lipocalin Domain CL0116 Lipocalin / cytosolic fatty-acid binding protein family
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Mus m 1.0101 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
No epitope information found!
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.