The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology



SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Info Description
Allergen ID 56
Allergen Scientific Name Ole e 1
Allergen Species - Systematic Name Olea europea
Allergen Species - Common Name olive
Allergen Common source tree
Allergen Common name Lamiales Oleaceae
Allergen Keywords Pollen allergen
Allergen IUIS (Yes=1, No=0) 1

Ole e 1 : There are iso allergen in the table! Click on each iso-allergen for more information.

ID Allergen Name
1 Ole e 1.0101
2 Ole e 1.0102
3 Ole e 1.0103
4 Ole e 1.0104
5 Ole e 1.0105
6 Ole e 1.0106
7 Ole e 1.0107
Ole e 1 - References
ID Reference
Pubmed ID: 7982126
Lombardero M, Barbas JA, Moscoso del Prado J, Carreira J, cDNA sequence analysis of the main olive allergen, Ole e I. Clin Exp Allergy. 1994 Aug;24(8):765-70.
Pubmed ID: 8404906
Villalba M, Batanero E, Lopez-Otin C, Sanchez LM, Monsalve RI, Gonzalez de la Pena MA, Lahoz C, Rodriguez R, The amino acid sequence of Ole e I, the major allergen from olive tree (Olea europaea) pollen. Eur J Biochem. 1993 Sep 15;216(3):863-9.
Pubmed ID: 10998264
Kolarich D, Altmann F. N-Glycan analysis by matrix-assisted laser desorption/ionization mass spectrometry of electrophoretically separated nonmammalian proteins: application to peanut allergen Ara h 1 and olive pollen allergen Ole e 1. Anal Biochem. 2000 Oct 1;285(1):64-75.
Ole e 1 - Protein Sequences
Source Link to source
SwissProt P19963
Ole e 1 - Sequence Search :
Sequence Header Sequence
Ole e 1
SDAP Sequence ID: 192
SDAP Allergen ID: 56
EDIPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTRAEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFKLNTVNGTTRTVNPLGFFKKEALPKCAQVYNKLGMYPPNM
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Ole e 1 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Ole e 1 90.85 0.8 6YOA_A 87.586 145 145 1 - 145 1 - 145 0 275 Download (SI: 192)
Ole e 1 - Alphafold Theoretical Model Structure
Model Structure
192_relaxed_rank_1_model_2.pdb


Coverage Plddt
Ole e 1 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
P19963 Click here to process the data
Ole e 1 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
192 56 13 94 13 100 PF01190 Pollen_Ole_e_1 Family CL0287 Pollen protein Ole e 1 like
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Ole e 1 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
No epitope information found!
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.