The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology



SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Info Description
Allergen ID 61
Allergen Scientific Name Ole e 6
Allergen Species - Systematic Name Olea europea
Allergen Species - Common Name olive
Allergen Common source tree
Allergen Common name Lamiales Oleaceae
Allergen Keywords Cysteine
Allergen IUIS (Yes=1, No=0) 1
ID Allergen Name
Ole e 6 - References
ID Reference
Pubmed ID: 9237648
Batanero E, Ledesma A, Villalba M, Rodriguez R, Purification, amino acid sequence and immunological characterization of Ole e 6, a cysteine-enriched allergen from olive tree pollen. FEBS Lett. 1997 Jun 30;410(2-3):293-6.
Pubmed ID: 15358355
Barral P, Tejera ML, Trevino MA, Batanero E, Villalba M, Bruix M, Rodriguez R, Recombinant expression of Ole e 6, a Cys-enriched pollen allergen, in Pichia pastoris yeast: detection of partial oxidation of methionine by NMR. Protein Expr Purif. 2004 Oct;37(2):336-43.
Pubmed ID: 15247256
Trevino MA, Garcia-Mayoral MF, Barral P, Villalba M, Santoro J, Rico M, Rodriguez R, Bruix M. NMR solution structure of Ole e 6, a major allergen from olive tree pollen. J Biol Chem. 2004 Sep 10;279(37):39035-41. Epub 2004 Jul 7.
Ole e 6 - Protein Sequences
Source Link to source
SwissProt O24172
Ole e 6 - PDB Structure
PDB Id PDB Name PDB Entry Deposition Date Experiment Type Observation
61 181 1SS3 23-MAR-04 NMR, 25 structures
1SS3.pdb


Ole e 6 - Sequence Search :
Sequence Header Sequence
Ole e 6
SDAP Sequence ID: 199
SDAP Allergen ID: 61
DEAQFKECYDTCHKECSDKGNGFTFCEMKCDTDCSVKDVKEKLENYKPKN
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Ole e 6 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Ole e 6 90.6 0.63 1SS3_A 100 50 50 1 - 50 1 - 50 1.49e-30 101 Download (SI: 199)
Ole e 6 - Alphafold Theoretical Model Structure
Model Structure
199_relaxed_rank_1_model_1.pdb


Coverage Plddt
Ole e 6 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
O24172 Click here to process the data
Ole e 6 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
199 61 8 45 8 46 PF09253 Ole_e_6 Domain No_clan Pollen allergen Ole e 6
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Ole e 6 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
No epitope information found!
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.