The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology



SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP
Allergen Info Description
Allergen ID 61
Allergen Scientific Name Ole e 6
Allergen Species - Systematic Name Olea europea
Allergen Species - Common Name olive
Allergen Common source tree
Allergen Common name Lamiales Oleaceae
Allergen Keywords Cysteine
Allergen IUIS (Yes=1, No=0) 1
ID Allergen Name
Ole e 6 - References
ID Reference
Pubmed ID: 9237648
Batanero E, Ledesma A, Villalba M, Rodriguez R, Purification, amino acid sequence and immunological characterization of Ole e 6, a cysteine-enriched allergen from olive tree pollen. FEBS Lett. 1997 Jun 30;410(2-3):293-6.
Pubmed ID: 15358355
Barral P, Tejera ML, Trevino MA, Batanero E, Villalba M, Bruix M, Rodriguez R, Recombinant expression of Ole e 6, a Cys-enriched pollen allergen, in Pichia pastoris yeast: detection of partial oxidation of methionine by NMR. Protein Expr Purif. 2004 Oct;37(2):336-43.
Pubmed ID: 15247256
Trevino MA, Garcia-Mayoral MF, Barral P, Villalba M, Santoro J, Rico M, Rodriguez R, Bruix M. NMR solution structure of Ole e 6, a major allergen from olive tree pollen. J Biol Chem. 2004 Sep 10;279(37):39035-41. Epub 2004 Jul 7.
Ole e 6 - Protein Sequences
Source Link to source
SwissProt O24172
Ole e 6 - PDB Structure
PDB Id PDB Name PDB Entry Deposition Date Experiment Type Observation
61 181 1SS3 23-MAR-04 NMR, 25 structures
1SS3.pdb


Ole e 6 - Sequence Search
Sequence Header Sequence
Ole e 6
SDAP Sequence ID: 199
SDAP Allergen ID: 61
DEAQFKECYDTCHKECSDKGNGFTFCEMKCDTDCSVKDVKEKLENYKPKN
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Expasy Blast Search
Ole e 6 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Ole e 6 90.6 0.63 1SS3_A 100 50 50 1 - 50 1 - 50 1.49e-30 101 Download (SI: 199)
Ole e 6 - Alphafold Theoretical Model Structure
Model Structure
199_relaxed_rank_1_model_1.pdb


Coverage Plddt
Ole e 6 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
O24172 Click here to process the data
Ole e 6 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
199 61 8 45 8 46 PF09253 Ole_e_6 Domain No_clan Pollen allergen Ole e 6
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

Welcome

Predicted B-Cell epitope using BCEP method for Ole e 6

Probe radius : 1.400

POLAR area/energy = 1665.49

APOLAR area/energy = 2774.88

Total area/energy = 4440.37

Number of surface atoms = 295

Number of buried atoms = 108

Residues Predicted with high probability (in top five patches) are: 45,46,47,48,49,50,27,28,29,31,32,33,35 , and medium probability (next top five patches) are : 35,17,18,19,20,21,22,42,43,44,14,15,25,24 . Predicted residues are shown in red and green color stick representation.

Original PDB file 1911.test.pdb
Original PDB file with surface residue only. All amino acid residue are replaced by their CB atom, in case of GLY CA atom is used. Solvent accessible surface area of each residue is stored in last column of the PDB file. 11911.test.txt
Patch drawn around the residues by patch analysis are stored in this file
How to read: Col 1: Patch No. Col 2: Center Res Name. Col 3: Sum(Pint*Area), Col 4: Sum(Psur*Area), Col 5: Total Residue, Col 6: Interface score, Col 7: Surface Score, Col 8: Max Interface Score, Col 9: Minimum Interface Score
1911.test.tmppat
Residues predicted by patch analysis are stored in this file.
How to read: Col 1: Patch No. Col 2: Center Res Name. Col 3: Res Number Col 4: Neigbouring Res Name, Col 5: Sum(Pint*Area). Col 6: Sum(PSur*Area), Col 7: Sum(Area), Col 8: Similar no of residue in patch (e.g CYS, CYS = 2)
1911.test.res
All residues scored by patch analysis are stored in this file.
How to read: Col 1: Patch No. Col 2: Center Res Name. Col 3: Sum(Pint*Area)/sum(Area), Col 4: Sum(Psur*Area)/sum(Area), Col 5: Total Residue
1911.test.resALL

[For BCEP predicted results, please cite our websites http://fermi.utmb.edu/ http://curie.utmb.edu/ for your future publications (Negi et al., Bioinformatics, 23, 3397-3399, 2007 , Negi et al., J. Mol. Model., 13, 1157-1167, 2007; Negi et al., J. Mol. Model., 12, 921-929, 2006)]



List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids
Peptides predicted from BepiPred method can be used to search related peptides in SDAP using PD search and Cross-React method.
Please note: BepiPred Epitopes are predicted using BepiPred webserver implemented in IEDB Analysis Resource at http://tools.iedb.org/main/bcell/
Cleck here for epitopes predicted by BepiPred method

Ole e 6 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
No epitope information found!
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2022  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.