The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology



SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Info Description
Allergen ID 1790
Allergen Scientific Name Par h 1.0101
Allergen Species - Systematic Name Parthenium hysterophorus
Allergen Species - Common Name Feverfew
Allergen Common source Plant
Allergen Common name Plantae Magnoliopsida
Allergen Keywords Defensin-like protein linked to polyproline-rich region
Allergen IUIS (Yes=1, No=0) 1
Par h 1.0101 - References
ID Reference
Pubmed ID: 8939153
Gupta N, Martin BM, Metcalfe DD, Rao PV. Identification of a novel hydroxyproline-rich glycoprotein as the major allergen in Parthenium pollen. J Allergy Clin Immunol. 1996 Nov;98(5 Pt 1):903-12. doi: 10.1016/s0091-6749(96)80006-6. PMID: 8939153.
Pubmed ID: 28729676
Pablos I, Eichhorn S, Briza P, Asam C, Gartner U, Wolf M, Ebner C, Bohle B, Arora N, Vieths S, Ferreira F, Gadermaier G. Proteomic profiling of the weed feverfew, a neglected pollen allergen source. Sci Rep. 2017 Jul 20;7(1):6049. doi: 10.1038/s41598-017-06213-z. PMID: 28729676; PMCID: PMC5519751.
Par h 1.0101 - Protein Sequences
Source Link to source
GenBank A0A0X9C7K4
Par h 1.0101 - Sequence Search :
Sequence Header Sequence
Par h 1.0101
SDAP Sequence ID: 1544
SDAP Allergen ID: 1790
MAKSSTSYLVFLLLVLVVAISEIASVNGKVCEKPSKTWFGNCKDTEKCDKRCMEWEGAKHGACHQRESKYMCFCYFDCDPKKNPGPPPGAPGTPGTPPAPPGGGEGDAPPGGGAPPPAGGEGGGGGGEGGGGAPPPAGGEGGGGGGDGGGGAPPAA
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Par h 1.0101 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Par h 1.0101 65.75 0.42 1BK8_A 61.702 47 156 32 - 78 4 - 50 6.33e-19 76.3 Download (SI: 1544)
Par h 1.0101 - Alphafold Theoretical Model Structure
Model Structure
1544_relaxed_rank_1_model_2.pdb


Coverage Plddt
Par h 1.0101 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
A0A0X9C7K4 Click here to process the data
Par h 1.0101 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
1544 1790 29 78 29 78 PF00304 Gamma-thionin Domain CL0054 Gamma-thionin family
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Par h 1.0101 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
No epitope information found!
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.