The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Info Description
Allergen ID 550
Allergen Scientific Name Par j 2
Allergen Species - Systematic Name Parietaria judaica
Allergen Species - Common Name Pellitory-of-the-Wall
Allergen Common source weed
Allergen Common name Rosales
Allergen Keywords lipid transfer protein; P2 protein
Allergen IUIS (Yes=1, No=0) 1

Par j 2 : There are iso allergen in the table! Click on each iso-allergen for more information.

ID Allergen Name
1 Par j 2.0101
2 Par j 2.0102
Par j 2 - References
ID Reference
No reference found!
Par j 2 - Protein Sequences
Source Link to source
SwissProt P55958
SwissProt O04403
Par j 2 - Theoretical Model Structure
Model ID PDB file PDB Snapshot PDB Snapshot 90 PDB Snapshot 180 PDB Snapshot 270 3D PDB View
207 GetModel Model Pic Model Pic Model Pic Model Pic Click here
208 GetModel Model Pic Model Pic Model Pic Model Pic Click here
Par j 2 - Sequence Search :
Sequence Header Sequence
Par j 2
SDAP Sequence ID: 207
SDAP Allergen ID: 550
MRTVSMAALVVIAAALAWTSSAEPAPAPAPGEEACGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLPPITADFDCSKIQSTIFRGYY
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Par j 2
SDAP Sequence ID: 208
SDAP Allergen ID: 550
MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVAEVPKKCGITTTLPPITADFDCSKIESTIFRGYY
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Par j 2 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Par j 2 74.95 0.59 1AFH_A 35.484 93 133 34 - 125 3 - 93 3.79e-20 79.7 Download (SI: 207)
Par j 2 76.75 0.62 1AFH_A 36.957 92 133 35 - 125 4 - 93 1.07e-20 81.3 Download (SI: 208)
Par j 2 - Alphafold Theoretical Model Structure
Model Structure
208_relaxed_rank_1_model_3.pdb


Coverage Plddt
Par j 2 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
P55958 Click here to process the data
O04403 Click here to process the data
Par j 2 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
207 550 17 111 12 115 PF14368 LTP_2 Family CL0482 Probable lipid transfer
208 550 18 111 10 115 PF14368 LTP_2 Family CL0482 Probable lipid transfer
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Par j 2 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
1 45-50 CLHFVK IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
2 49-58 VKGEEKEPSK IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
3 61-70 CSGTKKLSEE IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
4 69-76 EEVKTTEQ IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
5 77-86 KREACKCIVR IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
6 83-91 CIVRATKGI IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
7 104-111 KKCDIKTT IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
8 122-129 SKIQSTIF IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
208_relaxed_rank_1_model_3.pdb



Epitope Reference ( ID 25): J. A. Asturias, N. Gomez-Bayon, J. L. Eseverri, and A. Martinez, Par j 1 and Par j 2, the major allergens from Parietaria judaica pollen, have similar immunoglobulin E epitopes, Clin. Exp. Allergy 2003, 33, 518-524.
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.