The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology



SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Info Description
Allergen ID 38
Allergen Scientific Name Poa p 9
Allergen Species - Systematic Name Poa pratensis
Allergen Species - Common Name Kentucky blue grass
Allergen Common source grass
Allergen Common name Poales
Allergen Keywords Beta-expansin; Old Name: Poa p 5, KBG 31, KBG 41, KBG 60, Poa p IX
Allergen IUIS (Yes=1, No=0) 1
ID Allergen Name
Poa p 9 - References
ID Reference
Pubmed ID: 2051020
Olsen E, Zhang L, Hill RD, Kisil FT, Sehon AH, Mohapatra SS, Identification and characterization of the Poa p IX group of basic allergens of Kentucky bluegrass pollen. J Immunol. 1991 Jul 1;147(1):205-11.
Pubmed ID: 1702432
Silvanovich A, Astwood J, Zhang L, Olsen E, Kisil F, Sehon A, Mohapatra S, Hill R, Nucleotide sequence analysis of three cDNAs coding for Poa p IX isoallergens of Kentucky bluegrass pollen. J Biol Chem. 1991 Jan 15;266(2):1204-10.
Pubmed ID: 1383697
Zhang L, Olsen E, Kisil FT, Hill RD, Sehon AH, Mohapatra SS, Mapping of antibody binding epitopes of a recombinant Poa p IX allergen. Mol Immunol. 1992 Nov;29(11):1383-9.
Pubmed ID: 1611548
Klysner S, Welinder KG, Lowenstein H, Matthiesen F, Group V allergens in grass pollens: IV. Similarities in amino acid compositions and NH2-terminal sequences of the group V allergens from Lolium perenne, Poa pratensis and Dactylis glomerata. Clin Exp Allergy. 1992 Apr;22(4):491-7.
Poa p 9 - Protein Sequences
Source Link to source
SwissProt P22284
SwissProt P22285
SwissProt P22286
Poa p 9 - Theoretical Model Structure
Model ID PDB file PDB Snapshot PDB Snapshot 90 PDB Snapshot 180 PDB Snapshot 270 3D PDB View
228 GetModel Model Pic Model Pic Model Pic Model Pic Click here
229 GetModel Model Pic Model Pic Model Pic Model Pic Click here
230 GetModel Model Pic Model Pic Model Pic Model Pic Click here
Poa p 9 - Sequence Search :
Sequence Header Sequence
Poa p 9
SDAP Sequence ID: 228
SDAP Allergen ID: 38
MDKANGAYKTALKAASAVAPAEKFPVFQATFDKNLKEGLSGPDAVGFAKKLDAFIQTSYLSTKAAEPKEKFDLFVLSLTEVLRFMAGAVKAPPASKFPAKPAPKVAAYTPAAPAGAAPKATTDEQKLIEKINVGFKAAVAAAAGVPAASKYKTFVATFGAASNKAFAEALSTEPKGAAVASSKAVLTSKLDAAYKLAYKSAEGATPEAKYDAYVATLSEALRIIAGTLEVHGVKPAAEEVKAIPAGELQVIDKVDAAFKVAATAANAAPANDKFTVFEAAFNDAIKASTGGAYQSYKFIPALEAAVKQSYAATVATAPAVKYTVFETALKKAITAMSQAQKAAKPAAAVTGTATSAVGAATGAATAAAGGYKV
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Poa p 9
SDAP Sequence ID: 229
SDAP Allergen ID: 38
MAVHQYTVALFLAVALVAGPAASYAADVGYGAPATLATPATPAAPAAGYTPAAPAGAAPKATTDEQKLIEKINAGFKAAVAAAAGVPAVDKYKTFVATFGTASNKAFAEALSTEPKGAAAASSNAVLTSKLDAAYKLAYKSAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAGEEVKAIPAGELQVIDKVDAAFKVAATAANAAPANDKFTVFEAAFNDAIKASTGGAYQSYKFIPALEAAVKQSYAATVATAPAVKYTVFETALKKAITAMSQAQKAAKPAAAVTATATGAVGAATGAVGAATGAATAAAGGYKTGAATPTAGGYKV
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Poa p 9
SDAP Sequence ID: 230
SDAP Allergen ID: 38
MAVQKYTVALFLVALVVGPAASYAADLSYGAPATPAAPAAGYTPAAPAGAAPKATTDEQKMIEKINVGFKAAVAAAGGVPAANKYKTFVATFGAASNKAFAEALSTEPKGAAVDSSKAALTSKLDAAYKLAYKSAEGATPEAKYDDYVATLSEALRIIAGTLEVHGVKPAAEEVKATPAGELQVIDKVDAAFKVAATAANAAPANDKFTVFEAAFNDAIKASTGGAYQSYKFIPALEAAVKQSYAATVATAPAVKYTVFETALKKAITAMSQAQKAAKPAAAATGTATAAVGAATGAATAAAGGYKV
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Poa p 9 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Poa p 5 56.8 0.45 2M64_A 89.744 234 333 54 - 287 1 - 231 0 353 Download (SI: 229)
Poa p 5 56.15 0.46 2M64_A 90.171 234 373 113 - 346 1 - 231 0 351 Download (SI: 228)
Poa p 5 58.1 0.47 2M64_A 88.889 234 307 47 - 280 1 - 231 0 349 Download (SI: 230)
Poa p 9 - Alphafold Theoretical Model Structure
Model Structure
230_relaxed_rank_1_model_2.pdb


Coverage Plddt
Poa p 9 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
P22284 Click here to process the data
P22285 Click here to process the data
P22286 Click here to process the data
Poa p 9 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
228 38 84 235 84 235 PF01620 Pollen_allerg_2 Family No_clan Ribonuclease (pollen allergen)
229 38 44 176 40 176 PF01620 Pollen_allerg_2 Family No_clan Ribonuclease (pollen allergen)
230 38 7 169 7 169 PF01620 Pollen_allerg_2 Family No_clan Ribonuclease (pollen allergen)
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Poa p 9 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
No epitope information found!
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.