The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology



SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP
Allergen Info Description
Allergen ID 271
Allergen Scientific Name Sal s 1
Allergen Species - Systematic Name Salmo salar
Allergen Species - Common Name Atlantic salmon
Allergen Common source foods
Allergen Common name
Allergen Keywords parvalbumin
Allergen IUIS (Yes=1, No=0) 1
ID Allergen Name
Sal s 1 - References
ID Reference
No reference found!
Sal s 1 - Protein Sequences
Source Link to source
SwissProt Q91482
SwissProt Q91483
GenBank 5640137
Sal s 1 - Theoretical Model Structure
Model ID PDB file PDB Snapshot PDB Snapshot 90 PDB Snapshot 180 PDB Snapshot 270 3D PDB View
249 GetModel Model Pic Model Pic Model Pic Model Pic Click here
250 GetModel Model Pic Model Pic Model Pic Model Pic Click here
560 GetModel Model Pic Model Pic Model Pic Model Pic Click here
Sal s 1 - Sequence Search :
Sequence Header Sequence
Sal s 1
SDAP Sequence ID: 249
SDAP Allergen ID: 271
MACAHLCKEADIKTALEACKAADTFSFKTFFHTIGFASKSADDVKKAFKVIDQDASGFIEVEELKLFLQNFCPKARELTDAETKAFLKAGDADGDGMIGIDEFAVLVKQ
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Sal s 1
SDAP Sequence ID: 250
SDAP Allergen ID: 271
SFAGLNDADVAAALAACTAADSFNHKAFFAKVGLASKSSDDVKKAFYVIDQDKSGFIEEDELKLFLQNFSASARALTDAETKAFLADGDKDGDGMIGVDEFAAMIKG
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Sal s 1
SDAP Sequence ID: 560
SDAP Allergen ID: 271
MSFAGLNDADVAAALAACTAADSFNHKAFFAKVGLASKSSDDVKKAFYVIDQDKSGFIEEDELKLFLQNFSASARALTDAETKAFLADGDKDGDGMIGVDEFAAMIKG
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Sal s 1 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Sal s 1 90.2 0.78 5XND_A 64.815 108 109 1 - 108 6 - 113 1.82029e-42 136 Download (SI: 249)
Sal s 1 96.2 0.84 1PAL_A 94.34 106 107 1 - 106 2 - 107 0 164 Download (SI: 250)
Sal s 1 94.9 0.84 1PAL_A 94.34 106 108 2 - 107 2 - 107 0 164 Download (SI: 560)
Sal s 1 - Alphafold Theoretical Model Structure
Model Structure
560_relaxed_rank_1_model_4.pdb


Coverage Plddt
Sal s 1 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
Q91482 Click here to process the data
Q91483 Click here to process the data
5640137 Click here to process the data
Sal s 1 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
249 271 43 107 41 108 PF13499 EF-hand_7 Domain CL0220 EF-hand domain pair
250 271 41 105 39 106 PF13499 EF-hand_7 Domain CL0220 EF-hand domain pair
560 271 42 106 40 107 PF13499 EF-hand_7 Domain CL0220 EF-hand domain pair
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Sal s 1 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
No epitope information found!
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.