The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology



SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP
Allergen Info Description
Allergen ID 1856
Allergen Scientific Name Sco m 5.0101
Allergen Species - Systematic Name Scolopendra mutilans
Allergen Species - Common Name Chinese red-headed centipede
Allergen Common source insects
Allergen Common name Animalia Arthropoda
Allergen Keywords Venom allergen 5
Allergen IUIS (Yes=1, No=0) 1
Sco m 5.0101 - References
ID Reference
No reference found!
Sco m 5.0101 - Protein Sequences
Source Link to source
GenBank QEA69430
Sco m 5.0101 - Sequence Search :
Sequence Header Sequence
Sco m 5.0101
SDAP Sequence ID: 1606
SDAP Allergen ID: 1856
MTIFLTSTLFVLLVFQILGKGMGCDMKVRGLDANMKKMILDLHNKKRQTVANGQQSGQPSAANMKELHWDDQIAANAQRSAETCVFQHTAKNLRKTSKYSYLGENIYMGSYPDPIPRSVNAWYDEVKDVTPAVVKSFRSGGPMIGHYTQMVWANTEALGCGLVTASDKNTYIFCQYGPSGNYPGEPIYKQGSPASDCKKGKSSKYPGLCN
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Sco m 5.0101 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Sco m 5.0101 92.5 0.82 2DDB_A 38.554 166 210 34 - 197 4 - 159 5.83e-32 116 Download (SI: 1606)
Sco m 5.0101 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
QEA69430 Click here to process the data
Sco m 5.0101 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
1606 1856 40 176 40 176 PF00188 CAP Domain CL0659 Cysteine-rich secretory protein family
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Sco m 5.0101 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
No epitope information found!
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.