The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology



SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Info Description
Allergen ID 295
Allergen Scientific Name Tri a 18
Allergen Species - Systematic Name Triticum aestivum
Allergen Species - Common Name wheat
Allergen Common source foods
Allergen Common name
Allergen Keywords Agglutinin isolectin A
Allergen IUIS (Yes=1, No=0) 1
ID Allergen Name
Tri a 18 - References
ID Reference
No reference found!
Tri a 18 - Protein Sequences
Source Link to source
GenBank 170666
GenBank 170670
GenBank 170668
Tri a 18 - PDB Structure
PDB Id PDB Name PDB Entry Deposition Date Experiment Type Observation
295 245 1WGC 1990-04-03 X-ray diffraction resolution 2.20 A
295 246 2CWG 1993-01-08 X-ray diffraction resolution 2.00 A
295 247 7WGA 1990-04-03 X-ray diffraction resolution 2.00 A
7WGA.pdb


Tri a 18 - Sequence Search :
Sequence Header Sequence
Tri a 18
SDAP Sequence ID: 688
SDAP Allergen ID: 295
MKMMSTRALALGAAAVLAFAAATAQAQRCGEQGSNMECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGSQAGGATCTNNQCCSQYGYCGFGAEYCGAGCQGGPCRADIKCGSQAGGKLCPNNLCCSQWGFCGLGSEFCGGGCQSGACSTDKPCGKDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGCDGVFAEAITANSTLLQE
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a 18
SDAP Sequence ID: 689
SDAP Allergen ID: 295
MRKMMSTMALTLGAAVFLAFAAATAQAQRCGEQGSNMECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGSQAGGATCPNNHCCSQYGHCGFGAEYCGAGCQGGPCRADIKCGSQSGGKLCPNNLCCSQWGFCGLGSEFCGGGCQSGACSTDKPCGKDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGCDAVFAGAITANSTLLAE
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a 18
SDAP Sequence ID: 690
SDAP Allergen ID: 295
QRCGEQGSGMECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGSQAGGKTCPNNHCCSQYGHCGFGAEYCGAGCQGGPCRADIKCGSQAGGKLCPNNLCCSQWGYCGLGSEFCGEGCQNGACSTDKPCGKDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGCDGVFAEAIATNSTLLAE
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a 18 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Tri a 18 88.7 0.69 1K7T_A 94.595 185 213 29 - 213 2 - 186 0 339 Download (SI: 689)
Tri a 18 92 0.75 1K7T_A 100 185 186 2 - 186 2 - 186 0 352 Download (SI: 690)
Tri a 18 88.85 0.69 1K7T_A 94.054 185 212 28 - 212 2 - 186 0 335 Download (SI: 688)
Tri a 18 - Alphafold Theoretical Model Structure
Model Structure
690_relaxed_rank_1_model_1.pdb


Coverage Plddt
Tri a 18 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
170666 Click here to process the data
170670 Click here to process the data
170668 Click here to process the data
Tri a 18 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
688 295 28 66 28 66 PF00187 Chitin_bind_1 Domain No_clan Chitin recognition protein
688 295 71 109 71 109 PF00187 Chitin_bind_1 Domain No_clan Chitin recognition protein
688 295 114 152 114 152 PF00187 Chitin_bind_1 Domain No_clan Chitin recognition protein
688 295 158 195 157 195 PF00187 Chitin_bind_1 Domain No_clan Chitin recognition protein
689 295 29 67 29 67 PF00187 Chitin_bind_1 Domain No_clan Chitin recognition protein
689 295 72 110 72 110 PF00187 Chitin_bind_1 Domain No_clan Chitin recognition protein
689 295 115 153 115 153 PF00187 Chitin_bind_1 Domain No_clan Chitin recognition protein
689 295 159 196 158 196 PF00187 Chitin_bind_1 Domain No_clan Chitin recognition protein
690 295 2 40 2 40 PF00187 Chitin_bind_1 Domain No_clan Chitin recognition protein
690 295 45 83 45 83 PF00187 Chitin_bind_1 Domain No_clan Chitin recognition protein
690 295 88 126 88 126 PF00187 Chitin_bind_1 Domain No_clan Chitin recognition protein
690 295 132 169 131 169 PF00187 Chitin_bind_1 Domain No_clan Chitin recognition protein
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Tri a 18 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
No epitope information found!
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.