The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology



SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Info Description
Allergen ID 687
Allergen Scientific Name Tri a gliadin
Allergen Species - Systematic Name Triticum aestivum
Allergen Species - Common Name wheat
Allergen Common source foods
Allergen Common name
Allergen Keywords Gliadin; Storage protein
Allergen IUIS (Yes=1, No=0) 0
ID Allergen Name
Tri a gliadin - References
ID Reference
No reference found!
Tri a gliadin - Protein Sequences
Source Link to source
GenBank 473876
GenBank 170710
GenBank 170728
GenBank 21757
GenBank 21761
GenBank 21755
GenBank 21765
GenBank 170718
GenBank 170720
GenBank 170722
GenBank 170712
GenBank 170726
GenBank 170724
GenBank 170716
GenBank 21673
GenBank 21753
GenBank 170702
GenBank 170738
GenBank 170708
GenBank 170730
GenBank 170732
GenBank 170734
GenBank 170740
GenBank 170736
GenBank 21769
GenBank 1063270
SwissProt P02865
Tri a gliadin - Theoretical Model Structure
Model ID PDB file PDB Snapshot PDB Snapshot 90 PDB Snapshot 180 PDB Snapshot 270 3D PDB View
705 GetModel Model Pic Model Pic Model Pic Model Pic Click here
708 GetModel Model Pic Model Pic Model Pic Model Pic Click here
710 GetModel Model Pic Model Pic Model Pic Model Pic Click here
712 GetModel Model Pic Model Pic Model Pic Model Pic Click here
714 GetModel Model Pic Model Pic Model Pic Model Pic Click here
718 GetModel Model Pic Model Pic Model Pic Model Pic Click here
Tri a gliadin - Sequence Search :
Sequence Header Sequence
Tri a gliadin
SDAP Sequence ID: 696
SDAP Allergen ID: 687
MKTFLILALLAIVATTATTAVRVPVPQLQPQNPSQQQPQEQVPLVQQQQFLGQQQPFPPQQPYPQPQPFPSQQPYLQLQPFLQPQLPYSQPQPFRPQQPYPQPQPQYSQPQQPISQQQQQQQQQQQQQQQQQQQIIQQILQQQLIPCMDVVLQQHNIVHGKSQVLQQSTYQLLQELCCQHLWQIPEQSQCQAIHNVVHAIILHQQQKQQQQPSSQVSFQQPLQQYPLGQGSFRPSQQNPQAQGSVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCTIAPFGIFGTN
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a gliadin
SDAP Sequence ID: 697
SDAP Allergen ID: 687
MKTFLILALLAIVATTATTAVRVPVPQLQPQNPSQQQPQEQVPLVQQQQFPGQQQQFPPQQPYPQPQPFPSQQPYLQLQPFPQPQPFPPLPYPQPQSFPPQQPYPQQQPQYLQPQQPISQQQAQQQQQQQQQQQQQQQILQQILQQQLIPCRDVVLQQHNIAHASSQVLQQSTYQLLQQLCCQQLLQIPEQSQCQAIHNVAHAIIMHQQQQQQQEQKQQLQQQQQQQQQLQQQQQQQQQQPSSQVSFQQPQQQYPSSQVSFQPSQLNPQAQGSVQPQQLPQFAEIRNLALQTLPAMCNVYIPPHCSTTIAPFGISGTN
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a gliadin
SDAP Sequence ID: 698
SDAP Allergen ID: 687
PQPQPQYSQPQQPISQQQQQQQQQQQQQQQEQQILQQILQQQLIPCMDVVLQQHNIAHGRSQVLQQSTYQLLQELCCQHLWQIPEQSQCQAIHNVVHAIILHQQQQKQQQQPSSQFSFQQPLQQYPLGQGSFRPSQQNPQAQGSVQPQQLPQFEIRNLALQTLPAMCNVYIPPYCTIAPFGIFGTN
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a gliadin
SDAP Sequence ID: 699
SDAP Allergen ID: 687
MKTFLILALLAIVATTATTAVRVPVPQPQPQNPSQPQPQGQVPLVQQQQFPGQQQQFPPQQPYPQPQPFPSQQPYLQLQPFPQPQPFPPQLPYPQPPPFSPQQPYPQPQPQYPQPQQPISQQQAQQQQQQQQQQQQQQQQQQILQQILQQQLIPCRDVVLQQHNIAHARSQVLQQSTYQPLQQLCCQQLWQIPEQSRCQAIHNVVHAIILHQQQRQQQPSSQVSLQQPQQQYPSGQGFFQPSQQNPQAQGSVQPQQLPQFEEIRNLALQTLPRMCNVYIPPYCSTTIAPFGIFGTN
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a gliadin
SDAP Sequence ID: 700
SDAP Allergen ID: 687
MKTFLILVLLAIVATTATTAVRFPVPQLQPQNPSQQQPQEQVPLVQQQQFLGQQQPFPPQQPYPQPQPFPSQLPYLQLQPFPQPQLPYSQPQQFRPQQPYPQPQPQYSQPQQPISQQQQQQQQQQQQQQQQQQILQQILQQQLIPCMDVVLQQHNIAHGRSQVLQQSTYQLLQELCCQHLWQIPEQSQCQAIHNVVHAIILHQQQKQQQQPSSQVSFQQPLQQYPLGQGSFRPSQQNPQAQGSVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCTIAPFGIFGTN
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a gliadin
SDAP Sequence ID: 701
SDAP Allergen ID: 687
MKTFLILVLLAIVATTATTAVRFPVPQLQPQNPSQQQPQEQVPLVQQQQFLGQQQPFPPQQPYPQPQPFPSQLPYLQLQPFPQPQLPYSQPQPFRPQQPYPQPQPQYSQPQQPISQQQQQQQQQQQQQQQQQQILQQILQQQLIPCMDVVLQQHNIAHGRSQVLQQSTYQLLQELCCQHLWQIPEQSQCQAILKVVHAIILHQQQKQQQQPSSQVSFQQPLQQYPLGQGSFRPSQQNPQAQGSVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCTIAPFGIFGTN
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a gliadin
SDAP Sequence ID: 702
SDAP Allergen ID: 687
MKTFLILALVATTATTAVRVPVPQLQPKNPSQQQPQEQVPLVQQQQFPGQQQQFPPQQPYPQPQPFPSQQPYLQLQPFPQPQPFLPQLPYPQPQSFPPQQPYPQQRPMYLQPQQPISQQQAQQQQQQQQQQQQQQQQQILQQILQQQLIPCRDVVLQQHNIAHASSQVLQQSTYQLLQQLCCQQLLQIPEQSRCQAIHNVVHAIIMHQQEQQQQLQQQQQQQLQQQQQQQQQQQQPSSQVSFQQPQQQYPSSQGSFQPSQQNPQAQGSVQPQQLPQFAEIRNLALQTLPAMCNVYIPPHCSTTIAPFGIFGTN
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a gliadin
SDAP Sequence ID: 703
SDAP Allergen ID: 687
MKTFLILALVATTATTAVRVPVPQLQPKNPSQQQPQEQVPLVQQQQFPGQQQQFPPQQPYPQPQPFPSQQPYLQLQPFPQPQPFLPQLPYPQPQSFPPQQPYPQQRPKYLQPQQPISQQQAQQQQQQQQQQQQQQQQQILQQILQQQLIPCRDVVLQQHNIAHASSQVLQQSTYQLLQQLCCQQLLQIPEQSRCQAIHNVVHAIIMHQQEQQQQLQQQQQQQLQQQQQQQQQQQQPSSQVSFQQPQQQYPSSQGSFQPSQQNPQAQGSVQPQQLPQFAEIRNLALQTLPAMCNVYIPPHCSTTIAPFGIFGTN
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a gliadin
SDAP Sequence ID: 704
SDAP Allergen ID: 687
MKTFLILVLLAIVATTATTAVRFPVPQLQPQNPSQQQPQEQVPLVQQQQFLGQQQPFPPQQPYPQPQPFPSQLPYLQLQPFPQPQLPYSQPQPFRPQQPYPQPQPQYSQPQQPISQQQQQQQQQQQQQQQQQQILQQILQQQLIPCMDVVLQQHNIAHGRSQVLQQSTYQLLQELCCQHLWQIPEQSQCQAIHNVVHAIILHQQQKQQQQPSSQVSFQQPLQQYPLGQGSFRPSQQNPQAQGSVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCTIAPFGIFGTN
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a gliadin
SDAP Sequence ID: 705
SDAP Allergen ID: 687
MKTFLILALLAIVATTATTAVRVPVPQLQPQNPSQQQPQEQVPLVQQQQFLGQQQPFPPQQPYPQPQPFPSQQPYLQLQPFLQPQLPYSQPQPFRPQQPYPQPQPQYSQPQQPISQQQQQQQQQQQQQQQQQQQIIQQILQQQLIPCMDVVLQQHNIVHGKSQVLQQSTYQLLQELCCQHLWQIPEQSQCQAIHNVVHAIILHQQQKQQQQPSSQVSFQQPLQQYPLGQGSFRPSQQNPQAQGSVQPQQLPQFEEIRNLARK
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a gliadin
SDAP Sequence ID: 706
SDAP Allergen ID: 687
MKTFPILALLAIVATTATTAVRVPVPQLQLQNPSQQQPQEQVPLVQEQQFQGQQQPFPPQQPYPQPQPFPSQQPYLQLQPFPQPQLPYPQPQPFRPQQPYPQPQPQYSQPQQPISQQQQQQQQQQQQQQQILQQILQQQLIPCRDVVLQQHNIAHGSSQVLQESTYQLVQQLCCQQLWQIPEQSRCQAIHNVVHAIILHQQHHHHQQQQQQQQQQPLSQVSFQQPQQQYPSGQGFFQPSQQNPQAQGSFQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCTIAPFGIFGTN
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a gliadin
SDAP Sequence ID: 707
SDAP Allergen ID: 687
MKTFLILALLAIVATTATSAVRVPVPQLQPQNPSQQQPQEQVPLMQQQQQFPGQQEQFPPQQPYPHQQPFPSQQPYPQPQPFPPQLPYPQTQPFPPQQPYPQPQPQYPQPQQPISQQQAQQQQQQQQTLQQILQQQLIPCRDVVLQQHNIAHASSQVLQQSSYQQLQQLCCQQLFQIPEQSRCQAIHNVVHAIILHHHQQQQQQPSSQVSYQQPQEQYPSGQVSFQSSQQNPQAQGSVQPQQLPQFQEIRNLALQTLPAMCNVYIPPYCSTTIAPFGIFGTN
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a gliadin
SDAP Sequence ID: 708
SDAP Allergen ID: 687
MKTFLILALRAIVATTATIAVRVPVPQLQPQNPSQQQPQKQVPLVQQQQFPGQQQPFPPQQPYPQQQPFPSQQPYMQLQPFPQPQLPYPQPQLPYPQPQPFRPQQSYPQPQPQYSQPQQPISQQQQQQQQQQQQQQQILQQILQQQLIPCRDVVLQQHSIAHGSSQVLQQSTYQLVQQFCCQQLWQIPEQSRCQAIHNVVHAIILHQQQQQQQQQQQQQQQPLSQVCFQQSQQQYPSGQGSFQPSQQNPQAQGSVQPQQLPQFEEIRNLALETLPAMCNVYIPPYCTIAPVGIFGTN
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a gliadin
SDAP Sequence ID: 709
SDAP Allergen ID: 687
MKTFLILALLAIVATTATTAVRVPVPQLQPQNPSQQQPQEQVPLVQQQQFPGQQQQFPPQQPYPQPQPFPSQQPYLQLQPFPQPQPFPPQLPYPQPQSFPPQQPYPQQQPQYLQPQQPISQQQAQQQQQQQQQQQQQQQILQQILQQQLIPCRDVVLQQHNIAHASSQVLQQSTYQLLQQLCCQQLLQIPEQSQCQAIHNVAHAIIMHQQQQQQQEQKQQLQQQQQQQQQLQQQQQQQQQQPSSQVSFQQPQQQYPSSQVSFQPSQLNPQAQGSVQPQQLPQFAEIRNLALQTLPAMCNVYIPPHCSTTIAPFGISGTN
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a gliadin
SDAP Sequence ID: 710
SDAP Allergen ID: 687
MKTFLILALLAIVATTARIAVRVPVPQLQPQNPSQQQPQEQVPLVQQQQFPGQQQPFPPQQPYPQPQPFPSQQPYLQLQPFPQPQLPYPQPQLPYPQPQLPYPQPQPFRPQQPYPQSQPQYSQPQQPISQQQQQQQQQQQQKQQQQQQQQILQQILQQQLIPCRDVVLQQHSIAYGSSQVLQQSTYQLVQQLCCQQLWQIPEQSRCQAIHNVVHAIILHQQQQQQQQQQQQPLSQVSFQQPQQQYPSGQGSFQPSQQNPQAQGSVQPQQLPQFEEIRNLALETLPAMCNVYIPPYCTIAPVGIFGTN
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a gliadin
SDAP Sequence ID: 711
SDAP Allergen ID: 687
MKTFLILVLLAIVATTATTAVRFPVPQLQPQNPSQQLPQEQVPLVQQQQFLGQQQPFPPQQPYPQPQPFPSQLPYLQLQPFPQPQLPYSQPQPFRPQQPYPQPQPQYSQPQQPISQQQQQQQQQQQQQQQQQQILQQILQQQLIPCMDVVLQQHNIAHGRSQVLQQSTYQLLQELCCQHLWQIPEQSQCQAIHNVVHAIILHQQQKQQQQPSSQVSFQQPLQQYPLGQGSFRPSQQNPQAQGSVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCTIAPFGIFGTN
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a gliadin
SDAP Sequence ID: 712
SDAP Allergen ID: 687
MKTLLILTILAMATTIATANMQVDPSGQVQWPQQQPFPQPQQPFCQQPQRTIPQPHQTFHHQPQQTFPQPQQTYPHQPQQQFPQTQQPQQPFPQPQQTFPQQPQLPFPQQPQQPFPQPQQPQQPFPQSQQPQQPFPQPQQQFPQPQQPQQSFPQQQQPAIQSFLQQQMNPCKNFLLQQCNHVSLVSSLVSIILPRSDCQVMQQQCCQQLAQIPQQLQCAAIHSVAHSIIMQQEQQQGVPILRPLFQLAQGLGIIQPQQPAQLEGIRSLVLKTLPTMCNVYVPPDCSTINVPYANIDAGIGGQ
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a gliadin
SDAP Sequence ID: 713
SDAP Allergen ID: 687
MKTLLILTILAMAITIGTANIQVDPSGQVQWLQQQLVPQLQQPLSQQPQQTFPQPQQTFPHQPQQQVPQPQQPQQPFLQPQQPFPQQPQQPFPQTQQPQQPFPQQPQQPFPQTQQPQQPFPQQPQQPFPQTQQPQQPFPQLQQPQQPFPQPQQQLPQPQQPQQSFPQQQRPFIQPSLQQQLNPCKNILLQQSKPASLVSSLWSIIWPQSDCQVMRQQCCQQLAQIPQQLQCAAIHSVVHSIIMQQQQQQQQQQGIDIFLPLSQHEQVGQGSLVQGQGIIQPQQPAQLEAIRSLVLQTLPSMCNVYVPPECSIMRAPFASIVAGIGGQ
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a gliadin
SDAP Sequence ID: 714
SDAP Allergen ID: 687
MKTLLILTILAMAITIATANMQADPSGQVQWPQQQPFLQPHQPFSQQPQQIFPQPQQTFPHQPQQQFPQPQQPQQQFLQPRQPFPQQPQQPYPQQPQQPFPQTQQPQQPFPQSKQPQQPFPQPQQPQQSFPQQQPSLIQQSLQQQLNPCKNFLLQQCKPVSLVSSLWSIILPPSDCQVMRQQCCQQLAQIPQQLQCAAIHSVVHSIIMQQEQQEQLQGVQILVPLSQQQQVGQGILVQGQGIIQPQQPAQLEVIRSLVLQTLPTMCNVYVPPYCSTIRAPFASIVASIGGQ
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a gliadin
SDAP Sequence ID: 715
SDAP Allergen ID: 687
MKTFLVFALIAVVATSAIAQMETSCISGLERPWQQQPLPPQQSFSQQPPFSQQQQQPLPQQPSFSQQQPPFSQQQPILSQQPPFSQQQQPVLPQQSPFSQQQQLVLPPQQQQQQLVQQQIPIVQPSVLQQLNPCKVFLQQQCSPVAMPQRLARSQMWQQSSCHVMQQQCCQQLQQIPEQSRYEAIRAIIYSIILQEQQQGFVQPQQQQPQQSGQGVSQSQQQSQQQLGQCSFQQPQQQLGQQPQQQQQQQVLQGTFLQPHQIAHLEAVTSIALRTLPTMCSVNVPLYSATTSVPFGVGTGVGAY
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a gliadin
SDAP Sequence ID: 716
SDAP Allergen ID: 687
TITRTFPIPTISSNNNHHFRSNSNHHFHSNNNQFYRNNNSPGHNNPLNNNNSPNNNSPSNHHNNSPNNNFQYHTHPSNHKNLPHTNNIQQQQPPFSQQQQPPFSQQQQPVLPQQSPFSQQQQLVLPPQQQQQQLVQQQIPIVQPSVLQQLNPCKVFLQQQCSPVAMPQRLARSQMWQQSSCHVMQQQCCQQLQQIPEQSRYEAIRAIIYSIILQEQQQGFVQPQQQQPQQSGQGVSQSQQQSQQQLGQCSFQQPQQQLGQQPQQQQQQQVLQGTFLQPHQIAHLEAVTSIALRTLPTMCSVNVPLYSATTSVPFGVGTGVGAY
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a gliadin
SDAP Sequence ID: 717
SDAP Allergen ID: 687
PQQPFPLQPQQSFLWQSQQPFLQQPQQPSPQPQQVVQIISPATPTTIPSAGKPTSAPFPQQQQQHQQLAQQQIPVVQPSILQQLNPCKVFLQQQCSPVAMPQRLARSQMLQQSSCHVMQQQCCQQLPQIPQQSRYQAIRAIIYSIILQEQQQVQGSIQSQQQQPQQLGQCVSQPQQQSQQQLGQQPQQQQLAQGTFLQPHQIAQLEVMTSIALRILPTMCSVNVPLYRTTTSVPFGVGTGVGAY
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a gliadin
SDAP Sequence ID: 718
SDAP Allergen ID: 687
MKTFLILALLAIVATTATTAVRVPVPQPQPQNPSQPQPQRQVPLVQQQQFPGQQQQFPPQQPYPQPQPFPSQQPYLQLQPFPQPQPFPPQLPYPQPPPFSPQQPYPQPQPQYPQPQQPISQQQAQQQQQQQQQQQQQQQQQQILPQILQQQLIPCRDVVLQQHNIAHARSQVLQQSTYQPLQQLCCQQLWQIPEQSRCQAIHNVVHAIILHQQQQQQQPSSQVSLQQPQQQYPSGQGFFQPSQQNPQAQGSVQPQQLPQFEEIRNLALQTLPRMCNVYIPPYCSTTTAPFGIFGTN
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a gliadin
SDAP Sequence ID: 719
SDAP Allergen ID: 687
MKTLLILTILAMAITIGTANMQVDPSSQVQWPQQQPVPQPHQPFSQQPQQTFPQPQQTFPHQPQQQFPQPQQPQQQFLQPQQPFPQQPQQPYPQQPQQPFPQTQQPQQLFPQSQQPQQQFSQPQQQFPQPQQPQQSFPQQQPPFIQPSLQQQVNPCKNFLLQQCKPVSLVSSLWSMIWPQSDCQVMRQQCCQQLAQIPQQLQCAAIHTIIHSIIMQQEQQEQQQGMHILLPLYQQQQVGQGTLVQGQGIIQ
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a gliadin
SDAP Sequence ID: 720
SDAP Allergen ID: 687
VCALRGAAVPTQTIQPLRPFFFLPEQRNQQTCPLPPQQRGVLLSCAFQNQQQQVVFFEQITQQQISTFQPLQIFILSVSQPQQQQSQQQLGQQPQQQQQLAQQGTFLQPQQVAQLELMTSIALRTLPSMCRVNVPLSRTTTSVPFGGGAVGAYR
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a gliadin
SDAP Sequence ID: 721
SDAP Allergen ID: 687
NIQVDPSGQVQWPQQQPFPQPHQPFSQQPQQTFPQPQQTFPHQPQQQFSQPQQPQQQFIQPQQPFPQQPQQTYPQRPQQPFPQTQQPQQPFPQSQQPQQPFPQPQQQFPQPQQPQQSFPQQQPSLIQQSLQQQLNPCKNFLLQQCKPVSLVSSLWSMILPRSDCQVMRQQCCQQLAQIPQQLQCAAIHSIVHSIIMQQEQQEQRQGVQILVPLSQQQQVGQGTLVQGQGIIQPQQPAQLEVIRSSVLQTLATMCNVYVPPYCSTIRAPFASIVAGIGGQ
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a gliadin
SDAP Sequence ID: 825
SDAP Allergen ID: 687
ARQLNPSDQELQSPQQLYPQQPYPQQPY
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a gliadin - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Tri a gliadin 60.9 0.43 2NNA_C 83.333 18 291 227 - 244 1 - 18 0.058 32 Download (SI: 706)
Tri a gliadin 59.2 0.42 2NNA_C 88.889 18 297 233 - 250 1 - 18 0.008 34.7 Download (SI: 708)
Tri a gliadin 43.15 0.24 2NNA_C 77.778 18 262 223 - 240 1 - 18 0.11 31.2 Download (SI: 705)
Tri a gliadin 51.7 0.41 1TMQ_B 35.294 34 323 184 - 217 40 - 73 0.055 34.7 Download (SI: 716)
Tri a gliadin 81.55 0.21 5JYD_A 47.619 21 28 6 - 26 15 - 35 2.7 24.6 Download (SI: 825)
Tri a gliadin 56.6 0.43 1HSS_A 33.333 42 279 165 - 206 35 - 76 0.016 36.2 Download (SI: 721)
Tri a gliadin 58.8 0.41 2NNA_C 77.778 18 286 222 - 239 1 - 18 0.11 31.2 Download (SI: 701)
Tri a gliadin 59.55 0.41 2NNA_C 83.333 18 296 230 - 247 1 - 18 0.068 32 Download (SI: 718)
Tri a gliadin 53.75 0.41 1HSS_A 33.333 39 302 199 - 237 35 - 73 0.046 35 Download (SI: 712)
Tri a gliadin 59.45 0.39 2NNA_C 77.778 18 319 253 - 270 1 - 18 1.3 28.5 Download (SI: 709)
Tri a gliadin 60.05 0.42 2NNA_C 83.333 18 313 247 - 264 1 - 18 0.042 32.7 Download (SI: 702)
Tri a gliadin 59.4 0.4 2NNA_C 88.889 18 307 243 - 260 1 - 18 0.01 34.3 Download (SI: 710)
Tri a gliadin 57.75 0.42 1HSS_A 34.211 38 282 170 - 207 41 - 78 0.12 33.5 Download (SI: 707)
Tri a gliadin 55.95 0.42 7EEB_B 21.277 47 291 87 - 133 445 - 488 0.034 37 Download (SI: 714)
Tri a gliadin 59.25 0.4 2NNA_C 77.778 18 318 252 - 269 1 - 18 1.3 28.5 Download (SI: 697)
Tri a gliadin 59.65 0.41 2NNA_C 83.333 18 313 247 - 264 1 - 18 0.042 32.7 Download (SI: 703)
Tri a gliadin 44.25 0.12 7DCY_A 34.091 44 154 9 - 50 350 - 388 2.9 29.3 Download (SI: 720)
Tri a gliadin 67.5 0.48 2NNA_C 77.778 18 186 123 - 140 1 - 18 0.058 31.6 Download (SI: 698)
Tri a gliadin 58.65 0.41 2NNA_C 77.778 18 286 222 - 239 1 - 18 0.11 31.2 Download (SI: 700)
Tri a gliadin 59.65 0.41 2NNA_C 77.778 18 286 222 - 239 1 - 18 0.12 31.2 Download (SI: 704)
Tri a gliadin 59.4 0.41 2NNA_C 77.778 18 286 222 - 239 1 - 18 0.11 31.2 Download (SI: 711)
Tri a gliadin 59.75 0.46 4CVW_C 22 50 244 117 - 166 41 - 90 0.004 37.7 Download (SI: 717)
Tri a gliadin 59.45 0.41 2NNA_C 83.333 18 296 230 - 247 1 - 18 0.067 32 Download (SI: 699)
Tri a gliadin 53.9 0.4 1BIP_A 29.231 65 304 145 - 199 10 - 74 0.064 34.7 Download (SI: 715)
Tri a gliadin 58.15 0.41 2NNA_C 77.778 18 287 223 - 240 1 - 18 0.11 31.2 Download (SI: 696)
Tri a gliadin 43.25 0.17 1HSS_A 33.333 42 251 184 - 225 35 - 76 0.005 37.4 Download (SI: 719)
Tri a gliadin 51.95 0.37 1HSS_A 32.143 56 327 212 - 267 35 - 88 0.016 36.2 Download (SI: 713)
Tri a gliadin - Alphafold Theoretical Model Structure
Model Structure
825_relaxed_rank_1_model_4.pdb


Coverage Plddt
Tri a gliadin - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
473876 Click here to process the data
170710 Click here to process the data
170728 Click here to process the data
21757 Click here to process the data
21761 Click here to process the data
21755 Click here to process the data
21765 Click here to process the data
170718 Click here to process the data
170720 Click here to process the data
170722 Click here to process the data
170712 Click here to process the data
170726 Click here to process the data
170724 Click here to process the data
170716 Click here to process the data
21673 Click here to process the data
21753 Click here to process the data
170702 Click here to process the data
170738 Click here to process the data
170708 Click here to process the data
170730 Click here to process the data
170732 Click here to process the data
170734 Click here to process the data
170740 Click here to process the data
170736 Click here to process the data
21769 Click here to process the data
1063270 Click here to process the data
P02865 Click here to process the data
Tri a gliadin - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
696 687 147 276 147 276 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
697 687 134 206 132 206 PF13016 Gliadin Family CL0482 Cys-rich Gliadin N-terminal
698 687 46 175 46 175 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
699 687 155 283 155 283 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
700 687 146 275 146 275 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
701 687 146 275 146 275 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
702 687 134 206 132 206 PF13016 Gliadin Family CL0482 Cys-rich Gliadin N-terminal
703 687 151 300 151 300 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
704 687 146 275 146 275 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
705 687 130 201 128 202 PF13016 Gliadin Family CL0482 Cys-rich Gliadin N-terminal
706 687 143 280 143 280 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
707 687 140 269 140 269 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
708 687 133 204 132 205 PF13016 Gliadin Family CL0482 Cys-rich Gliadin N-terminal
709 687 152 222 152 227 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
710 687 163 296 163 296 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
711 687 146 275 146 275 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
712 687 154 230 154 230 PF13016 Gliadin Family CL0482 Cys-rich Gliadin N-terminal
713 687 167 243 167 243 PF13016 Gliadin Family CL0482 Cys-rich Gliadin N-terminal
714 687 132 208 132 208 PF13016 Gliadin Family CL0482 Cys-rich Gliadin N-terminal
715 687 117 193 117 194 PF13016 Gliadin Family CL0482 Cys-rich Gliadin N-terminal
716 687 136 212 136 213 PF13016 Gliadin Family CL0482 Cys-rich Gliadin N-terminal
717 687 70 146 70 147 PF13016 Gliadin Family CL0482 Cys-rich Gliadin N-terminal
718 687 155 283 155 283 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
719 687 139 215 139 215 PF13016 Gliadin Family CL0482 Cys-rich Gliadin N-terminal
721 687 120 196 120 196 PF13016 Gliadin Family CL0482 Cys-rich Gliadin N-terminal
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Tri a gliadin - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
No epitope information found!
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.