The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology



SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Info Description
Allergen ID 689
Allergen Scientific Name Tri a glutenin
Allergen Species - Systematic Name Triticum aestivum
Allergen Species - Common Name wheat
Allergen Common source foods
Allergen Common name
Allergen Keywords glutenin
Allergen IUIS (Yes=1, No=0) 0
ID Allergen Name
Tri a glutenin - References
ID Reference
No reference found!
Tri a glutenin - Protein Sequences
Source Link to source
GenBank 21779
GenBank 21773
GenBank 21751
GenBank 897811
GenBank 21793
GenBank 736319
GenBank 32968199
GenBank 21783
GenBank 21926
GenBank 21743
GenBank 21930
GenBank 22090
GenBank 170743
GenBank 886961
GenBank 886963
GenBank 886965
GenBank 886967
SwissProt Q9S8D7
Tri a glutenin - Theoretical Model Structure
Model ID PDB file PDB Snapshot PDB Snapshot 90 PDB Snapshot 180 PDB Snapshot 270 3D PDB View
723 GetModel Model Pic Model Pic Model Pic Model Pic Click here
733 GetModel Model Pic Model Pic Model Pic Model Pic Click here
Tri a glutenin - Sequence Search :
Sequence Header Sequence
Tri a glutenin
SDAP Sequence ID: 723
SDAP Allergen ID: 689
MAKRLVLFAAVVIALVALTTAEGEASRQLQCERELQESSLEACRQVVDQQLAGRLPWSTGLQMRCCQQLRDVSAKCRSVAVSQVARQYEQTVVPPKGGSFYPGETTPLQQLQQGIFWGTSSQTVQGYYPSVTSPRQGSYYPGQASPQQPGQGQQPGKWQEPGQGQQWYYPTSLQQPGQGQQIGKGKQGYYPTSLQQPGQGQQIGQGQQGYYPTSPQHTGQRQQPVQGQQIGQGQQPEQGQQPGQWQQGYYPTSPQQLGQGQQPGQWQQSGQGQQGHYPTSLQQPGQGQQGHYLASQQQPAQGQQGHYPASQQQPGQGQQGHYPASQQQPGQGQQGHYPASQQEPGQGQQGQIPASQQQPGQGQQGHYPASLQQPGQQGHYPTSLQQLGQGQQIGQPGQKQQPGQGQQTGQGQQPEQEQQPGQGQQGYYPTSLQQPGQGQQQGQGQQGYYPTSLQQPGQGQQGHYPASLQQPGQGQGQPGQRQQPGQGQHPEQGQQPGQGQQGYYPTSPQQPGQGQQLGQGQQGYYPTSPQQPGQGQQPGQGQQGHCPMSPQQTGQAQQLGQGQQIGQVQQPGQGQQGYYPTSLQQPGQGQQSGQGQQSGQGHQPGQGQQSGQEKQGYDSPYHVSAEQQAASPMVAKAQQPATQLPTVCRMEGGDALSASQ
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a glutenin
SDAP Sequence ID: 724
SDAP Allergen ID: 689
MKTFLVFALLAVAATSAIAQMETRCIPGLERPWQQQPLPPQQTFPQQPLFSQQQQQQLFPQQPSFSQQQPPFWQQQPPFSQQQPILPQQPPFSQQQQLVLPQQPPFSQQQQPVLPPQQSPFPQQQQQHQQLVQQQIPVVQPSILQQLNPCKVFLQQQCSPVAMPQRLARSQMLQQSSCHVMQQQCCQQLPQIPQQSRYEAIRAIIYSIILQEQQQVQGSIQSQQQQPQQLGQCVSQPQQQSQQQLGQQPQQQQLAQGTFLQPHQIAQLEVMTSIALRILPTMCSVNVPLYRTTTSVPFGVGTGVGAY
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a glutenin
SDAP Sequence ID: 725
SDAP Allergen ID: 689
MAKRLVLFAAVVIALVALTTAEGEASRQLQCERELQESSLEACRQVVDQQLAGRLPWSTGLQMRCCQQLRDVSAKCRSVAVSQVARQYEQTVVPPKGGSFYPGETTPLQQLQQGIFWGTSSQTVQGYYPGVTSPRQGSYYPGQASPQQPGQGQQPGKWQEPGQGQQWYYPTSLQQPGQGQQIGKGQQGYYPTSLQQPGQGQQGYYPTSLQHTGQRQQPVQGQQPEQGQQPGQWQQGYYPTSPQQLGQGQQPRQWQQSGQGQQGHYPTSLQQPGQGQQGHYLASQQQPGQGQQGHYPASQQQPGQGQQGHYPASQQQPGQGQQGHYPASQQEPGQGQQGQIPASQQQPGQGQQGHYPASLQQPGQGQQGHYPTSLQQLGQGQQTGQPGQKQQPGQGQQTGQGQQPEQEQQPGQGQQGYYPTSLQQPGQGQQQGQGQQGYYPTSLQQPGQGQQGHYPASLQQPGQGQPGQRQQPGQGQHPEQGKQPGQGQQGYYPTSPQQPGQGQQLGQGQQGYYPTSPQQPGQGQQPGQGQQGHCPTSPQQSGQAQQPGQGQQIGQVQQPGQGQQGYYPTSVQQPGQGQQSGQGQQSGQGHQPGQGQQSGQEQQGYDSPYHVSAEQQAASPMVAKAQQPATQLPTVCRMEGGDALSASQ
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a glutenin
SDAP Sequence ID: 726
SDAP Allergen ID: 689
EKLGQGQQPRQWLQPRQGQQGYYPTSPQQSGQGQQLGQGQQGYYPTSPQQSGQGQQGYDSPYHVSAEHQAASLKVAKAQQLAAQLPAMCRLEGGDALLASQ
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a glutenin
SDAP Sequence ID: 727
SDAP Allergen ID: 689
LVSVEHQAARLKVAKAQQLAAQLPAMCRLEGGDALSASQ
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a glutenin
SDAP Sequence ID: 728
SDAP Allergen ID: 689
MAKRLVLFVAVVVALVALTVAEGEASEQLQCERELQELQERELKACQQVMDQQLRDISPECHPVVVSPVAGQYEQQIVVPKGGSFYPGETTPPQQLQQRIFWGIPALLKRYYPSVTSPQQVSYYPGQASPQRPGQGQQPGQGQQSGQGQQGYYPTSPQQPGQWQQPEQGQPGYYPTSPQQPGQLQQPAQGQQPGQGQQGRQPGQGQPGYYPTSSQLQPGQLQQPAQGQQGQQPGQGQQGQQPGQGQQPGQGQQGQQPGQGQQPGQGQQGQQLGQGQQGYYPTSLQQSGQGQPGYYPTSLQQLGQGQSGYYPTSPQQPGQGQQPGQLQQPAQGQQPEQGQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSPQQSGQGQPGYYPTSSQQPTQSQQPGQGQQGQQVGQGQQAQQPGQGQQPGQGQPGYYPTSPLQSGQGQPGYYLTSPQQSGQGQQPGQLQQSAQGQKGQQPGQGQQPGQGQQGQQPGQGQQGQQPGQGQPGYYPTSPQQSGQGQQPGQWQQPGQGQPGYYPTSPLQPGQGQPGYDPTSPQQPGQGQQPGQLQQPAQGQQGQQLAQGQQGQQPAQVQQGQQPAQGQQGQQLGQGQQGQQPGQGQQPAQGQQGQQPGQGQQGQQPGQGQQPGQGQPWYYPTSPQESGQGQQPGQWQQPGQWQQPGQGQPGYYLTSPLQLGQGQQGYYPTSLQQPGQGQQPGQWQQSGQGQHGYYPTSPQLSGQGQRPGQWLQPGQGQQGYYPTSPQQSGQGQQLGQWLQPGQGQQGYYPTSLQQTGQGQQSGQGQQGYYSSYHVSVEHQAASLKVAKAQQLAAQLPAMCRLEGGDALSASQ
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a glutenin
SDAP Sequence ID: 729
SDAP Allergen ID: 689
MAKRLVLFVAVVVALVALTVAEGEASEQLQCERELQELQERELKACQQVMDQQLRDISPECHPVVVSPVAGQYEQQIVVPPKGGSFYPGETTPPQQLQQRIFWGIPALLKRYYPSVTCPQQVSYYPGQASPQRPGQGQQPGQGQQGYYPTSPQQPGQWQQPEQGQQGYYPTSPQQPGQLQQPAQGQQPGQGQQGQQPGQGQPGYYPTSSQLQPGQLQQPAQGQQGQQPGQAQQGQQPGQGQQPGQGQQGQQPGQGQQPGQGQQGQQLGQGQQGYYPTSLQQSGQGQPGYYPTSLQQLGQGQSGYYPTSPQQPGQGQQPGQLQQPAQGQQPGQGQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSPQQSGQGQPGYYPTSSQQPTQSQQPGQGQQGQQVGQGQQAQQPGQGQQPGQGQPGYYPTSPQQSGQGQPGYYLTSPQQSGQGQQPGQLQQSAQGQKGQQPGQGQQPGQGQQGQQPGQGQQGQQPGQGQPGYYPTSPQQSGQGQQPGQWQQPGQGQPGYYPTSPLQPGQGQPGYDPTSPQQPGQGQQPGQLQQPAQGQQGQQLAQGQQGQQPAQVQQGQQPAQGQQGQQLGQGQQGQQPGQGQQGQQPAQGQQGQQPGQGQHGQQPGQGQQGQQPGQGQQPGQGQPWYYPTSPQESGQGQQPGQWQQPGQGQPGYYLTFSVAARTGQQGYYPTSLQQPGQGQQPGQWQQSGQGQHWYYPTSPKLSGQGQRPGQWLQPGQGQQGYYPTSPQQPPQGQQLGQWLQPGQGQQGYYPTSLQQTGQGQQSGQGQQGYYSSYHVSVEHQAASLKVAKAQQLAAQLPAMCRLEGGDALSASQ
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a glutenin
SDAP Sequence ID: 730
SDAP Allergen ID: 689
MKTFLVFALLALAAASAVAQISQQQQAPPFSQQQQPPFSQQQQPPFSQQQQSPFSQQQQQPPFAQQQQPPFSQQPPISQQQQPPFSQQQQPQFSQQQQPPYSQQQQPPYSQQQQPPFSQQQQPPFSQQQQQPPFTQQQQQQQQQQPFTQQQQPPFSQQPPISQQQQPPFLQQQRPPFSRQQQIPVIHPSVLQQLNPCKVFLQQQCIPVAMQRCLARSQMLQQSICHVMQQQCCQQLRQIPEQSRHESIRAIIYSIILQQQQQQQQQQQQQQGQSIIQYQQQQPQQLGQCVSQPLQQLQQQLGQQPQQQQLAHQIAQLEVMTSIALRTLPTMCNVNVPLYETTTSVPLGVGIGVGVY
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a glutenin
SDAP Sequence ID: 731
SDAP Allergen ID: 689
MKTFLVFALLAVVATSTIAQMETSCIPGLERPWQEQPLPPQHTLFPQQQPFPQQQQPPFSQQQPSFLQQQPILPQLPFSQQQQPVLPQQSPFSQQQLVLPPQQQYQQVLQQQIPIVQPSVLQQLNPCKVFLQQQCNPVAMPQRLARSQMLQQSSCHVMQQQCCQQLPQIPEQSRYDVIRAITYSIILQEQQQGFVQAQQQQPQQLGQGVSQSQQQSQQQLGQCSFQQPQQQLGQQPQQQQVLQGTFLQPHQIAHLEVMTSIALRTLPTMCSVNVPLYSSTTSVPFSVGTGVGAYL
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a glutenin
SDAP Sequence ID: 732
SDAP Allergen ID: 689
MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQLRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILWGIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQPGQGQQEYYLTSPQQSGQWQQPGQGQAGYYPTSPQQSGQEQPGYYPTSPWQPEQLQQPTQGQQRQQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQQPGQLQQLAQGQQGQQPERGQQGQQSGQGQQLGQGQQGQQPGQKQQSGQGQQGYYPISPQQLGQGQQSGQGQLGYYPTSPQQSGQGQSGYYPTSAQQPGQLQQSTQEQQLGQEQQDQQSGQGRQGQQSGQRQQDQQSGQGQQPGQRQPGYYSTSPQQLGQGQPRYYPTSPQQPGQEQQPRQLQQPEQGQQGQQPEQGQQGQQPGQGEQGQQPGQGQQGQQPGQGQPGYYPTSPQQSGQGQPGYYPTSPQQSGQLQQPAQGQQPGQEQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSPQQSGQEQQLEQWQQSGQGQPGHYPTSPLQPGQGQPGYYPTSPQQIGQGQQPGQLQQPTQGQQGQQPGQGQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSLQQSGQGQQPGQWQQPGQGLPGYYPTSSLQPEQGQQGYYPTSQQQPGQGPQPGQWQQSGQGQQGYYPTSPQQSGQGQQPGQWLQPGQWLQSGYYLTSPQQLGQGQQPRQWLQPRQGQQGYYPTSPQQSGQGQQLGQGQQGYYPTSPQQSGQGQQGYDSPYHVSAEHQAASLKVAKAQQLAAQLPAMCRLEGGDALLASQ
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a glutenin
SDAP Sequence ID: 733
SDAP Allergen ID: 689
MKTFLVFALLAVVATSAIAQMDTSCIPGLERPWQQQPLPPQQTFPQQPPFSQQQQQQPFPQQPSFSQQQPILPQGPPFPQQTQPVLPQQSPFSQQQQLILPPQQQQQLPQQQISIVQPSVLQQLNPCKVFLQQQCSPVAIPQRLARSQMWQQSSCHVMQQQCCQQLSQIPEQSRYDAIRAITYSIILQEQQQGQSQQQQPQQSGQGVSQSQQQSQQQLGQCSFQQPQQQLGQQPQQQQVQQGTFLQPHQIAHLEVMTSIALRTLPTMCSVNVPLYSSTTSVPFGV
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a glutenin
SDAP Sequence ID: 734
SDAP Allergen ID: 689
MAKRLVLFATVVITLVALTAAEGEASRQLQCERELQESSLEACRQVVDQQLAGRLPWSTGLQMRCCQQLRDVSAKCRPVAVSQVVRQYEQTVVPPKGGSFYPGETTPLQQLQQVIFWGTSSQTVQGYYPSVSSPQQGPYYPGQASPQQPGQGQQPGKWQELGQGQQGYYPTSLHQSGQGQQGYYPSSLQQPGQGQQIGQGQQGYYPTSLQQPGQGQQIGQGQQGYYPTSPQHPGQRQQPGQGQQIGQGQQLGQGRQIGQGQQSGQGQQGYYPTSPQQLGQGQQPGQWQQSGQGQQGYYPTSQQQPGQGQQGQYPASQQQPGQGQQGQYPASQQQPGQGQQGQYPASQQQPGQGQQGHYLASQQQPGQGQQRHYPASLQQPGQGQQGHYTASLQQPGQGQQGHYPASLQQVGQGQQIGQLGQRQQPGQGQQTRQGQQLEQGQQPGQGQQTRQGQQLEQGQQPGQGQQGYYPTSPQQSGQGQQPGQSQQPGQGQQGYYSSSLQQPGQGLQGHYPASLQQPGQGHPGQRQQPGQGQQPEQGQQPGQGQQGYYPTSPQQPGQGKQLGQGQQGYYPTSPQQPGQGQQPGQGQQGHCPTSPQQTGQAQQPGQGQQIGQVQQPGQGQQGYYPISLQQSGQGQQSGQGQQSGQGHQLGQGQQSGQEQQGYDNPYHVNTEQQTASPKVAKVQQPATQLPIMCRMEGGDALSASQ
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a glutenin
SDAP Sequence ID: 735
SDAP Allergen ID: 689
MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQLRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILWGIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQEYYLTSPQQSGQWQQPGQGQSGYYPTSPQQSGQKQPGYYPTSPWQPEQLQQPTQGQQRQQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQQPGQLQQLAQGQQGQQPERGQQGQQSGQGQQLGQGQQGQQPGQKQQSGQGQQGYYPISPQQLGQGQQSGQGQLGYYPTSPQQSGQGQSGYYPTSAQQPGQLQQSTQEQQLGQEQQDQQSGQGRQGQQSGQRQQDQQSGQGQQPGQRQPGYYSTSPQQLGQGQPRYYPTSPQQPGQEQQPRQLQQPEQGQQGQQPEQGQQGQQQRQGEQGQQPGQGQQGQQPGQGQPGYYPTSPQQSGQGQPGYYPTSPQQSGQLQQPAQGQQPGQEQQGQQPGQGQQPGQGQPGYYPTSPQQSGQEQQLEQWQQSGQGQPGHYPTSPLQPGQGQPGYYPTSPQQIGQGQQPGQLQQPTQGQQGQQPGQGQQGQQPGEGQQGQQPGQGQQPGQGQPGYYPTSLQQSGQGQQPGQWQQPGQGQPGYYPTSSLQPEQGQQGYYPTSQQQPGQGPQPGQWQQSGQGQQGYYPTSPQQSGQGQQPGQWLQPGQWLQSGYYLTSPQQLGQGQQPRQWLQPRQGQQGYYPTSPQQSGQGQQLGQGQQGYYPTSPQQSGQGQQGYDSPYHVSAEHQAASLKVAKAQQLAAQLPAMCRLEGGDALLASQ
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a glutenin
SDAP Sequence ID: 736
SDAP Allergen ID: 689
FALIAVVATSAIAQMETSHIPSLEKPLQQQPLPLQQILWYQQQQPIQQQPQPFPQQPPCSQQQQPPLSQQQQ
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a glutenin
SDAP Sequence ID: 737
SDAP Allergen ID: 689
FALIAVVATSTIAQMETSCIPGLERPWQQQPLPPQQTLFPQQQPFPQQQPPFSQQQPSFSQQQPPFSQQQPILPEPPFSLQQQPVLPQQSPFSQQQLVLPPQQQQQLPQQQISIVQPSVLQQLNPCKVFLQQQCSPVAMPQRLARSQMWQQSRCHVMQQQCCQQLSQIPEQSRYDAICAITYSIILQEQQQGFVQAQQQQPQQSGQGVSQSQQQSQQQLGQCSFQQPQQ
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a glutenin
SDAP Sequence ID: 738
SDAP Allergen ID: 689
HIPSLEKPLQQQPLPLQQILWYQQQQPIQQQPQPFPQQPPCSQQQQPPLSQQQQPPFSQQQPPFSQQQQPILPQQPPFSQQQQQFPQQQQPLLPQQPPFSQQQPPFSQQQQQPPFSQQQQQPILLQQPPFSQHQQPVLPQQQIPSVQPSILQQLNPCKVFLQQQCSPVAMPQSLARSQMLWQSSCHVMQQQCCRQLPQIPEQSRYDAIRAIIYSIVLQEQQHGQGLNQPQQQQPQQSVQGVSQPQQQQKQLGQCSFQQPQQ
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a glutenin
SDAP Sequence ID: 739
SDAP Allergen ID: 689
HIPSLEKPSQQQPLPLQQILWYHQQQPIQQQPQPFPQQPPCSQQQQPPLSQQQQPPFSQQQPPFSQQELPILPQQPPFSQQQQPQFSQQQQPFPQQQQPLLLQQPPFSQQRPPFSQQQQQPVLPQQPPFSQQQQQQPILPQQPPFSLHQQPVLPQQQIPYVQPSILQQLNPCKVFLQQQCSPVAMPQSLARSQMLWQSSCHVMQQQCCQQLPRIPEQSRYDAIRAIIYSIVLQEQQHGQGFNQPQQQQPQQSVQGVSQPQQQQKQLGQCSFQQPQQ
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a glutenin
SDAP Sequence ID: 827
SDAP Allergen ID: 689
SQQQQPPFSQQQPPFSQQQQPPFSQQQPPF
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a glutenin - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Tri a glutenin 33.95 0.23 3NRE_A 40.351 57 815 675 - 728 145 - 201 0.054 37.7 Download (SI: 735)
Tri a glutenin 33.8 0.25 3NRE_A 40.351 57 830 690 - 743 145 - 201 0.057 37.7 Download (SI: 732)
Tri a glutenin 57.05 0.24 6VCX_A 27.778 54 101 32 - 85 102 - 155 0.84 29.6 Download (SI: 726)
Tri a glutenin 39.1 0.28 1BEA_A 41.667 48 648 40 - 84 17 - 63 0.004 39.3 Download (SI: 725)
Tri a glutenin 48.3 0.32 1BIP_A 40 35 261 188 - 222 40 - 74 0.004 37.7 Download (SI: 738)
Tri a glutenin 55.1 0.42 4CVW_C 24 50 307 180 - 229 41 - 90 0.002 38.9 Download (SI: 724)
Tri a glutenin 47.65 0.3 1BIP_A 37.143 35 276 203 - 237 40 - 74 0.031 35 Download (SI: 739)
Tri a glutenin 38.95 0.27 1BEA_A 41.667 48 660 40 - 84 17 - 63 0.003 39.3 Download (SI: 723)
Tri a glutenin 51.85 0.37 5DOO_A 41.935 31 356 325 - 355 29 - 59 3.4 31.2 Download (SI: 730)
Tri a glutenin 38.55 0.28 1BEA_A 40.816 49 705 40 - 85 17 - 64 0.007 38.5 Download (SI: 734)
Tri a glutenin 74.9 0.34 2YSK_A 51.852 27 39 10 - 33 49 - 75 2.3 25.4 Download (SI: 727)
Tri a glutenin 34.6 0.27 1H1Y_A 26.786 56 839 728 - 783 109 - 164 1.6 33.1 Download (SI: 729)
Tri a glutenin 51.75 0.41 1B1U_A 29.73 74 285 138 - 200 10 - 83 0.19 33.1 Download (SI: 733)
Tri a glutenin 54.5 0.42 4COB_A 23.656 93 295 59 - 145 8 - 100 1.5 31.2 Download (SI: 731)
Tri a glutenin 35.3 0.25 6G1E_A 25.806 62 838 684 - 744 143 - 196 1.8 32.7 Download (SI: 728)
Tri a glutenin - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
21779 Click here to process the data
21773 Click here to process the data
21751 Click here to process the data
897811 Click here to process the data
21793 Click here to process the data
736319 Click here to process the data
32968199 Click here to process the data
21783 Click here to process the data
21926 Click here to process the data
21743 Click here to process the data
21930 Click here to process the data
22090 Click here to process the data
170743 Click here to process the data
886961 Click here to process the data
886963 Click here to process the data
886965 Click here to process the data
886967 Click here to process the data
Q9S8D7 Click here to process the data
Tri a glutenin - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
723 689 1 208 1 209 PF03157 Glutenin_hmw Disordered No_clan High molecular weight glutenin subunit
723 689 174 238 174 238 PF03157 Glutenin_hmw Disordered No_clan High molecular weight glutenin subunit
723 689 218 304 217 305 PF03157 Glutenin_hmw Disordered No_clan High molecular weight glutenin subunit
723 689 296 660 294 660 PF03157 Glutenin_hmw Disordered No_clan High molecular weight glutenin subunit
724 689 133 209 133 210 PF13016 Gliadin Family CL0482 Cys-rich Gliadin N-terminal
725 689 1 288 1 288 PF03157 Glutenin_hmw Disordered No_clan High molecular weight glutenin subunit
725 689 285 476 283 477 PF03157 Glutenin_hmw Disordered No_clan High molecular weight glutenin subunit
725 689 465 648 465 648 PF03157 Glutenin_hmw Disordered No_clan High molecular weight glutenin subunit
726 689 2 101 1 101 PF03157 Glutenin_hmw Disordered No_clan High molecular weight glutenin subunit
727 689 2 39 1 39 PF03157 Glutenin_hmw Disordered No_clan High molecular weight glutenin subunit
728 689 1 613 1 613 PF03157 Glutenin_hmw Disordered No_clan High molecular weight glutenin subunit
728 689 601 838 599 838 PF03157 Glutenin_hmw Disordered No_clan High molecular weight glutenin subunit
729 689 1 601 1 602 PF03157 Glutenin_hmw Disordered No_clan High molecular weight glutenin subunit
729 689 592 839 592 839 PF03157 Glutenin_hmw Disordered No_clan High molecular weight glutenin subunit
730 689 180 256 180 257 PF13016 Gliadin Family CL0482 Cys-rich Gliadin N-terminal
731 689 110 186 110 187 PF13016 Gliadin Family CL0482 Cys-rich Gliadin N-terminal
732 689 1 737 1 737 PF03157 Glutenin_hmw Disordered No_clan High molecular weight glutenin subunit
732 689 694 830 694 830 PF03157 Glutenin_hmw Disordered No_clan High molecular weight glutenin subunit
733 689 110 186 110 187 PF13016 Gliadin Family CL0482 Cys-rich Gliadin N-terminal
734 689 1 190 1 190 PF03157 Glutenin_hmw Disordered No_clan High molecular weight glutenin subunit
734 689 187 251 186 253 PF03157 Glutenin_hmw Disordered No_clan High molecular weight glutenin subunit
734 689 237 325 237 327 PF03157 Glutenin_hmw Disordered No_clan High molecular weight glutenin subunit
734 689 317 534 316 534 PF03157 Glutenin_hmw Disordered No_clan High molecular weight glutenin subunit
734 689 523 705 522 705 PF03157 Glutenin_hmw Disordered No_clan High molecular weight glutenin subunit
735 689 1 722 1 722 PF03157 Glutenin_hmw Disordered No_clan High molecular weight glutenin subunit
735 689 675 815 675 815 PF03157 Glutenin_hmw Disordered No_clan High molecular weight glutenin subunit
737 689 109 185 109 186 PF13016 Gliadin Family CL0482 Cys-rich Gliadin N-terminal
738 689 140 216 140 217 PF13016 Gliadin Family CL0482 Cys-rich Gliadin N-terminal
739 689 155 231 155 232 PF13016 Gliadin Family CL0482 Cys-rich Gliadin N-terminal
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Tri a glutenin - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
No epitope information found!
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.