The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Info Description
Allergen ID 261
Allergen Scientific Name Ves v 5
Allergen Species - Systematic Name Vespula vulgaris
Allergen Species - Common Name yellowjacket
Allergen Common source insects
Allergen Common name
Allergen Keywords antigen 5; Ag5; Venom allergen 5
Allergen IUIS (Yes=1, No=0) 1
ID Allergen Name
Ves v 5 - References
ID Reference
Pubmed ID: 8454859
Lu G, Villalba M, Coscia MR, Hoffman DR, King TP, Sequence analysis and antigenic cross-reactivity of a venom allergen, antigen 5, from hornets, wasps, and yellow jackets. J Immunol. 1993 Apr 1;150(7):2823-30.
Ves v 5 - Protein Sequences
Source Link to source
SwissProt Q05110
Ves v 5 - PDB Structure
PDB Id PDB Name PDB Entry Deposition Date Experiment Type Observation
261 164 1QNX 25-OCT-99 X-ray diffraction resolution 1.9 A
1QNX.pdb


Ves v 5 - Sequence Search :
Sequence Header Sequence
Ves v 5
SDAP Sequence ID: 270
SDAP Allergen ID: 261
MEISGLVYLIIIVTIIDLPYGKANNYCKIKCLKGGVHTACKYGSLKPNCGNKVVVSYGLTKQEKQDILKEHNDFRQKIARGLETRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQCQYGHDTCRDVAKYQVGQNVALTGSTAAKYDDPVKLVKMWEDEVKDYNPKKKFSGNDFLKTGHYTQMVWANTKEVGCGSIKYIQEKWHKHYLVCNYGPSGNFMNEELYQTK
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Ves v 5 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Ves v 5 93.15 0.81 1QNX_A 99.51 204 227 24 - 227 6 - 209 0 425 Download (SI: 270)
Ves v 5 - Alphafold Theoretical Model Structure
Model Structure
270_relaxed_rank_1_model_1.pdb


Coverage Plddt
Ves v 5 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
Q05110 Click here to process the data
Ves v 5 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
270 261 68 212 68 212 PF00188 CAP Domain CL0659 Cysteine-rich secretory protein family
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Ves v 5 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
1 24-35 NNYCKIKCLKGG T-cell Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
2 36-47 VHTACKYGSLKP T-cell Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
3 39-50 ACKYGSLKPNCG T-cell Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
4 42-56 YGSLKPNCGNKVVVS T-cell Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
5 48-59 NCGNKVVVSYGL T-cell Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
7 51-62 NKVVVSYGLTKQ T-cell Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
7 96-110 NMKNLVWNDELAYVA T-cell Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
8 105-119 ELAYVAQVWANQCQY T-cell Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
9 126-140 DVAKYQVGQNVALTG T-cell Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
10 138-149 LTGSTAAKYDDP T-cell Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
11 150-161 VKLVKMWEDEVK T-cell Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
12 165-179 PKKKFSGNDFLKTGH T-cell Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
13 171-185 GNDFLKTGHYTQMVW T-cell Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
14 177-188 TGHYTQMVWANT T-cell Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
15 180-191 YTQMVWANTKEV T-cell Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
16 204-215 HKHYLVCNYGPS T-cell Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
17 210-221 CNYGPSGNFMNE T-cell Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
270_relaxed_rank_1_model_1.pdb



Epitope Reference ( ID 32): B. Bohle, B. Zwolfer, G. F. Fischer, U. Seppala, T. Kinaciyan, C. Bolwig, M. D. Spangfort, and C. Ebner, Characterization of the human T cell response to antigen 5 from Vespula vulgaris (Ves v 5). Clin. Exp. Allergy 2005, 35, 367-373.
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.