The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Search Results: Peptide Similarity

Query peptide: ASNTSPASAPNALTVAAINKSNARASFSNY

NoAllergenLink to NCBI/
PIR/SwissProt
PD Sequence
Similarity
Index
z(PD,min)z(PD,all)Start
Residue
Matching regionEnd
Residue
1Asp f 13 P28296 0.00 11.7630 13.1733 289ASNTSPASAPNALTVAAINKSNARASFSNY318
2Asp v 13.0101 294441150 2.17 9.8616 11.4781 289ASNTSPASAPNALTVAASTERNARASFSNY318
3Asp fl protease 5702208 2.41 9.6461 11.2859 289AGQTSPASAPDAITVAAIQKSNNRASFSNF318
4Asp o 13 2428 2.41 9.6461 11.2859 289AGQTSPASAPDAITVAAIQKSNNRASFSNF318
5Rho m 2.0101 Q32ZM1 5.32 7.1002 9.0160 207ACNTSPASAENAITVGASTISDARAYFSNY236
6Tri r 2.0101 5813790 6.08 6.4303 8.4188 300AQHSSPASEPSVCTVAASTKDDGKADFSNY329
7Pen ch 13 6684758 6.33 6.2136 8.2255 285ASNSSPASAAEACTIAASTSTDGSASFTNF314
8Pen c 13.0101 4587983 6.87 5.7387 7.8021 285ASNSSPASAAEVCTIAASTSTDGSASFTNF314
9Cla c 9.0101 148361511 7.29 5.3717 7.4750 192SCNYSPAAAENAVTVGASTLSDERAYFSNY221
10Pen ch 18 7963902 7.70 5.0123 7.1544 316ACNYSPAAAEKAITVGASTLADERAYFSNY345
11Pen o 18 12005497 7.73 4.9787 7.1245 319ACNYSPAAAEKAVTVGASTLADERAYFSNY348
12Cla h 9.0101 60116876 7.79 4.9291 7.0803 322SCNYSPAAAENAVTVGASTLADERAYFSNY351
13Asp f 18.0101 2143219 7.90 4.8295 6.9915 320ACNYSPAAAENPITVGASTLQDERAYFSNY349
14Cur l 4.0101 193507493 8.07 4.6867 6.8642 321SCNYSPAAAENAVTVGASTLLDERAYFSNY350
15Alt a 15.0101 A0A0F6N3V8_ALTAL 8.07 4.6867 6.8642 292SCNYSPAAAENAVTVGASTLLDERAYFSNY321
16Fus p 9.0101 A0A0U1Y1N5_GIBIN 8.30 4.4789 6.6789 186ACNYSPAAASEPVTVGASALDDSRAYFSNY215
17gal d 6.0101 P87498 10.38 2.6601 5.0573 1178SSDSSSSSSSSSSSSSSKSKSSSRSSKSNR1207
18Gal d 6.0101 VIT1_CHICK 10.38 2.6601 5.0573 1178SSDSSSSSSSSSSSSSSKSKSSSRSSKSNR1207
19Asp f 17 2980819 10.53 2.5257 4.9375 159STGTASSSAPATETATATETSTATGTVTET188
20Hom s 3 929619 10.68 2.3961 4.8219 71NGFPSDASANSSLLLEFQDENSNQSSVSDV100
21Hom s 1.0101 2723284 10.81 2.2844 4.7223 106ASSKTSSGDASSLSIEETNKLRAKLGLKPL135
22Hom s 1 2342526 10.81 2.2844 4.7223 64ASSKTSSGDASSLSIEETNKLRAKLGLKPL93
23Cha o 3.0101 GH5FP_CHAOB 11.04 2.0785 4.5387 95LTRTSYTNATVAQTFARLNLTEAASGIEHN124
24Gal d 6.0101 VIT1_CHICK 11.16 1.9789 4.4499 1204KSNRSSSSSNSKDSSSSSSKSNSKGSSSSS1233
25gal d 6.0101 P87498 11.16 1.9789 4.4499 1204KSNRSSSSSNSKDSSSSSSKSNSKGSSSSS1233
26Gal d vitellogenin 212881 11.18 1.9598 4.4328 1208SSSSSSSSSSNSKSSSSSSKSSSSSSRSRS1237
27Gal d vitellogenin 63887 11.18 1.9598 4.4328 1206SSSSSSSSSSNSKSSSSSSKSSSSSSRSRS1235
28Mala s 12.0101 78038796 11.19 1.9467 4.4212 231NDPYNGNNHGTYVALSSIDKTNWQRSFSRN260
29Har a 2.0101 17291858 11.19 1.9444 4.4192 83XXXXXXXXXXNAATMXGQSKXXXXXXXXXX112
30Can s 4.0101 XP_030482568.1 11.27 1.8799 4.3616 73GSKVSPADAAYGETANIFGKPKTNTDFLPY102
31Gal d vitellogenin 212881 11.31 1.8438 4.3295 1197SSSSSSSSSSRSSSSSSSSSSNSKSSSSSS1226
32Gal d vitellogenin 63887 11.31 1.8438 4.3295 1195SSSSSSSSSSRSSSSSSSSSSNSKSSSSSS1224
33Gal d vitellogenin 212881 11.32 1.8310 4.3180 1248SSSSSSSKSSSSRSSSSSSKSSSHHSHSHH1277
34Gal d vitellogenin 63887 11.32 1.8310 4.3180 1246SSSSSSSKSSSSRSSSSSSKSSSHHSHSHH1275
35gal d 6.0101 P87498 11.34 1.8163 4.3049 1275SSSSSRASSNSRSTSSSTSSSSESSGVSHR1304
36Gal d 6.0101 VIT1_CHICK 11.34 1.8163 4.3049 1275SSSSSRASSNSRSTSSSTSSSSESSGVSHR1304
37Gal d 6.0101 VIT1_CHICK 11.37 1.7901 4.2816 1185SSSSSSSSSSKSKSSSRSSKSNRSSSSSNS1214
38gal d 6.0101 P87498 11.37 1.7901 4.2816 1185SSSSSSSSSSKSKSSSRSSKSNRSSSSSNS1214
39gal d 6.0101 P87498 11.39 1.7684 4.2623 1089ATRNSRSSSSSASSISESSESTTSTPSSSD1118
40Gal d 6.0101 VIT1_CHICK 11.39 1.7684 4.2623 1089ATRNSRSSSSSASSISESSESTTSTPSSSD1118
41Sol i 3 P35778 11.41 1.7543 4.2497 14AENLANTLATNYCNLQSCKRNNAIHTMCQY43
42Hev b 7.02 3087805 11.49 1.6844 4.1873 2ATGSTTLTQGKKITVLSIDGGGIRGIIPGI31
43Hev b 7.02 3288200 11.49 1.6844 4.1873 2ATGSTTLTQGKKITVLSIDGGGIRGIIPGI31
44Hev b 7.01 1916805 11.49 1.6844 4.1873 2ATGSTTLTQGKKITVLSIDGGGIRGIIPGI31
45Fus c 2 19879659 11.50 1.6791 4.1826 41EQLSTKHSVPDVLAFAKVNVDHVQDAAQQY70
46Alt a 4 1006624 11.50 1.6772 4.1810 356ATESAKASASSATDSAASAVSEGTETVKSG385
47Cas s 5 Q42428 11.50 1.6746 4.1786 193THNYNYGQAGKAIGADLINNPDLVATNPTI222
48Cop c 5 5689673 11.51 1.6640 4.1692 79TSKLPSSSTLSSAKRSSISRNSSSSSLSDI108
49Gal d vitellogenin 63887 11.53 1.6493 4.1560 1117EPDAKTSSSSSSASSTATSSSSSSASSPNR1146
50gal d 6.0101 P87498 11.53 1.6490 4.1557 1362SSSSSSESGSSHSNSSSSDSSSRRSHMSDS1391

Histogram for best protein-peptide similarity index
Number of windows: 1645
Average PD: 13.411230
Standard deviation: 1.140123
1 0.5 1
2 1.0 0
3 1.5 0
4 2.0 0
5 2.5 3
6 3.0 0
7 3.5 0
8 4.0 0
9 4.5 0
10 5.0 0
11 5.5 1
12 6.0 0
13 6.5 2
14 7.0 1
15 7.5 1
16 8.0 4
17 8.5 3
18 9.0 0
19 9.5 0
20 10.0 0
21 10.5 2
22 11.0 4
23 11.5 12
24 12.0 48
25 12.5 111
26 13.0 238
27 13.5 356
28 14.0 465
29 14.5 255
30 15.0 99
31 15.5 21
32 16.0 9
33 16.5 2
34 17.0 5
35 17.5 0

Histogram for all protein-peptide similarity indices
Number of windows: 364836
Average PD: 16.845328
Standard deviation: 1.278744
1 0.5 1
2 1.0 0
3 1.5 0
4 2.0 0
5 2.5 3
6 3.0 0
7 3.5 0
8 4.0 0
9 4.5 0
10 5.0 0
11 5.5 1
12 6.0 0
13 6.5 2
14 7.0 1
15 7.5 1
16 8.0 4
17 8.5 3
18 9.0 0
19 9.5 0
20 10.0 0
21 10.5 2
22 11.0 4
23 11.5 24
24 12.0 91
25 12.5 519
26 13.0 668
27 13.5 1562
28 14.0 3387
29 14.5 7388
30 15.0 14540
31 15.5 24604
32 16.0 37329
33 16.5 49243
34 17.0 56326
35 17.5 55533
36 18.0 46439
37 18.5 32870
38 19.0 19908
39 19.5 9429
40 20.0 3780
41 20.5 936
42 21.0 192
Query sequence: ASNTSPASAPNALTVAAINKSNARASFSNY

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Ovidiu Ivanciuc
Copyright   2001-2021  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.