The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Sar sa 1.0101

Sequence 193247971

Full FASTA alignment

Sequence name:
Query sequence:
MALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAI
IDQDKSGFIEEEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGI
DEFNHLVKH

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Sar sa 1.0101FM177701Go!109125.33.6e-31
2Clu h 1.0301CAQ72972Go!109105.04.8e-25
3Cyp c 1.02CAC83659Go!10999.91.6e-23
4Cten i 1.0101QCY53440Go!10998.15.7e-23
5Lat c 1.0101Q5IRB2Go!10997.11.1e-22
6Pan h 1.0101XP_026772003Go!10996.81.4e-22
7Cyp c 1.01CAC83658Go!10995.73.1e-22
8Sco j 1P59747Go!10994.56.9e-22
9Clu h 1.0201CAQ72971Go!11092.72.4e-21
10Sal s 1Q91482Go!10992.03.8e-21
11Thu a 1.0101CAQ72967Go!10991.74.8e-21
12The c 1Q90YK7Go!10991.65.4e-21
13Ras k 1.0101A0A1B1V0G7Go!10991.17.6e-21
14Gad m 1.0202CAM56786Go!10990.21.3e-20
15Gad m 1.0201AAK63087Go!10989.91.7e-20
16Gad m 1.0201Q90YK9Go!10989.91.7e-20
17Clu h 1.0101CAQ72970Go!10989.71.9e-20
18Sal s 1CAA66404Go!10888.15.8e-20
19Gad m 1.0101AAK63086Go!10987.68.2e-20
20Seb m 1.0101CAQ72968Go!10987.11.2e-19
21Sal s 1Q91483Go!10787.01.3e-19
22Xip g 1.0101FM202668Go!10986.81.5e-19
23Gad m 1.0102CAM56785Go!10986.61.6e-19
24Seb m 1.0201CAQ72969Go!11086.12.3e-19
25Lat c 1.0201Q6ITU9Go!10986.02.6e-19
26Cro p 1.0101XP_019397705Go!10985.53.6e-19
27Onc m 1.0101P86431Go!10881.94.4e-18
28Lep w 1.0101AM904681Go!10980.98.7e-18
29Ran e 2CAC95152Go!10980.61.1e-17
30Onc m 1.0201P86432Go!10775.82.9e-16
31Gad c 1P02622Go!11375.24.8e-16
32Pan h 1.0201XP_026803769Go!10972.43.2e-15
33Cro p 2.0101XP_019400389Go!11071.27.2e-15
34Gal d 8.0101C1L370Go!11067.31.1e-13
35Ran e 1CAC83046Go!11065.34.3e-13
36Jun o 4O64943Go!16532.93.8e-03
37Cup a 4.0101ABP87672Go!17732.94.0e-03

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Sar sa 1.0101, Sequence: FM177701
Sequence identity: 100.00 (109/109)
Sequence 1 MALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAI
           MALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAI
Sequence 2 MALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAI

Sequence 1 IDQDKSGFIEEEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGI
           IDQDKSGFIEEEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGI
Sequence 2 IDQDKSGFIEEEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGI

Sequence 1 DEFNHLVKH
           DEFNHLVKH
Sequence 2 DEFNHLVKH



Alignment 2
Sequence 1:
Sequence 2: Allergen Clu h 1.0301, Sequence: CAQ72972
Sequence identity: 82.57 (90/109)
Sequence 1 MALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAI
           MA-A---KEADITAAL-ACK-ADSFDHKAFF-KVG--GKS-DELKKAF-I
Sequence 2 MAFAAFLKEADITAALGACKGADSFDHKAFFAKVGLKGKSGDELKKAFEI

Sequence 1 IDQDKSGFIEEEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGI
           IDQDKSGFIEEEELKLFLQNFCK-ARALTDGETKKFLKAGD---DGKIGI
Sequence 2 IDQDKSGFIEEEELKLFLQNFCKGARALTDGETKKFLKAGDSDNDGKIGI

Sequence 1 DEFNHLVKH
           DEF--L--H
Sequence 2 DEFAALINH



Alignment 3
Sequence 1:
Sequence 2: Allergen Cyp c 1.02, Sequence: CAC83659
Sequence identity: 77.98 (85/109)
Sequence 1 MALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAI
           MA-AG----ADITAALEACKAADSF-HK-FF-KVG---KSAD--KKAFAI
Sequence 2 MAFAGVLNDADITAALEACKAADSFNHKTFFAKVGLTSKSADDVKKAFAI

Sequence 1 IDQDKSGFIEEEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGI
           IDQDKSGFIEE-ELKLFLQNF---ARALTDGETK-FLKAGD--GDGKIG-
Sequence 2 IDQDKSGFIEEDELKLFLQNFKAGARALTDGETKTFLKAGDSDGDGKIGV

Sequence 1 DEFNHLVKH
           DEF--LVK-
Sequence 2 DEFTALVKA



Alignment 4
Sequence 1:
Sequence 2: Allergen Cten i 1.0101, Sequence: QCY53440
Sequence identity: 77.06 (84/109)
Sequence 1 MALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAI
           MA-AG----ADI-AALEACKAADSF-HKAFF-KVG-S-KS-D--KKAFAI
Sequence 2 MAFAGILNDADIAAALEACKAADSFNHKAFFAKVGLSAKSGDDVKKAFAI

Sequence 1 IDQDKSGFIEEEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGI
           IDQDKSGFIEE-ELKLFLQNF---ARALTD-ETK-FLKAGD--GDGKIG-
Sequence 2 IDQDKSGFIEEDELKLFLQNFKADARALTDAETKIFLKAGDSDGDGKIGV

Sequence 1 DEFNHLVKH
           DEF--LVK-
Sequence 2 DEFAALVKA



Alignment 5
Sequence 1:
Sequence 2: Allergen Lat c 1.0101, Sequence: Q5IRB2
Sequence identity: 75.23 (82/109)
Sequence 1 MALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAI
           MA-AG---EADITAAL-AC-AADSF-HK-FF-KVG--GKS-D--KKAFA-
Sequence 2 MAFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAV

Sequence 1 IDQDKSGFIEEEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGI
           IDQDKSGFIEE-ELKLFLQNF---ARALTD-ETK-FLKAGD--GDGKIG-
Sequence 2 IDQDKSGFIEEDELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGV

Sequence 1 DEFNHLVKH
           DEF--LVK-
Sequence 2 DEFAALVKV



Alignment 6
Sequence 1:
Sequence 2: Allergen Pan h 1.0101, Sequence: XP_026772003
Sequence identity: 75.23 (82/109)
Sequence 1 MALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAI
           MA-AG----ADI-AAL-ACKA--SFDHKAFF-KVG--GKSAD--KKAF-I
Sequence 2 MAFAGVLNDADIAAALDACKADGSFDHKAFFTKVGLTGKSADDVKKAFSI

Sequence 1 IDQDKSGFIEEEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGI
           IDQDKSGFIEE-ELKLFLQNF---ARALTD-ETK-FLKAGD--GDGKIG-
Sequence 2 IDQDKSGFIEEDELKLFLQNFKSDARALTDNETKIFLKAGDTDGDGKIGV

Sequence 1 DEFNHLVKH
           DEF--LVK-
Sequence 2 DEFASLVKA



Alignment 7
Sequence 1:
Sequence 2: Allergen Cyp c 1.01, Sequence: CAC83658
Sequence identity: 72.48 (79/109)
Sequence 1 MALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAI
           MA-AG----ADITAAL--C-AADSFD-K-FF-KVG-S-K--D--KKAFA-
Sequence 2 MAFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAV

Sequence 1 IDQDKSGFIEEEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGI
           IDQDKSGFIEE-ELKLFLQNF---ARALTD-ETK-FLKAGD--GDGKIG-
Sequence 2 IDQDKSGFIEEDELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGV

Sequence 1 DEFNHLVKH
           DEF--LVK-
Sequence 2 DEFAALVKA



Alignment 8
Sequence 1:
Sequence 2: Allergen Sco j 1, Sequence: P59747
Sequence identity: 72.48 (79/109)
Sequence 1 MALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAI
           MA-A---K-A--TAAL--CKAA-SFDHK-FF---G-SGKS-DE-KKAFAI
Sequence 2 MAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAI

Sequence 1 IDQDKSGFIEEEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGI
           IDQDKSGFIEEEELKLFLQNF---ARAL-D-ETK-FLKAGD--GDGKIGI
Sequence 2 IDQDKSGFIEEEELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGI

Sequence 1 DEFNHLVKH
           DEF----K-
Sequence 2 DEFAAMIKG



Alignment 9
Sequence 1:
Sequence 2: Allergen Clu h 1.0201, Sequence: CAQ72971
Sequence identity: 72.48 (79/109)
Sequence 1 MALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAI
           MA-AGL---ADI-AAL-AC-AAD-FDHK-FF-KVG-SGKSAD--KK-F-I
Sequence 2 MAFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYI

Sequence 1 IDQDKSGFIEEEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGI
           IDQDKSGFIEEEELKLFLQNF---ARAL-D-ETK-FL-AGD--GDG-IG-
Sequence 2 IDQDKSGFIEEEELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGV

Sequence 1 DEFNHLVKH-
           DEF---VK--
Sequence 2 DEFAVMVKAR



Alignment 10
Sequence 1:
Sequence 2: Allergen Sal s 1, Sequence: Q91482
Sequence identity: 72.48 (79/109)
Sequence 1 MALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAI
           MA-A-L-KEADI--ALEACKAAD-F--K-FFH--G---KSAD--KKAF--
Sequence 2 MACAHLCKEADIKTALEACKAADTFSFKTFFHTIGFASKSADDVKKAFKV

Sequence 1 IDQDKSGFIEEEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGI
           IDQD-SGFIE-EELKLFLQNFC-KAR-LTD-ETK-FLKAGD--GDG-IGI
Sequence 2 IDQDASGFIEVEELKLFLQNFCPKARELTDAETKAFLKAGDADGDGMIGI

Sequence 1 DEFNHLVKH
           DEF--LVK-
Sequence 2 DEFAVLVKQ



Alignment 11
Sequence 1:
Sequence 2: Allergen Thu a 1.0101, Sequence: CAQ72967
Sequence identity: 71.56 (78/109)
Sequence 1 MALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAI
           MA-AG---EADITAAL-AC-AADSF--K-FF-KVG---K-----KKAFA-
Sequence 2 MAFAGILTEADITAALAACQAADSFKYKDFFTKVGLAAKTPEDIKKAFAV

Sequence 1 IDQDKSGFIEEEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGI
           IDQDKSGFIEE-ELKLFLQNF---ARALTD-ETK-FL-AGD--GDGKIGI
Sequence 2 IDQDKSGFIEEDELKLFLQNFSAGARALTDAETKAFLMAGDSDGDGKIGI

Sequence 1 DEFNHLVKH
           DEF--LVK-
Sequence 2 DEFAALVKA



Alignment 12
Sequence 1:
Sequence 2: Allergen The c 1, Sequence: Q90YK7
Sequence identity: 67.89 (74/109)
Sequence 1 MALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAI
           MA-AG--K-A---AALEACK-A-SFDH--FF---G--GKS-D--KKAF-I
Sequence 2 MAFAGILKDAEVAAALEACKSAGSFDHTKFFKSCGLAGKSSDDVKKAFGI

Sequence 1 IDQDKSGFIEEEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGI
           IDQD-S-FIEEEELKLFLQNF---ARAL-D-ETK-FLKAGD--GDGKIG-
Sequence 2 IDQDQSDFIEEEELKLFLQNFSASARALSDAETKAFLKAGDSDGDGKIGV

Sequence 1 DEFNHLVKH
           DEF---VK-
Sequence 2 DEFAAMVKA



Alignment 13
Sequence 1:
Sequence 2: Allergen Ras k 1.0101, Sequence: A0A1B1V0G7
Sequence identity: 68.81 (75/109)
Sequence 1 MALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAI
           MA-A---K-A-ITAAL--CKA--SFDHK-FF---G--GKS-D--KKAFAI
Sequence 2 MAFASVLKDAEITAALDGCKADGSFDHKKFFKACGLAGKSGDDVKKAFAI

Sequence 1 IDQDKSGFIEEEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGI
           IDQDKSGFIEEEELKLFLQNF---AR-L-D-ETK-FLKAGD--GDGKIG-
Sequence 2 IDQDKSGFIEEEELKLFLQNFKAGARTLSDAETKAFLKAGDTDGDGKIGV

Sequence 1 DEFNHLVKH
           DEF----K-
Sequence 2 DEFAAMIKG



Alignment 14
Sequence 1:
Sequence 2: Allergen Gad m 1.0202, Sequence: CAM56786
Sequence identity: 67.89 (74/109)
Sequence 1 MALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAI
           MA-AG----ADITAAL-ACKA--SFDHKAFF-KVG---KS----KK-F-I
Sequence 2 MAFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSSADIKKVFEI

Sequence 1 IDQDKSGFIEEEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGI
           IDQDKS-F-EE-ELKLFLQNF---ARAL-D-ETK-FLKAGD--GDGKIG-
Sequence 2 IDQDKSDFVEEDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGV

Sequence 1 DEFNHLVKH
           DEF----K-
Sequence 2 DEFGAMIKA



Alignment 15
Sequence 1:
Sequence 2: Allergen Gad m 1.0201, Sequence: AAK63087
Sequence identity: 67.89 (74/109)
Sequence 1 MALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAI
           MA-AG----ADITAAL-ACKA--SFDHKAFF-KVG---KS----KK-F-I
Sequence 2 MAFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSPADIKKVFEI

Sequence 1 IDQDKSGFIEEEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGI
           IDQDKS-F-EE-ELKLFLQNF---ARAL-D-ETK-FLKAGD--GDGKIG-
Sequence 2 IDQDKSDFVEEDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGV

Sequence 1 DEFNHLVKH
           DEF----K-
Sequence 2 DEFGAMIKA



Alignment 16
Sequence 1:
Sequence 2: Allergen Gad m 1.0201, Sequence: Q90YK9
Sequence identity: 67.89 (74/109)
Sequence 1 MALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAI
           MA-AG----ADITAAL-ACKA--SFDHKAFF-KVG---KS----KK-F-I
Sequence 2 MAFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSPADIKKVFEI

Sequence 1 IDQDKSGFIEEEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGI
           IDQDKS-F-EE-ELKLFLQNF---ARAL-D-ETK-FLKAGD--GDGKIG-
Sequence 2 IDQDKSDFVEEDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGV

Sequence 1 DEFNHLVKH
           DEF----K-
Sequence 2 DEFGAMIKA



Alignment 17
Sequence 1:
Sequence 2: Allergen Clu h 1.0101, Sequence: CAQ72970
Sequence identity: 71.56 (78/109)
Sequence 1 MALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAI
           MALA-L-K-ADI-AAL-AC-A-DSF-HK-FF-K-G---KSA--LKKAF-I
Sequence 2 MALASLLKGADIDAALKACEAKDSFKHKDFFAKIGLATKSAADLKKAFEI

Sequence 1 IDQDKSGFIEEEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGI
           IDQDKSGFIEEEELKLFLQNF---ARALTD-ETK-FLKAGD--GDG-IG-
Sequence 2 IDQDKSGFIEEEELKLFLQNFKAGARALTDAETKAFLKAGDADGDGMIGV

Sequence 1 DEFNHLVKH
           DEF----K-
Sequence 2 DEFAVMIKP



Alignment 18
Sequence 1:
Sequence 2: Allergen Sal s 1, Sequence: CAA66404
Sequence identity: 66.97 (73/109)
Sequence 1 MALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAI
           M--AGL---AD--AAL-AC-AADSF-HKAFF-KVG---KS-D--KKAF--
Sequence 2 MSFAGL-NDADVAAALAACTAADSFNHKAFFAKVGLASKSSDDVKKAFYV

Sequence 1 IDQDKSGFIEEEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGI
           IDQDKSGFIEE-ELKLFLQNF---ARALTD-ETK-FL--GD--GDG-IG-
Sequence 2 IDQDKSGFIEEDELKLFLQNFSASARALTDAETKAFLADGDKDGDGMIGV

Sequence 1 DEFNHLVKH
           DEF----K-
Sequence 2 DEFAAMIKG



Alignment 19
Sequence 1:
Sequence 2: Allergen Gad m 1.0101, Sequence: AAK63086
Sequence identity: 67.89 (74/109)
Sequence 1 MALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAI
           MA-AG----AD--AA--AC-AA-SF--KAFF-K-G-SGKSAD--KKAF--
Sequence 2 MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFV

Sequence 1 IDQDKSGFIEEEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGI
           IDQDKSGFIEE-ELKLFLQ-F---ARALTD-ETK-FLKAGD--GDG-IG-
Sequence 2 IDQDKSGFIEEDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGV

Sequence 1 DEFNHLVKH
           DE---LVK-
Sequence 2 DEWAVLVKA



Alignment 20
Sequence 1:
Sequence 2: Allergen Seb m 1.0101, Sequence: CAQ72968
Sequence identity: 67.89 (74/109)
Sequence 1 MALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAI
           MALA-----ADITAAL-AC---D-F-HK-FF-KVG-S-KSAD--K-AF--
Sequence 2 MALAASLNAADITAALAACSGVDTFKHKDFFGKVGLSAKSADDIKNAFKV

Sequence 1 IDQDKSGFIEEEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGI
           IDQDKSGFIEEEELKLFLQNF---ARALT--ET--FLKAGD--GDG-IG-
Sequence 2 IDQDKSGFIEEEELKLFLQNFSATARALTEAETTAFLKAGDSDGDGMIGM

Sequence 1 DEFNHLVKH
           DEF---VK-
Sequence 2 DEFAAMVKG



Alignment 21
Sequence 1:
Sequence 2: Allergen Sal s 1, Sequence: Q91483
Sequence identity: 66.06 (72/109)
Sequence 1 MALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAI
           ---AGL---AD--AAL-AC-AADSF-HKAFF-KVG---KS-D--KKAF--
Sequence 2 -SFAGL-NDADVAAALAACTAADSFNHKAFFAKVGLASKSSDDVKKAFYV

Sequence 1 IDQDKSGFIEEEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGI
           IDQDKSGFIEE-ELKLFLQNF---ARALTD-ETK-FL--GD--GDG-IG-
Sequence 2 IDQDKSGFIEEDELKLFLQNFSASARALTDAETKAFLADGDKDGDGMIGV

Sequence 1 DEFNHLVKH
           DEF----K-
Sequence 2 DEFAAMIKG



Alignment 22
Sequence 1:
Sequence 2: Allergen Xip g 1.0101, Sequence: FM202668
Sequence identity: 66.06 (72/109)
Sequence 1 MALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAI
           MA-AG----AD--AALEACK-A--FD-K-FF---G---KS-D--KKAFAI
Sequence 2 MAFAGVLSDADVAAALEACKDAGTFDYKKFFKSCGLAAKSTDDVKKAFAI

Sequence 1 IDQDKSGFIEEEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGI
           IDQDKSGFIEE-ELKLFLQNF---AR-LTD-ET--FLKAGD--GDGKIG-
Sequence 2 IDQDKSGFIEEDELKLFLQNFKAAARPLTDAETEAFLKAGDSDGDGKIGA

Sequence 1 DEFNHLVKH
           -EF--LV--
Sequence 2 EEFAALVTA



Alignment 23
Sequence 1:
Sequence 2: Allergen Gad m 1.0102, Sequence: CAM56785
Sequence identity: 66.97 (73/109)
Sequence 1 MALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAI
           MA-AG----AD--AA--AC-AA-SF--KAFF-K-G-SGKSAD--KKAF--
Sequence 2 MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFV

Sequence 1 IDQDKSGFIEEEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGI
           IDQDKSGFIEE-ELKLFLQ-F---ARALTD-ETK-FLKAGD--GDG-IG-
Sequence 2 IDQDKSGFIEEDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGV

Sequence 1 DEFNHLVKH
           -E---LVK-
Sequence 2 EEWAVLVKA



Alignment 24
Sequence 1:
Sequence 2: Allergen Seb m 1.0201, Sequence: CAQ72969
Sequence identity: 67.89 (74/109)
Sequence 1 MALAGL-VKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFA
           MA-A----K-ADI-AAL--CK-A--F-HK-FF---G-SGKS-DE-KKAFA
Sequence 2 MAFASVGLKDADIAAALDGCKDAGKFNHKTFFKTCGLSGKSSDEVKKAFA

Sequence 1 IIDQDKSGFIEEEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIG
           IIDQD-SGFIEEEELKLFLQ-F---ARAL-D-ETK-FLKAGD--GDGKIG
Sequence 2 IIDQDISGFIEEEELKLFLQTFKAGARALSDAETKEFLKAGDSDGDGKIG

Sequence 1 IDEFNHLVKH
           -DE----VK-
Sequence 2 ADEWAAMVKQ



Alignment 25
Sequence 1:
Sequence 2: Allergen Lat c 1.0201, Sequence: Q6ITU9
Sequence identity: 65.14 (71/109)
Sequence 1 MALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAI
           MA--------D--AAL--CK-A--FDHK-FF---G-S-K--D--KKAFAI
Sequence 2 MAFSNVLSDSDVAAALDGCKDAGTFDHKKFFSACGLSNKTSDDVKKAFAI

Sequence 1 IDQDKSGFIEEEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGI
           IDQDKSGFIEEEELKLFLQNF---AR-LTD-ET--FLKAGD--GDGKIG-
Sequence 2 IDQDKSGFIEEEELKLFLQNFKADARVLTDVETSTFLKAGDTDGDGKIGA

Sequence 1 DEFNHLVKH
           DEF--LVK-
Sequence 2 DEFTALVKP



Alignment 26
Sequence 1:
Sequence 2: Allergen Cro p 1.0101, Sequence: XP_019397705
Sequence identity: 63.30 (69/109)
Sequence 1 MALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAI
           MA--------DI-AAL--C-AA-SF--K-FF--VG--GKSAD--KK-F-I
Sequence 2 MAITDILSAKDIEAALSSCQAAESFNYKSFFSTVGLKGKSADQVKKVFGI

Sequence 1 IDQDKSGFIEEEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGI
           -DQDKSGFIEE-EL-LFL-NF---ARALTD-ETK-FL-AGD--GDGKIG-
Sequence 2 LDQDKSGFIEEDELQLFLKNFSSSARALTDAETKAFLAAGDTDGDGKIGV

Sequence 1 DEFNHLVKH
           DEF--LVK-
Sequence 2 DEFQALVKA



Alignment 27
Sequence 1:
Sequence 2: Allergen Onc m 1.0101, Sequence: P86431
Sequence identity: 62.39 (68/109)
Sequence 1 MALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAI
           -A-A-L-KEAD---ALEACKAADSF--K-FFH--G---K--D--KK----
Sequence 2 -ACAHLCKEADLKTALEACKAADSFNFKTFFHTLGFASKXXDDVKKXXXV

Sequence 1 IDQDKSGFIEEEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGI
           -DQD-SGF-E-EELKLFLQNFC-K---LTD-ETK-FLKAGD--GDG--G-
Sequence 2 LDQDASGFLEVEELKLFLQNFCPKXXXLTDAETKAFLKAGDADGDGMLGL

Sequence 1 DEFNHLVKH
           DEF--LVK-
Sequence 2 DEFAVLVKQ



Alignment 28
Sequence 1:
Sequence 2: Allergen Lep w 1.0101, Sequence: AM904681
Sequence identity: 65.14 (71/109)
Sequence 1 MALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAI
           M--AGL---A-I-AAL--C-AADSFD-K-FF---G---KSA-E-K-AF--
Sequence 2 MTFAGL-DAAEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNK

Sequence 1 IDQDKSGFIEEEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGI
           IDQD-SGFIEE-ELKLFLQNF---ARALTD-ET--FLKAGD--GDGKIGI
Sequence 2 IDQDESGFIEEDELKLFLQNFSASARALTDKETANFLKAGDVDGDGKIGI

Sequence 1 DEFNHLVKH-
           -EF--LV---
Sequence 2 EEFTDLVRSK



Alignment 29
Sequence 1:
Sequence 2: Allergen Ran e 2, Sequence: CAC95152
Sequence identity: 61.47 (67/109)
Sequence 1 MALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAI
           M-----V-E-DI-AALE--KAA-SF--K-FF-KVG--GKSA---KK-F-I
Sequence 2 MSITDIVSEKDIDAALESVKAAGSFNYKIFFQKVGLAGKSAADAKKVFEI

Sequence 1 IDQDKSGFIEEEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGI
           -D-DKSGFIE--EL-LFLQNF---AR-L-D-ET--FLKAGD--GDGKIG-
Sequence 2 LDRDKSGFIEQDELGLFLQNFRASARVLSDAETSAFLKAGDSDGDGKIGV

Sequence 1 DEFNHLVKH
           -EF--LVK-
Sequence 2 EEFQALVKA



Alignment 30
Sequence 1:
Sequence 2: Allergen Onc m 1.0201, Sequence: P86432
Sequence identity: 60.55 (66/109)
Sequence 1 MALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAI
           ---AGL---AD--AAL-AC-AADSF-HKAFF-K------S-D-LKK----
Sequence 2 -SFAGL-NDADVAAALAACAAADSFNHKAFFAKXXXXXXSPDDLKKXXXX

Sequence 1 IDQDKSGFIEEEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGI
           -DQDKSGF-EE-ELKLFLQNF---ARALTD-ETK----AGD--GDG--G-
Sequence 2 LDQDKSGFLEEDELKLFLQNFSASARALTDAETKXXXXAGDADGDGMLGL

Sequence 1 DEFNHLVKH
           DEF--LVK-
Sequence 2 DEFAVLVKQ



Alignment 31
Sequence 1:
Sequence 2: Allergen Gad c 1, Sequence: P02622
Sequence identity: 59.63 (65/109)
Sequence 1 MALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAI
           -A--G----ADI-AA--AC----SFD---F--KVG----SADELKK-F-I
Sequence 2 -AFKGILSNADIKAAEAACFKEGSFDEDGFYAKVGLDAFSADELKKLFKI

Sequence 1 IDQDKSGFIEEEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGI
           -D-DK-GFIEE-ELKLFL--F----RALTD-ETK-FLKAGD--GDGKIG-
Sequence 2 ADEDKEGFIEEDELKLFLIAFAADLRALTDAETKAFLKAGDSDGDGKIGV

Sequence 1 DEFNHLVKH-----
           DEF--LV-------
Sequence 2 DEFGALVDKWGAKG



Alignment 32
Sequence 1:
Sequence 2: Allergen Pan h 1.0201, Sequence: XP_026803769
Sequence identity: 55.05 (60/109)
Sequence 1 MALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAI
           MA---L-K--DI--AL---K-AD-FDHK-FF--VG----SA---KK-F--
Sequence 2 MAMQDLLKADDIKKALDTFKVADTFDHKKFFELVGLKAMSAENVKKVFSV

Sequence 1 IDQDKSGFIEEEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGI
           -D-D-SGFIEE-ELK--L--F-K--R-LTD-ETK-FL-A-D--GDGKIGI
Sequence 2 LDVDASGFIEEDELKFVLKGFSKDGRDLTDKETKAFLTAADRDGDGKIGI

Sequence 1 DEFNHLVKH
           DEF---V--
Sequence 2 DEFEAIVHQ



Alignment 33
Sequence 1:
Sequence 2: Allergen Cro p 2.0101, Sequence: XP_019400389
Sequence identity: 54.13 (59/109)
Sequence 1 MALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAI
           MA---L----DI--A--A--AA-SF-HK-FF--VG---KS-D--KK-F-I
Sequence 2 MAMTDLLSADDIKKAVGAFAAAESFNHKKFFEMVGLKKKSQDDVKKVFHI

Sequence 1 IDQDKSGFIEEEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGI
           -D-D-SGFIEE-ELK--L--F---AR-L-D-ETK--L-AGD--GDGKIG-
Sequence 2 LDKDRSGFIEEDELKSVLKGFTPDARDLSDKETKELLAAGDKDGDGKIGV

Sequence 1 DEFNHLVKH-
           DEF--LV---
Sequence 2 DEFTSLVAES



Alignment 34
Sequence 1:
Sequence 2: Allergen Gal d 8.0101, Sequence: C1L370
Sequence identity: 50.46 (55/109)
Sequence 1 MALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAI
           MA--------DI--A--A--AA-SF--K-FF--VG---KS----KK-F-I
Sequence 2 MAMTDVLSAEDIKKAVGAFSAAESFNYKKFFEMVGLKKKSPEDVKKVFHI

Sequence 1 IDQDKSGFIEEEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGI
           -D-D-SGFIEEEELK--L--F----R-L-D-ETK--L-AGD--GDGKIG-
Sequence 2 LDKDRSGFIEEEELKFVLKGFTPDGRDLSDKETKALLAAGDKDGDGKIGA

Sequence 1 DEFNHLVKH-
           DEF---V---
Sequence 2 DEFATMVAES



Alignment 35
Sequence 1:
Sequence 2: Allergen Ran e 1, Sequence: CAC83046
Sequence identity: 47.71 (52/109)
Sequence 1 MALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAI
           M----L----DI--A--A--A--SF-HK-FF---G---KS-----K-F--
Sequence 2 MPMTDLLAAGDISKAVSAFAAPESFNHKKFFELCGLKSKSKEIMQKVFHV

Sequence 1 IDQDKSGFIEEEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGI
           -DQD-SGFIE-EEL-L-L--F----R-L-D-ET---L-AGD--GDGKIG-
Sequence 2 LDQDQSGFIEKEELCLILKGFTPEGRSLSDKETTALLAAGDKDGDGKIGV

Sequence 1 DEFNHLVKH-
           DEF--LV---
Sequence 2 DEFVTLVSES



Alignment 36
Sequence 1:
Sequence 2: Allergen Jun o 4, Sequence: O64943
Sequence identity: 29.36 (32/109)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MDEVPSSDGSKSACSGEVVMEQSVHELEEVFKKFDANGDGKISGSELADI

Sequence 1 -MALAGLVKEADITAALEACKA-ADSFDHKAFFHKVGMSGKSADELKKAF
           ---L---V-EA---A--E---A--D-------F------G-S---LK-AF
Sequence 2 LRSLGSDVGEAEVKAMMEEADADGDGYVSLQEFVDLNNKGASVKDLKNAF

Sequence 1 AIIDQDKSGFIEEEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKI
           ---D-D--G-I---EL---L----------T--E-K------D--GDG-I
Sequence 2 KVFDRDCNGSISAAELCHTLESV---GEPCTIEESKNIIHNVDKNGDGLI

Sequence 1 GIDEFNHLVKH-------
           ---EF-------------
Sequence 2 SVEEFQTMMTSEMTDKSK



Alignment 37
Sequence 1:
Sequence 2: Allergen Cup a 4.0101, Sequence: ABP87672
Sequence identity: 27.52 (30/109)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MRGSHHHHHHGSMDEVPSSDGSKSASSGKRVLEQSVHELEEVFKKFDANG

Sequence 1 -------------MALAGLVKEADITAALE-ACKAADSFDHKAFFHKVGM
           -------------------V-EA---A--E-A----D-------F-----
Sequence 2 DGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQEFVDLNI

Sequence 1 SGKSADELKKAFAIIDQDKSGFIEEEELKLFLQNFCKKARALTDGETKKF
           -G-----LK-AF---D-D--G-I---EL---L----------T--E-K--
Sequence 2 KGATVKDLKNAFKVFDRDCNGTISPAELCQTLKSM---GEPCTIEESKNI

Sequence 1 LKAGDNVGDGKIGIDEFNHLVKH-------
           ----D--GDG-I---EF-------------
Sequence 2 IHNVDKNGDGLISVEEFQTMMTSEMTDKSK


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.