The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Zea m 14.0102

Sequence P19656-2

Full FASTA alignment

Sequence name:
Query sequence:
MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS
KCGVSIPYTISTSTDCSRYSRRMHASAD

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Zea m 14.0102P19656-2Go!128152.33.9e-39
2Zea m 14.0101P19656-1Go!120140.61.2e-35
3Tri tu 14.0101CAH69206Go!11598.55.5e-23
4Pun g 1.0201A0A059SSZ0Go!12089.72.6e-20
5Hor v 1CAA42832Go!13486.42.7e-19
6Pun g 1.0101A0A059STC4Go!12086.03.3e-19
7Pha v 3.0201ADC80503Go!11884.87.5e-19
8Hor v 1AAA32970Go!11784.11.2e-18
9Pru av 3Q9M5X8Go!11783.42.0e-18
10Mal d 3Q9M5X7Go!11583.22.2e-18
11Fra a 3.0101Q8VX12Go!11783.22.2e-18
12Hev b 12AAL25839Go!11682.82.8e-18
13Fra a 3.0201Q4PLU0Go!11782.53.6e-18
14Ara h 9.0101ABX56711Go!11682.34.0e-18
15Fra a 3.0102Q4PLT9Go!11782.24.6e-18
16Len c 3.0101A0AT29Go!11882.24.6e-18
17Pun g 1.0301A0A059ST23Go!12082.24.6e-18
18Rub i 3.0101Q0Z8V0Go!11782.05.1e-18
19Pyr c 3Q9M5X6Go!11581.66.5e-18
20Fra a 3.0202Q4PLT6Go!11780.91.1e-17
21Pis s 3.0101A0A161AT60Go!12081.01.1e-17
22Mor n 3.0101P85894Go!9180.01.5e-17
23Pru p 3CAB96876Go!9180.01.5e-17
24Ara h 9.0201ABX75045Go!9279.91.7e-17
25Pru ar 3P81651Go!9179.72.0e-17
26Pru p 3P81402Go!9179.72.0e-17
27Pru d 3P82534Go!9179.52.2e-17
28Pha v 3.0101ADC80502Go!11578.55.7e-17
29Lup an 3.0101XP_019446786Go!11677.31.3e-16
30Tri a 14.010119846220Go!9076.02.4e-16
31Pla or 3.0101ABY21307Go!11876.32.8e-16
32Pla a 3.0101CAL07989Go!11875.64.5e-16
33Can s 3.0101W0U0V5Go!9174.85.7e-16
34Cor a 8AAK28533Go!11575.06.3e-16
35Lyc e 3AAB42069Go!11474.01.3e-15
36Sola l 3.0101P93224Go!11474.01.3e-15
37Pru du 3.0101ACN11576Go!12374.01.3e-15
38Api g 2ACV04796Go!11873.81.5e-15
39Art gm 3.0102ANC85023Go!11771.67.1e-15
40Art an 3.0101ANC85017Go!11771.48.0e-15
41Art ca 3.0101ANC85021Go!11771.48.0e-15
42Art gm 3.0101ANC85022Go!11771.29.0e-15
43Ara h 17.0101A0A510A9S3Go!9370.31.3e-14
44Art an 3.0102ANC85018Go!11770.02.1e-14
45Art ca 3.0102QIN55516Go!11769.82.4e-14
46Art si 3.0102ANC85027Go!11669.33.4e-14
47Art v 3.0202ACE07187Go!11669.33.4e-14
48Art ar 3.0102ANC85020Go!11669.33.4e-14
49Sola l 7.0101NP_001316123Go!11568.84.8e-14
50Art la 3.0102ANC85025Go!11567.51.1e-13
51Art si 3.0101ANC85026Go!11666.91.8e-13
52Art v 3.0301EU564847Go!11766.91.8e-13
53Art v 3.0201EU564845Go!11466.32.6e-13
54Art ar 3.0101ANC85019Go!11666.32.6e-13
55Art la 3.0101ANC85024Go!11666.32.6e-13
56Sin a 3.0101ABU95411Go!9265.43.8e-13
57Par j 2O04403Go!13358.85.6e-11
58Hel a 3.0101P82007Go!11656.62.2e-10
59Par j 2P55958Go!13355.84.3e-10
60Par j 1Q40905Go!13850.32.1e-08
61Par j 1O04404Go!17650.22.9e-08
62Amb a 6O04004Go!11849.53.1e-08
63Par j 1P43217Go!13948.11.0e-07
64Par j 1.0103CAI94601Go!13948.11.0e-07
65Par j 1.0101CAA54587Go!13344.21.4e-06
66Vit v 1P80274Go!3731.32.9e-03
67Art v 3.0101P0C088Go!3731.23.3e-03
68Cas s 810998016Go!3629.97.5e-03

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Zea m 14.0102, Sequence: P19656-2
Sequence identity: 100.00 (128/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
           MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
Sequence 2 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS

Sequence 1 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS
           GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS
Sequence 2 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS

Sequence 1 KCGVSIPYTISTSTDCSRYSRRMHASAD
           KCGVSIPYTISTSTDCSRYSRRMHASAD
Sequence 2 KCGVSIPYTISTSTDCSRYSRRMHASAD



Alignment 2
Sequence 1:
Sequence 2: Allergen Zea m 14.0101, Sequence: P19656-1
Sequence identity: 92.19 (118/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
           MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
Sequence 2 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS

Sequence 1 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS
           GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS
Sequence 2 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS

Sequence 1 KCGVSIPYTISTSTDCSRYSRRMHASAD
           KCGVSIPYTISTSTDCSR----------
Sequence 2 KCGVSIPYTISTSTDCSRVN--------



Alignment 3
Sequence 1:
Sequence 2: Allergen Tri tu 14.0101, Sequence: CAH69206
Sequence identity: 60.16 (77/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
           MAR-----VV--AVVA--LLA----EAA-SCGQV-SA--PCISYARG-G-
Sequence 2 MARSAVAQVVLVAVVAAMLLAV--TEAAVSCGQVSSALSPCISYARGNGA

Sequence 1 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS
           -PSA-CCSGVRSL---AR-TAD--AAC-C-K-AAAG---LNAG-AA-IP-
Sequence 2 SPSAACCSGVRSLASSARSTADKQAACKCIKSAAAG---LNAGKAAGIPT

Sequence 1 KCGVSIPYTISTSTDCSRYSRRMHASAD
           KCGVS-PY-IS-S-DCS-----------
Sequence 2 KCGVSVPYAISSSVDCSKIR--------



Alignment 4
Sequence 1:
Sequence 2: Allergen Pun g 1.0201, Sequence: A0A059SSZ0
Sequence identity: 51.56 (66/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
           MA----L-----A-------AA---E-A--CGQV-S---PCI-YARG---
Sequence 2 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA

Sequence 1 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS
           -PSA-CCSGVRSLNNAA-TT-DR--ACNCLK--A----G-N-G-----P-
Sequence 2 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG

Sequence 1 KCGVSIPYTISTSTDCSRYSRRMHASAD
           KCGVSIPY-IS-STDCSR----------
Sequence 2 KCGVSIPYKISPSTDCSRVK--------



Alignment 5
Sequence 1:
Sequence 2: Allergen Hor v 1, Sequence: CAA42832
Sequence identity: 50.78 (65/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
           MAR-Q-L---A-A-V-L-L-AA-----A--CGQV-S---PC--Y--G-G-
Sequence 2 MARAQVL-LMAAALV-LMLTAAPRAAVALNCGQVDSKMKPCLTYVQG-GP

Sequence 1 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS
           GPS--CC-GVR-L-N-A----DR---CNCLK--A-G---LN--NAASIPS
Sequence 2 GPSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPS

Sequence 1 KCGVSIPYTISTSTDCSRYSRRMHASAD---------
           KC-V--PYTIS---DCSR---R---------------
Sequence 2 KCNVNVPYTISPDIDCSRFTERRSVKLVLSSSIHVEL



Alignment 6
Sequence 1:
Sequence 2: Allergen Pun g 1.0101, Sequence: A0A059STC4
Sequence identity: 49.22 (63/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAA-TSEAAISCGQVASAIAPCISYARGQG
           ------L---A-AV-A--L-AA----EAA--CGQVAS--APCI-YAR--G
Sequence 2 -MTGSGLFKLACAVFAVALVAAPIATEAAVTCGQVASSLAPCIPYARSAG

Sequence 1 SGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIP
           ------CCSG---L---ARTT-DR-A-C-CLK-A----SG-N-G--AS-P
Sequence 2 GAVPPACCSGIKTLDGMARTTPDRQATCKCLKSASTSISGINYGLVASLP

Sequence 1 SKCGVSIPYTISTSTDCSRYSRRMHASAD
           -KCGV-IPY-IS-STDC-R----------
Sequence 2 AKCGVNIPYKISPSTDCARVK--------



Alignment 7
Sequence 1:
Sequence 2: Allergen Pha v 3.0201, Sequence: ADC80503
Sequence identity: 53.91 (69/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
           MA------VVA--V--LV-L-A-T--AAISCGQV-S--A-CI------G-
Sequence 2 MATLNSACVVA--VLCLVVLTAPTAHAAISCGQVTSSLASCIPFLTKGGP

Sequence 1 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS
           -P-A-CCSGVRSLN-AA-TT-DR-A-CNCLK-AA----G-NA-NA---P-
Sequence 2 VP-ASCCSGVRSLNAAAKTTPDRQAVCNCLKSAAGAIPGFNANNAGILPG

Sequence 1 KCGVSIPYTISTSTDCSRYSRRMHASAD
           KCGVSIPY-ISTST-C------------
Sequence 2 KCGVSIPYKISTSTNCATIKF-------



Alignment 8
Sequence 1:
Sequence 2: Allergen Hor v 1, Sequence: AAA32970
Sequence identity: 50.00 (64/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
           MAR-Q-L---A-A-V-L-L-AA-----A--CGQV-S---PC--Y--G-G-
Sequence 2 MARAQVL-LMAAALV-LMLTAAPRAAVALNCGQVDSKMKPCLTYVQG-GP

Sequence 1 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS
           GPS--CC-GVR-L-N-A----DR---CNCLK--A-G---LN--NAASIPS
Sequence 2 GPSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPS

Sequence 1 KCGVSIPYTISTSTDCSRYSRRMHASAD
           KC-V--PYTIS---DCSR----------
Sequence 2 KCNVNVPYTISPDIDCSRIY--------



Alignment 9
Sequence 1:
Sequence 2: Allergen Pru av 3, Sequence: Q9M5X8
Sequence identity: 45.31 (58/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
           -------------VVAL----------A--CGQV-S--APCI-Y-RG-G-
Sequence 2 --MACSAMTKLALVVALCMVVSVPIAQALTCGQVSSNLAPCIAYVRGGGA

Sequence 1 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS
           -P-A-CC-G-R--NN-A-TTADR--ACNCLK---A-V-G-NA-NAA--P-
Sequence 2 VPPA-CCNGIRNINNLAKTTADRQTACNCLKQLSASVPGVNANNAAALPG

Sequence 1 KCGVSIPYTISTSTDCSRYSRRMHASAD
           KCGV--PY-IS-ST-C------------
Sequence 2 KCGVNVPYKISPSTNCATVK--------



Alignment 10
Sequence 1:
Sequence 2: Allergen Mal d 3, Sequence: Q9M5X7
Sequence identity: 46.88 (60/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
           -------AV---A-V-----A-----A-I-CGQV-S--APCI-Y-R--G-
Sequence 2 ---MASSAVTKLALVVALCMAVSVAHA-ITCGQVTSSLAPCIGYVRSGGA

Sequence 1 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS
           -P-A-CC-G-R--N--ARTTADR--ACNCLKN-A---SG-N--NAA--P-
Sequence 2 VPPA-CCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPG

Sequence 1 KCGVSIPYTISTSTDCSRYSRRMHASAD
           KCGV--PY-ISTST-C------------
Sequence 2 KCGVNVPYKISTSTNCATVK--------



Alignment 11
Sequence 1:
Sequence 2: Allergen Fra a 3.0101, Sequence: Q8VX12
Sequence identity: 47.66 (61/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEA-AISCGQVASAIAPCISYARGQG
           --------------VAL-----A---A-AI-CGQVAS-I-PC--Y----G
Sequence 2 ---MASSTAMKLSLVALLCIVVALPIAQAITCGQVASNISPCLTYVKSGG

Sequence 1 SGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIP
           --P-A-CCSG-R-LN--A-TTADR-AACNCLK-AA-G--GLN---AA--P
Sequence 2 AVPAA-CCSGIRNLNGMAKTTADRQAACNCLKQAAGGIKGLNPNLAAGLP

Sequence 1 SKCGVSIPYTISTSTDCSRYSRRMHASAD
           -KCGVS-PY-IST-T-C------------
Sequence 2 GKCGVSVPYKISTTTNCAAVK--------



Alignment 12
Sequence 1:
Sequence 2: Allergen Hev b 12, Sequence: AAL25839
Sequence identity: 46.09 (59/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
           --------------V---L-AA-----AI-CGQV-SA--PC-SY----G-
Sequence 2 ----MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGP

Sequence 1 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS
           -P-A-CC-GVR--NNAA-TTADRR-AC-CLK-AA--V-GLN----A--P-
Sequence 2 TPPATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPG

Sequence 1 KCGVSIPYTISTSTDCSRYSRRMHASAD
           KCGV-IPY-IS-ST-C------------
Sequence 2 KCGVNIPYKISLSTNCATVK--------



Alignment 13
Sequence 1:
Sequence 2: Allergen Fra a 3.0201, Sequence: Q4PLU0
Sequence identity: 46.88 (60/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEA-AISCGQVASAIAPCISYARGQG
           --------------VAL-----A---A-AI-CGQVAS-I-PC--Y----G
Sequence 2 ---MASSTAMKLSLVALLCIVVALPIAQAITCGQVASSISPCVNYVKSGG

Sequence 1 SGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIP
           --P-A-CC-G-RSLN-AA-TTADR-A-CNCLK-A-----GLN---AA--P
Sequence 2 AVPAA-CCNGIRSLNSAAKTTADRQATCNCLKQASGAIKGLNPSLAAGLP

Sequence 1 SKCGVSIPYTISTSTDCSRYSRRMHASAD
           -KCGVS-PY-ISTST-C------------
Sequence 2 GKCGVSVPYKISTSTNCAAVK--------



Alignment 14
Sequence 1:
Sequence 2: Allergen Ara h 9.0101, Sequence: ABX56711
Sequence identity: 51.56 (66/128)
Sequence 1 MARTQQLAVVATAVVALVLLA--AATSEAAISCGQVASAIAPCISYARGQ
           -------A----A-V-LV--A---A----AISCGQV-SA-APCI------
Sequence 2 ------MASLKFAFVMLVCMAMVGAPMVNAISCGQVNSALAPCIPFLT-K

Sequence 1 GSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASI
           G--P---CCSGVR-L--A-RTTADR-AACNCLK-AA----GLN-GNAA--
Sequence 2 GGAPPPACCSGVRGLLGALRTTADRQAACNCLKAAAGSLRGLNQGNAAAL

Sequence 1 PSKCGVSIPYTISTSTDCSRYSRRMHASAD
           P--CGVSIPY-ISTST-C------------
Sequence 2 PGRCGVSIPYKISTSTNCATIKF-------



Alignment 15
Sequence 1:
Sequence 2: Allergen Fra a 3.0102, Sequence: Q4PLT9
Sequence identity: 46.88 (60/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEA-AISCGQVASAIAPCISYARGQG
           --------------VAL-----A---A-AI-CGQVAS-I-PC--Y----G
Sequence 2 ---MASSTAMKLSLVALLCIVVALPIAQAITCGQVASNISPCVTYVKSGG

Sequence 1 SGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIP
           --P-A-CCSG-R-LN--A-TTADR-A-CNCLK-AA-G--GLN---AA--P
Sequence 2 AVP-APCCSGIRNLNGMAKTTADRQATCNCLKQAAGGIKGLNPNLAAGLP

Sequence 1 SKCGVSIPYTISTSTDCSRYSRRMHASAD
           -KCGVS-PY-IST-T-C------------
Sequence 2 GKCGVSVPYKISTTTNCAAVK--------



Alignment 16
Sequence 1:
Sequence 2: Allergen Len c 3.0101, Sequence: A0AT29
Sequence identity: 48.44 (62/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
           MAR---LA-V-------V---A---E-AISCG-V-S---PC--Y--G-G-
Sequence 2 MARGMKLACVVLVICMVVI--APMAEGAISCGAVTSDLSPCLTYLTG-GP

Sequence 1 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS
           GPS--CC-GV--L--AA-TT-DR-AACNCLK-AA-----LN--NAA--P-
Sequence 2 GPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPG

Sequence 1 KCGVSIPYTISTSTDCSRYSRRMHASAD
           KCGV-IPY-IST-T-C------------
Sequence 2 KCGVNIPYKISTTTNCNTVKF-------



Alignment 17
Sequence 1:
Sequence 2: Allergen Pun g 1.0301, Sequence: A0A059ST23
Sequence identity: 47.66 (61/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
           MA----L-------V-----A----EA-I-CGQV-S--A-CI-YARG-G-
Sequence 2 MASSGFLRLAGFVLVCMAV-ASTVAEAGITCGQVSSSLAGCIQYARGNGA

Sequence 1 GP-SAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIP
           GP----CC-G-RSLN-AA-TT-DR-AAC-CLK--A---SG-N-G--A--P
Sequence 2 GPVPQACCNGIRSLNSAAKTTPDRQAACRCLKSLASSISGINYGLVAGAP

Sequence 1 SKCGVSIPYTISTSTDCSRYSRRMHASAD
           -KCGVSIPY-I--ST-C------------
Sequence 2 GKCGVSIPYKIAPSTNCDNVK--------



Alignment 18
Sequence 1:
Sequence 2: Allergen Rub i 3.0101, Sequence: Q0Z8V0
Sequence identity: 47.66 (61/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEA-AISCGQVASAIAPCISYARGQG
           -------AV---A-VAL-----A---A-AI-CGQV----APC--Y----G
Sequence 2 ---MACSAVMKLALVALLCIVVAVPVAQAITCGQVTQNVAPCFNYVKNGG

Sequence 1 SGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIP
           --P-A-CC-GVR-LN--A-TTADR---CNCLKNAA----GLN---AA--P
Sequence 2 AVPAA-CCNGVRNLNSQAKTTADRQQTCNCLKNAAGSIPGLNPSLAAGLP

Sequence 1 SKCGVSIPYTISTSTDCSRYSRRMHASAD
           -KCGVS-PY-ISTST-C------------
Sequence 2 GKCGVSVPYKISTSTNCATVK--------



Alignment 19
Sequence 1:
Sequence 2: Allergen Pyr c 3, Sequence: Q9M5X6
Sequence identity: 45.31 (58/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
           -------AV---A-V-----A-----A-I-C-QV----APCI-Y-R--G-
Sequence 2 ---MASSAVIKLALVVALCMAVSVAHA-ITCSQVSANLAPCINYVRSGGA

Sequence 1 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS
           -P-A-CC-G----N--A-TT-DR-AACNCLKN-A--VSG-N-GNA-S-P-
Sequence 2 VPPA-CCNGIKTINGLAKTTPDRQAACNCLKNLAGSVSGVNPGNAESLPG

Sequence 1 KCGVSIPYTISTSTDCSRYSRRMHASAD
           KCGV--PY-ISTST-C------------
Sequence 2 KCGVNVPYKISTSTNCATVK--------



Alignment 20
Sequence 1:
Sequence 2: Allergen Fra a 3.0202, Sequence: Q4PLT6
Sequence identity: 45.31 (58/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEA-AISCGQVASAIAPCISYARGQG
           --------------VAL-----A---A-AI-CGQVAS-I-PC--Y----G
Sequence 2 ---MAISTAMKLSLVALLCIVVALPIAQAITCGQVASSISPCVNYVKSGG

Sequence 1 SGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIP
           --P-A-CC-G-RSLN-AA-TTADR---CNCLK-A-----GLN---AA--P
Sequence 2 AVPAA-CCNGIRSLNSAAKTTADRQTTCNCLKQASGAIKGLNPNLAAGLP

Sequence 1 SKCGVSIPYTISTSTDCSRYSRRMHASAD
           -KCGV--PY-ISTST-C------------
Sequence 2 GKCGVNVPYKISTSTNCAAVK--------



Alignment 21
Sequence 1:
Sequence 2: Allergen Pis s 3.0101, Sequence: A0A161AT60
Sequence identity: 47.66 (61/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARG-QG
           MAR---LA-VA------V---A---EAA-SCG-V----APC--Y------
Sequence 2 MARSMKLACVALVICMVVI--APMAEAALSCGTVSADMAPCVTYLQAPNN

Sequence 1 SGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIP
           --P---CC-GV--L--AA-TT-DR-AACNCLK-AA-----LN--NAA--P
Sequence 2 ASPPPPCCAGVKKLLAAATTTPDRQAACNCLKSAAGSIPKLNTNNAAALP

Sequence 1 SKCGVSIPYTISTSTDCSRYSRRMHASAD
           -KCGVSIPY-ISTST-C------------
Sequence 2 GKCGVSIPYKISTSTNCNTVRF-------



Alignment 22
Sequence 1:
Sequence 2: Allergen Mor n 3.0101, Sequence: P85894
Sequence identity: 45.31 (58/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
           ----------------------------I-CGQV-S--APCI-Y-R--G-
Sequence 2 ----------------------------ITCGQVSSSLAPCINYLRAGGV

Sequence 1 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS
           -P-A-CC-GVRSLNNAA-TTADR-AACNCLK-A-----GLN---AA--P-
Sequence 2 VP-ANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPG

Sequence 1 KCGVSIPYTISTSTDCSRYSRRMHASAD
           KCGVS-PY-IS-STDC------------
Sequence 2 KCGVSVPYKISPSTDCKSVK--------



Alignment 23
Sequence 1:
Sequence 2: Allergen Pru p 3, Sequence: CAB96876
Sequence identity: 43.75 (56/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
           ----------------------------I-CGQV-S--APCI-Y-RG-G-
Sequence 2 ----------------------------ITCGQVSSSLAPCIPYVRGGGA

Sequence 1 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS
           -P-A-CC-G-R--NN-ARTT-DR-AACNCLK---A-V-G-N--NAA--P-
Sequence 2 VPPA-CCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPG

Sequence 1 KCGVSIPYTISTSTDCSRYSRRMHASAD
           KCGVSIPY-IS-ST-C------------
Sequence 2 KCGVSIPYKISASTNCATVK--------



Alignment 24
Sequence 1:
Sequence 2: Allergen Ara h 9.0201, Sequence: ABX75045
Sequence identity: 45.31 (58/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
           -----------------------------SCGQV-SA-APCI------G-
Sequence 2 ----------------------------LSCGQVNSALAPCITFLT-KGG

Sequence 1 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS
           -PS--CCSGVR-L--AA-TTADR-AACNCLK-AA----GLN-GNAA--P-
Sequence 2 VPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHGLNQGNAAALPG

Sequence 1 KCGVSIPYTISTSTDCSRYSRRMHASAD
           -CGVSIPY-ISTST-C------------
Sequence 2 RCGVSIPYKISTSTNCATIKF-------



Alignment 25
Sequence 1:
Sequence 2: Allergen Pru ar 3, Sequence: P81651
Sequence identity: 42.19 (54/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
           ----------------------------I-CGQV-S--APCI-Y-RG-G-
Sequence 2 ----------------------------ITCGQVSSSLAPCIGYVRGGGA

Sequence 1 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS
           -P-A-CC-G-R--NN-ARTT-DRR-ACNCLK------SG-N--NAA--P-
Sequence 2 VPPA-CCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAAALPG

Sequence 1 KCGVSIPYTISTSTDCSRYSRRMHASAD
           KCGV-IPY-IS-ST-C------------
Sequence 2 KCGVNIPYKISASTNCATVK--------



Alignment 26
Sequence 1:
Sequence 2: Allergen Pru p 3, Sequence: P81402
Sequence identity: 43.75 (56/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
           ----------------------------I-CGQV-SA-APCI-Y-RG-G-
Sequence 2 ----------------------------ITCGQVSSALAPCIPYVRGGGA

Sequence 1 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS
           -P-A-CC-G-R--NN-ARTT-DR-AACNCLK---A-V-G-N--NAA--P-
Sequence 2 VPPA-CCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPG

Sequence 1 KCGVSIPYTISTSTDCSRYSRRMHASAD
           KCGV-IPY-IS-ST-C------------
Sequence 2 KCGVHIPYKISASTNCATVK--------



Alignment 27
Sequence 1:
Sequence 2: Allergen Pru d 3, Sequence: P82534
Sequence identity: 41.41 (53/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
           ----------------------------I-CGQV-S--APCI-Y--G-G-
Sequence 2 ----------------------------ITCGQVSSNLAPCINYVKGGGA

Sequence 1 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS
           -P-A-CC-G-R--NN-ARTTADRRAACNCLK-------G-N--NAA--P-
Sequence 2 VPPA-CCNGIRNVNNLARTTADRRAACNCLKQLSGSIPGVNPNNAAALPG

Sequence 1 KCGVSIPYTISTSTDCSRYSRRMHASAD
           KCGV--PY-IS-ST-C------------
Sequence 2 KCGVNVPYKISASTNCATVK--------



Alignment 28
Sequence 1:
Sequence 2: Allergen Pha v 3.0101, Sequence: ADC80502
Sequence identity: 42.97 (55/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
           ----------A--VV-------A-------CGQV-S---PC-------G-
Sequence 2 ----MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGF

Sequence 1 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS
           -P-AGCC-GVR---N-AR-TADRR--CNCLK-AA--V-GLN--NA---P-
Sequence 2 VP-AGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPG

Sequence 1 KCGVSIPYTISTSTDCSRYSRRMHASAD
           KCGV-IPY-ISTST-C------------
Sequence 2 KCGVNIPYKISTSTNCASIN--------



Alignment 29
Sequence 1:
Sequence 2: Allergen Lup an 3.0101, Sequence: XP_019446786
Sequence identity: 43.75 (56/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
           ----------A-AV--------A----AI-CGQV----A-C--Y-R--G-
Sequence 2 ---MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGA

Sequence 1 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS
           -P-A-CC-G-----N-A-TT-DRR-ACNCLK-AAA---GLN--NA-S-P-
Sequence 2 VP-APCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPG

Sequence 1 KCGVSIPYTISTSTDCSRYSRRMHASAD
           KCGV-IPY-ISTST-C------------
Sequence 2 KCGVNIPYKISTSTNCASIK--------



Alignment 30
Sequence 1:
Sequence 2: Allergen Tri a 14.0101, Sequence: 19846220
Sequence identity: 40.62 (52/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
           ----------------------------I-CG-V-S---PC-SY--G-G-
Sequence 2 ----------------------------IDCGHVDSLVRPCLSYVQG-GP

Sequence 1 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS
           GPS--CC-GV--L-N-AR---DR--ACNCLK--A-G---LN--NA-SIP-
Sequence 2 GPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPP

Sequence 1 KCGVSIPYTISTSTDCSRYSRRMHASAD
           KCGV--PYTIS---DCSR----------
Sequence 2 KCGVNLPYTISLNIDCSRV---------



Alignment 31
Sequence 1:
Sequence 2: Allergen Pla or 3.0101, Sequence: ABY21307
Sequence identity: 42.19 (54/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
           -------A--A----A-----A---EAAI-CG-V-----PC--Y-R--G-
Sequence 2 -MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGA

Sequence 1 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS
           ---A-CC-GV--LNN-A-TT-DR-AAC-CLK-A----SG---GNAAS---
Sequence 2 VAPA-CCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAG

Sequence 1 KCGVSIPYTISTSTDCSRYSRRMHASAD
           KCGV--PY-IS---DCS-----------
Sequence 2 KCGVNLPYKISPTIDCSKVK--------



Alignment 32
Sequence 1:
Sequence 2: Allergen Pla a 3.0101, Sequence: CAL07989
Sequence identity: 41.41 (53/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
           -------A--A----A-----A---EAAI-CG-V-----PC----R--G-
Sequence 2 -MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGA

Sequence 1 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS
           ---A-CC-GV--LNN-A-TT-DR-AAC-CLK-A----SG---GNAAS---
Sequence 2 VAPA-CCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAG

Sequence 1 KCGVSIPYTISTSTDCSRYSRRMHASAD
           KCGV--PY-IS---DCS-----------
Sequence 2 KCGVNLPYKISPTIDCSKVK--------



Alignment 33
Sequence 1:
Sequence 2: Allergen Can s 3.0101, Sequence: W0U0V5
Sequence identity: 40.62 (52/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
           ----------------------------I-CGQVAS--APC-SY----G-
Sequence 2 ----------------------------ITCGQVASSLAPCLSYLKVGGA

Sequence 1 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS
           -P--GCC----SL--AA-T-ADR-AAC-CLK-AA----G-N---A---P-
Sequence 2 VPD-GCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKGVNFNLASGLPG

Sequence 1 KCGVSIPYTISTSTDCSRYSRRMHASAD
           KCGVSIPY-IS-STDCS-----------
Sequence 2 KCGVSIPYKISPSTDCSSVK--------



Alignment 34
Sequence 1:
Sequence 2: Allergen Cor a 8, Sequence: AAK28533
Sequence identity: 39.06 (50/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
           ------------AV------AA----A---C-Q------PC--Y----G-
Sequence 2 ----MGSLKLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGV

Sequence 1 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS
           -P---CC-GVR--N-A-RTT-DR--ACNCLK--A-G--GLN---AA--P-
Sequence 2 LPPS-CCKGVRAVNDASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPG

Sequence 1 KCGVSIPYTISTSTDCSRYSRRMHASAD
           KCGV-IPY-IS-ST-C------------
Sequence 2 KCGVNIPYKISPSTNCNNVK--------



Alignment 35
Sequence 1:
Sequence 2: Allergen Lyc e 3, Sequence: AAB42069
Sequence identity: 39.06 (50/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
           --------------V-------A------SCG-V-S--APC--Y--G-G-
Sequence 2 ----MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRG-

Sequence 1 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS
           -P--GCC-GV--L--AA-T--DR--AC-CLK-AA----G---G-AA--P-
Sequence 2 -PLGGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPG

Sequence 1 KCGVSIPYTISTSTDCSRYSRRMHASAD
           -CGV-IPY-IS-STDCS-----------
Sequence 2 VCGVNIPYKISPSTDCSTVQ--------



Alignment 36
Sequence 1:
Sequence 2: Allergen Sola l 3.0101, Sequence: P93224
Sequence identity: 39.06 (50/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
           --------------V-------A------SCG-V-S--APC--Y--G-G-
Sequence 2 ----MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRG-

Sequence 1 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS
           -P--GCC-GV--L--AA-T--DR--AC-CLK-AA----G---G-AA--P-
Sequence 2 -PLGGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPG

Sequence 1 KCGVSIPYTISTSTDCSRYSRRMHASAD
           -CGV-IPY-IS-STDCS-----------
Sequence 2 VCGVNIPYKISPSTDCSTVQ--------



Alignment 37
Sequence 1:
Sequence 2: Allergen Pru du 3.0101, Sequence: ACN11576
Sequence identity: 47.66 (61/128)
Sequence 1 MARTQQLA--VVATAVVALVLLAAATSEAAISCGQVASAIAPCISY-ARG
           MA---QL---V---AV------------AA-SCGQV-----PCI-Y-A-G
Sequence 2 MASSGQLLKLVCLVAVMCCMAVGGPKAMAAVSCGQVVNNLTPCINYVANG

Sequence 1 QGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGV--SGLNAGNA
           ----PS--CC-GVRSL---A-TTADR---CNCLK-A--G------NAG-A
Sequence 2 GALNPS--CCTGVRSLYSLAQTTADRQSICNCLKQAVNGIPYTNANAGLA

Sequence 1 ASIPSKCGVSIPYTISTSTDCSRYSRRMHASAD
           A--P-KCGV-IPY-IS-STDC------------
Sequence 2 AGLPGKCGVNIPYKISPSTDCKTIK--------



Alignment 38
Sequence 1:
Sequence 2: Allergen Api g 2, Sequence: ACV04796
Sequence identity: 40.62 (52/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAI---SCGQVASAIAPCISYARG
           ---------VA-AV------------A------CGQV------C--Y--G
Sequence 2 ----MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKG

Sequence 1 QGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAAS
           -G--PS--CC-GV--LN--A-T-ADR--AC-CLK--A--V-G-N-G-A--
Sequence 2 -GGYPSPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASA

Sequence 1 IPSKCGVSIPYTISTSTDCSRYSRRMHASAD
           -P-KCG--IPY-IS-STDCSR----------
Sequence 2 LPGKCGIRIPYPISPSTDCSRVN--------



Alignment 39
Sequence 1:
Sequence 2: Allergen Art gm 3.0102, Sequence: ANC85023
Sequence identity: 39.84 (51/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
           --------V----VV--V-------EAA--C--V---I-PC-S-----G-
Sequence 2 -MAMKMMKVFCVMVVCMVV-SSSYAEAALTCSDVSNKISPCLSFLKQGGE

Sequence 1 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS
           -P-A-CC-GV--LN-AA-TT-DR--ACNCLK--------L---NA---PS
Sequence 2 VP-ADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDNAVVLPS

Sequence 1 KCGVSIPYTISTSTDCSRYSRRMHASAD
           KCGV-IPY-IS--TDC------------
Sequence 2 KCGVNIPYKISLETDCNKVK--------



Alignment 40
Sequence 1:
Sequence 2: Allergen Art an 3.0101, Sequence: ANC85017
Sequence identity: 40.62 (52/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
           --------V----VV--V-------EAA--C--V---I-PC-S----QG-
Sequence 2 -MAMKMMKVFCVMVVCMVV-SSSYAEAALTCSDVSNKILPCTSFLK-QGG

Sequence 1 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS
           --SA-CC-GV--LN-AA-TT-DR-AACNCLK------------NA---PS
Sequence 2 EVSADCCTGVKGLNDAAKTTPDRQAACNCLKTTFKSNKDFKSDNAVVLPS

Sequence 1 KCGVSIPYTISTSTDCSRYSRRMHASAD
           KCGV-IPY-IS--TDC------------
Sequence 2 KCGVNIPYKISLETDCNKVK--------



Alignment 41
Sequence 1:
Sequence 2: Allergen Art ca 3.0101, Sequence: ANC85021
Sequence identity: 40.62 (52/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
           --------V----VV--V-------EAA--C--V---I-PC-S----QG-
Sequence 2 -MAMKMMKVFCVMVVCMVV-SSSYAEAALTCSDVSNKILPCTSFLK-QGG

Sequence 1 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS
           --SA-CC-GV--LN-AA-TT-DR-AACNCLK------------NA---PS
Sequence 2 EVSADCCTGVKGLNDAAKTTPDRQAACNCLKTTFKSNKDFKSDNAVVLPS

Sequence 1 KCGVSIPYTISTSTDCSRYSRRMHASAD
           KCGV-IPY-IS--TDC------------
Sequence 2 KCGVNIPYKISLETDCNKVK--------



Alignment 42
Sequence 1:
Sequence 2: Allergen Art gm 3.0101, Sequence: ANC85022
Sequence identity: 39.84 (51/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
           --------V----VV--V-------EAA--C--V---I-PC-S-----G-
Sequence 2 -MAMKMMKVFCVMVVCMVV-SSSYAEAALTCSDVSNKISPCTSFLKQGGE

Sequence 1 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS
           -P-A-CC-GV--LN-AA-TT-DR--ACNCLK------------NAA--PS
Sequence 2 VP-ADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDFKSDNAAVLPS

Sequence 1 KCGVSIPYTISTSTDCSRYSRRMHASAD
           KCGV-IPY-IS--TDC------------
Sequence 2 KCGVNIPYKISLETDCNKVK--------



Alignment 43
Sequence 1:
Sequence 2: Allergen Ara h 17.0101, Sequence: A0A510A9S3
Sequence identity: 41.41 (53/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQG-
           ---------------------------AI-C--V---IAPC--Y----G-
Sequence 2 ---------------------------AIQCSFVTKSIAPCFGYLKSGGT

Sequence 1 -SGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGV-SGLNAGNAAS
           -SGP---CCSG----N--A-TT-DR-A-CNCLK-AAA---S--N--NAAS
Sequence 2 VSGP---CCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAAS

Sequence 1 IPSKCGVSIPYTISTSTDCSRYSRRMHASAD
           -P-KCGVSIPY-ISTS--CS-----------
Sequence 2 LPGKCGVSIPYKISTSINCSSIK--------



Alignment 44
Sequence 1:
Sequence 2: Allergen Art an 3.0102, Sequence: ANC85018
Sequence identity: 39.84 (51/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
           --------V----VV--V-------EAA--C--V---I-PC-S-----G-
Sequence 2 -MAMKMMKVFCVMVVCMVV-TSSYAEAALTCNDVTKKISPCTSFLEKGGE

Sequence 1 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS
           -P---CC-GV--LN-AA-TT-DR-AACNCLK------------NAA--PS
Sequence 2 VP-VDCCTGVKGLNDAAKTTPDRQAACNCLKTSFKSSNNFKEENAAVLPS

Sequence 1 KCGVSIPYTISTSTDCSRYSRRMHASAD
           KCGV-IPY-IS--TDC------------
Sequence 2 KCGVNIPYKISLETDCNKVK--------



Alignment 45
Sequence 1:
Sequence 2: Allergen Art ca 3.0102, Sequence: QIN55516
Sequence identity: 39.06 (50/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
           --------V-----V--V-L-----EAA--C--V---I-PC-S-----G-
Sequence 2 -MAMKMMKVFCVMIVCMVVLSSY-AEAALTCSDVSNKITPCLSFLKQGGE

Sequence 1 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS
           -P-A-CC-GV--LN-AA-T--DR--ACNCLK--------L---NA---PS
Sequence 2 VP-ADCCTGVKGLNDAAKTGPDRQKACNCLKTTFKSNKDLKSDNAVVLPS

Sequence 1 KCGVSIPYTISTSTDCSRYSRRMHASAD
           KCGV-IPY-IS--TDC------------
Sequence 2 KCGVNIPYKISLETDCNTVK--------



Alignment 46
Sequence 1:
Sequence 2: Allergen Art si 3.0102, Sequence: ANC85027
Sequence identity: 39.06 (50/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
           ------------A-V----L-----EA---C--V---I-PC--Y----G-
Sequence 2 --MAMKMMKFFCAMVVCMVLSSSYAEA-LTCSDVSNKITPCLNYLKQGGE

Sequence 1 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS
           -P-A-CC-GV--LN-AA-TT-DR--ACNCLK--------L----AAS-PS
Sequence 2 VP-ADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPS

Sequence 1 KCGVSIPYTISTSTDCSRYSRRMHASAD
           KCGV-IPY-IS--TDC------------
Sequence 2 KCGVNIPYKISLETDCNKVK--------



Alignment 47
Sequence 1:
Sequence 2: Allergen Art v 3.0202, Sequence: ACE07187
Sequence identity: 39.06 (50/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
           ------------A-V----L-----EA---C--V---I-PC--Y----G-
Sequence 2 --MAMKMMKFFCAMVVCMVLSSSYAEA-LTCSDVSNKITPCLNYLKQGGE

Sequence 1 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS
           -P-A-CC-GV--LN-AA-TT-DR--ACNCLK--------L----AAS-PS
Sequence 2 VP-ADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPS

Sequence 1 KCGVSIPYTISTSTDCSRYSRRMHASAD
           KCGV-IPY-IS--TDC------------
Sequence 2 KCGVNIPYKISLETDCNKVK--------



Alignment 48
Sequence 1:
Sequence 2: Allergen Art ar 3.0102, Sequence: ANC85020
Sequence identity: 39.06 (50/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
           ------------A-V----L-----EA---C--V---I-PC--Y----G-
Sequence 2 --MAMKMMKFFCAMVVCMVLSSSYAEA-LTCSDVSNKITPCLNYLKQGGE

Sequence 1 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS
           -P-A-CC-GV--LN-AA-TT-DR--ACNCLK--------L----AAS-PS
Sequence 2 VP-ADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPS

Sequence 1 KCGVSIPYTISTSTDCSRYSRRMHASAD
           KCGV-IPY-IS--TDC------------
Sequence 2 KCGVNIPYKISLETDCNKVK--------



Alignment 49
Sequence 1:
Sequence 2: Allergen Sola l 7.0101, Sequence: NP_001316123
Sequence identity: 39.84 (51/128)
Sequence 1 MARTQQLAVVATAVVALVLLA----AATSEAAISCGQVASAIAPCISYAR
           ----------A-A---LV-LA----A-----AI-CGQV----APC-----
Sequence 2 --------MKAIAILVLVVLAVFQLAMVARGAITCGQVDANLAPCVPFLT

Sequence 1 GQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAA
           -QG--P-A-CCSGVR-LN-------DRR-ACNC-K-AA-----L----A-
Sequence 2 -QGGEPGAACCSGVRTLNGNTQSSDDRRTACNCVKAAANRYPNLKDDAAQ

Sequence 1 SIPSKCGVSIPYTISTSTDCSRYSRRMHASAD
           S-PSKCG-S----IS----C---S--------
Sequence 2 SLPSKCGISLTVPISRTVNCDTIS--------



Alignment 50
Sequence 1:
Sequence 2: Allergen Art la 3.0102, Sequence: ANC85025
Sequence identity: 36.72 (47/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
           --------V----VV--V-------EAA--C--V---I-PC-SY----G-
Sequence 2 ---MKMMKVFCVMVVCMVV-KSSYAEAALTCSDVSTKISPCLSYLKKGGE

Sequence 1 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS
           -P-A-CC-GV--LN-A--TT-DR--ACNCLK--------L----A---PS
Sequence 2 VP-ADCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPS

Sequence 1 KCGVSIPYTISTSTDCSRYSRRMHASAD
           KCG---PY--S--TDC------------
Sequence 2 KCGLNLPYKLSLETDCNKVK--------



Alignment 51
Sequence 1:
Sequence 2: Allergen Art si 3.0101, Sequence: ANC85026
Sequence identity: 36.72 (47/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEA-AISCGQVASAIAPCISYARGQG
           --------------V--V------S-A-A--C--V---I-PC--Y----G
Sequence 2 ----MAMKMMKVFCVMVVCMVVSSSYAEALTCSDVSNKISPCLNYLKQGG

Sequence 1 SGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIP
           --P-A-CC-GV--LN-AA-TT-DR--AC-CLKN-------L----A---P
Sequence 2 EVP-ANCCAGVKGLNDAAKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLP

Sequence 1 SKCGVSIPYTISTSTDCSRYSRRMHASAD
           SKCGV-IPY--S--TDC------------
Sequence 2 SKCGVTIPYKLSMETDCNKVK--------



Alignment 52
Sequence 1:
Sequence 2: Allergen Art v 3.0301, Sequence: EU564847
Sequence identity: 35.94 (46/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
           --------V----VV--V-------E-A--C--V---I-PC-SY----G-
Sequence 2 -MAIKMMKVFCIMVVCMVV-STSYAESALTCSDVSTKISPCLSYLKKGGE

Sequence 1 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS
           -P-A-CC-GV--LN-A--TT-DR--ACNCLK--------L----A---PS
Sequence 2 VP-ADCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPS

Sequence 1 KCGVSIPYTISTSTDCSRYSRRMHASAD
           KCG---PY--S--TDC------------
Sequence 2 KCGLNLPYKLSLETDCNKVK--------



Alignment 53
Sequence 1:
Sequence 2: Allergen Art v 3.0201, Sequence: EU564845
Sequence identity: 37.50 (48/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
           ------------A-V----------EA---C--V---I--C-SY----G-
Sequence 2 ----MKMMKFFCAMVVCMVVSSSYAEA-LKCSDVSNKISACLSYLKQGGE

Sequence 1 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS
           -P-A-CC-GV--LN-AA-TT-DR--ACNCLK-------------AAS-PS
Sequence 2 VP-ADCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPS

Sequence 1 KCGVSIPYTISTSTDCSRYSRRMHASAD
           KCGV-IPY-IS--TDC------------
Sequence 2 KCGVNIPYKISLETDCNKVK--------



Alignment 54
Sequence 1:
Sequence 2: Allergen Art ar 3.0101, Sequence: ANC85019
Sequence identity: 37.50 (48/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
           ------------A-V----------EA---C--V---I--C-SY----G-
Sequence 2 --MAMKMMKFFCAMVVCMVVSSSYAEA-LKCSDVSNKISACLSYLKQGGE

Sequence 1 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS
           -P-A-CC-GV--LN-AA-TT-DR--ACNCLK-------------AAS-PS
Sequence 2 VP-ADCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPS

Sequence 1 KCGVSIPYTISTSTDCSRYSRRMHASAD
           KCGV-IPY-IS--TDC------------
Sequence 2 KCGVNIPYKISLETDCNKVK--------



Alignment 55
Sequence 1:
Sequence 2: Allergen Art la 3.0101, Sequence: ANC85024
Sequence identity: 37.50 (48/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
           ------------A-V----------EA---C--V---I--C-SY----G-
Sequence 2 --MAMKMMKFFCAMVVCMVVSSSYAEA-LKCSDVSNKISACLSYLKQGGE

Sequence 1 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS
           -P-A-CC-GV--LN-AA-TT-DR--ACNCLK-------------AAS-PS
Sequence 2 VP-ADCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPS

Sequence 1 KCGVSIPYTISTSTDCSRYSRRMHASAD
           KCGV-IPY-IS--TDC------------
Sequence 2 KCGVNIPYKISLETDCNKVK--------



Alignment 56
Sequence 1:
Sequence 2: Allergen Sin a 3.0101, Sequence: ABU95411
Sequence identity: 37.50 (48/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
           ---------------------------A-SCG-V-S--A-CI-Y------
Sequence 2 ---------------------------ALSCGTVNSNLAACIGYLTQNAP

Sequence 1 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS
           -P--GCC-GV--LNN-ARTT-DR--AC-CL--AA-----LNA--AA--P-
Sequence 2 LPK-GCCTGVTNLNNMARTTPDRQQACRCLVGAANSFPSLNAARAAALPK

Sequence 1 KCGVSIPYTISTSTDCSRYSRRMHASAD
           -CGV-IPY-IS-ST-C------------
Sequence 2 ACGVNIPYKISKSTNCNSVR--------



Alignment 57
Sequence 1:
Sequence 2: Allergen Par j 2, Sequence: O04403
Sequence identity: 32.03 (41/128)
Sequence 1 --MARTQQLAVVATAV--VALVLLAAATSEAAISCGQVASAIAPCISYAR
           --------L-V-A-A--------LA-A-------CG-V---I-PC-----
Sequence 2 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK

Sequence 1 GQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAA
           G----PS--CCSG---L-----TT---R-AC-C---A--G-SG------A
Sequence 2 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA

Sequence 1 SIPSKCGVS--IPYTISTSTDCSRYSRRMHASAD
           --P-KCG-----P--I----DCS-----------
Sequence 2 EVPKKCGITTTLP-PITADFDCSKIESTIFRGYY



Alignment 58
Sequence 1:
Sequence 2: Allergen Hel a 3.0101, Sequence: P82007
Sequence identity: 30.47 (39/128)
Sequence 1 MARTQQLAVVATAVVALVLLAA--ATSEAAISCGQVASAIAPCISYARGQ
           ------------A--A----A--------AI-C--V-----PC--Y-R--
Sequence 2 ----MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSG

Sequence 1 GSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASI
           G--P---CC-G---L--A-RT-ADRR-AC-C-K-AA----------A-S-
Sequence 2 GK-PTPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSL

Sequence 1 PSKCGVSIPYTISTSTDCSRYSRRMHASAD
           P-KCG-S----I-----C------------
Sequence 2 PGKCGISTSIPINPNVNCNTIP--------



Alignment 59
Sequence 1:
Sequence 2: Allergen Par j 2, Sequence: P55958
Sequence identity: 31.25 (40/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAIS-----CGQVASAIAPCISYA
           --RT---A-------AL-----A----A-------CG-V---I-PC----
Sequence 2 -MRTVSMAALVVIAAALAWTSSAEPAPAPAPGEEACGKVVQDIMPCLHFV

Sequence 1 RGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNA
           -G----PS--CCSG---L-----TT---R-AC-C---A--G-SG------
Sequence 2 KGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELV

Sequence 1 ASIPSKCGV--SIPYTISTSTDCSRYSRRMHASAD
           A--P-KC------P--I----DCS-----------
Sequence 2 AEVPKKCDIKTTLP-PITADFDCSKIQSTIFRGYY



Alignment 60
Sequence 1:
Sequence 2: Allergen Par j 1, Sequence: Q40905
Sequence identity: 31.25 (40/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAA----TSEAAI----------SCGQVAS
           --------V-A---VALV---AA----TS-A-------------CG-V--
Sequence 2 -----MRTVSARSSVALVVIVAAVLVWTSSASVAPAPAPGSEETCGTVVG

Sequence 1 AIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAG
           A--PC-----G----PS-GCCSG---L-----T---R--AC-C---A---
Sequence 2 ALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKT

Sequence 1 VSGLNAGNAASIPSKCGV---SIPYTISTSTDCSRYSRRMHASAD
           -S----------P--CG------P--I----DC------------
Sequence 2 YSDIDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTLGVLHYKGN-



Alignment 61
Sequence 1:
Sequence 2: Allergen Par j 1, Sequence: O04404
Sequence identity: 28.12 (36/128)
Sequence 1 -----MARTQQLAVVATAVVALVLLAAATSEAAI-----SCGQVASAIAP
           -----------L-V---A--A---LA-----A--------CG-V--A--P
Sequence 2 MRTVSAPSAVALVVIVAAGLAWTSLASVAPPAPAPGSEETCGTVVRALMP

Sequence 1 CISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGL
           C-----G----PS-GCCSG---L-----T---R--AC-C---A----S--
Sequence 2 CLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSDI

Sequence 1 NAGNAASIPSKCGV---SIPYTISTSTDCSRYSRRMHASAD---------
           --------P--CG------P--I----DC---------------------
Sequence 2 DGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTLGVVPRQPQLPVSLRHGPV

Sequence 1 ---------------------------
           ---------------------------
Sequence 2 TGPSDPAHKARLERPQIRVPPPAPEKA



Alignment 62
Sequence 1:
Sequence 2: Allergen Amb a 6, Sequence: O04004
Sequence identity: 28.12 (36/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATS--EAAISCGQVASAIAPCISYARGQ
           --------------V-L-L---------A---C--V----APC-----GQ
Sequence 2 ---MDCIRILWSVAVGLLLVSWRPTMFAASPTCDTVQNILAPCAGFLTGQ

Sequence 1 GSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASI
           ---PS--CC-GV--LNN---T-ADR-A-CNC-K-----------------
Sequence 2 E--PSKACCTGVNNLNNSRKTKADRVAVCNCIKELTKSIA-YDPKRMPLL

Sequence 1 PSKCGVSIPY-TISTSTDCSRYSRRMHASAD
           --KCGV-----------DCS-----------
Sequence 2 STKCGVKPDFPAVDKNLDCSKLPV-------



Alignment 63
Sequence 1:
Sequence 2: Allergen Par j 1, Sequence: P43217
Sequence identity: 21.88 (28/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
           ------------------------------CG----A--PC-----G---
Sequence 2 ---------------------------QETCGTMVRALMPCLPFVQGKEK

Sequence 1 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS
           -PS-GCCSG---L-----T---R--AC-C---A----S----------P-
Sequence 2 EPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPK

Sequence 1 KCGV---SIPYTISTSTDCSRYSRRMHASAD-------------------
           -CG------P--I----DC-------------------------------
Sequence 2 HCGIVDSKLP-PIDVNMDCKTVGVVPRQPQLPVSLRHGPVTGPSDPAHKA

Sequence 1 -----------------
           -----------------
Sequence 2 RLERPQIRVPPPAPEKA



Alignment 64
Sequence 1:
Sequence 2: Allergen Par j 1.0103, Sequence: CAI94601
Sequence identity: 21.88 (28/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
           ------------------------------CG----A--PC-----G---
Sequence 2 ---------------------------QETCGTMVRALMPCLPFVQGKEK

Sequence 1 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS
           -PS-GCCSG---L-----T---R--AC-C---A----S----------P-
Sequence 2 EPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPK

Sequence 1 KCGV---SIPYTISTSTDCSRYSRRMHASAD-------------------
           -CG------P--I----DC-------------------------------
Sequence 2 HCGIVDSKLP-PIDVNMDCKTLGVVPRQPQLPVSLRHGPVTGPSDPAHKA

Sequence 1 -----------------
           -----------------
Sequence 2 RLERPQIRVPPPAPEKA



Alignment 65
Sequence 1:
Sequence 2: Allergen Par j 1.0101, Sequence: CAA54587
Sequence identity: 20.31 (26/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
           ------------------------------------A--PC-----G---
Sequence 2 ---------------------------------MVRALMPCLPFVQGKEK

Sequence 1 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS
           -PS-GCCSG---L-----T---R--AC-C---A----S----------P-
Sequence 2 EPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPK

Sequence 1 KCGV---SIPYTISTSTDCSRYSRRMHASAD-------------------
           -CG------P--I----DC-------------------------------
Sequence 2 HCGIVDSKLP-PIDVNMDCKTVGVVPRQPQLPVSLRHGPVTGPSDPAHKA

Sequence 1 -----------------
           -----------------
Sequence 2 RLERPQIRVPPPAPEKA



Alignment 66
Sequence 1:
Sequence 2: Allergen Vit v 1, Sequence: P80274
Sequence identity: 12.50 (16/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
           ------------------------------CGQVASA--PCI-Y----G-
Sequence 2 ---------------------------TVTCGQVASALSPCIDYLQKDGA

Sequence 1 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS
           -P---CC----S--------------------------------------
Sequence 2 VPAGSCCXKXLSSA------------------------------------

Sequence 1 KCGVSIPYTISTSTDCSRYSRRMHASAD
           ----------------------------
Sequence 2 ----------------------------



Alignment 67
Sequence 1:
Sequence 2: Allergen Art v 3.0101, Sequence: P0C088
Sequence identity: 13.28 (17/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
           ---------------------------A--C--V---I-PC-SY----G-
Sequence 2 ---------------------------ALTCSDVSNKISPCLSYLKQGGE

Sequence 1 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS
           -P-A-CC-GV--LN------------------------------------
Sequence 2 VP-ADCCAGVKGLND-----------------------------------

Sequence 1 KCGVSIPYTISTSTDCSRYSRRMHASAD
           ----------------------------
Sequence 2 ----------------------------



Alignment 68
Sequence 1:
Sequence 2: Allergen Cas s 8, Sequence: 10998016
Sequence identity: 10.94 (14/128)
Sequence 1 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS
           ----------------------------I-C-QV-----PC--Y----G-
Sequence 2 ---------------------------SITCTQVSKSLMPCLTYLKSNGG

Sequence 1 GPSAG-CCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIP
           -P--G-CC-GV---------------------------------------
Sequence 2 SPPPGTCCQGVKL-------------------------------------

Sequence 1 SKCGVSIPYTISTSTDCSRYSRRMHASAD
           -----------------------------
Sequence 2 -----------------------------


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.