The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Bla g 7.0101

Sequence 8101069

Full FASTA alignment

Sequence name:
Query sequence:
MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKI
QQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLE
RSEERLATATAKLAEASQAADESERARKILESKGLADEERMDALENQLKE
ARFMAEEADKKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
GNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAEFAERSVQKLQ
KEVDRLEDELVHEKEKYKYICDDLDMTFTELIGN

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Bla g 7.0101AAF72534Go!284297.05.3e-82
2Per a 7.0102AAD19606Go!284294.23.7e-81
3Per a 7Q9UB83Go!284289.41.0e-79
4Aed a 10.0101Q17H75Go!285265.71.4e-72
5Bomb m 3.0101NP_001103782Go!285265.71.4e-72
6Copt f 7.0101AGM32377.1Go!256257.73.2e-70
7Chi k 10CAA09938Go!285257.15.4e-70
8Scy p 1.0101A7L5V2Go!284250.26.6e-68
9Hom a 1.0102AAC48288Go!284249.88.3e-68
10Hom a 1.0101O44119Go!284248.32.3e-67
11Pro c 1.0101C0LU07Go!284248.02.9e-67
12Por p 1.0101M1H607Go!284248.02.9e-67
13Pen m 1AAX37288Go!284247.54.1e-67
14Lit v 1.0101EU410072Go!284247.54.1e-67
15Pen a 111893851Go!284247.54.1e-67
16Mac r 1.0101D3XNR9Go!284246.96.5e-67
17Pan b 1.0101CBY17558Go!284246.77.3e-67
18Mel l 1.0101M4M2H6Go!284245.51.6e-66
19Der f 10.0101BAA04557Go!299244.73.0e-66
20Cho a 10.0101AEX31649Go!284242.71.1e-65
21Der p 10O18416Go!284241.13.5e-65
22Blo t 10.0101ABU97466Go!284240.17.0e-65
23Pan s 1O61379Go!274239.69.7e-65
24Tyr p 10.0101AAT40866Go!284239.69.9e-65
25Lep d 10Q9NFZ4Go!284239.31.2e-64
26Met e 1Q25456Go!274237.34.8e-64
27Cha f 1Q9N2R3Go!264235.12.1e-63
28Ani s 3Q9NAS5Go!284214.73.1e-57
29Asc l 3.0101ACN32322Go!287213.47.8e-57
30Lep s 1CAC84590Go!284197.45.1e-52
31Aed a 10.0201Q17H80Go!284193.38.8e-51
32Hel as 1CAB38044Go!284193.19.9e-51
33Hal l 1.0101APG42675Go!284189.61.1e-49
34Hal d 1AAG08987Go!284188.52.4e-49
35Sac g 1.0101AVD53650Go!284183.01.1e-47
36Per v 1AAG08988Go!284172.31.8e-44
37Mim n 1AAG08989Go!284170.27.9e-44
38Pan h 4.0201XP_026775428Go!284166.97.7e-43
39Sal s 4.0101NP_001117128Go!284165.71.7e-42
40Cra g 1AAK96889Go!233157.93.3e-40
41Pan h 4.0101XP_026781482Go!284156.51.0e-39
42Der f 11.0101AAK39511Go!69245.94.8e-06
43Rap v 2.0101QPB41107Go!85945.96.2e-06
44Der p 11AAO73464Go!87545.67.9e-06
45Blo t 11AAM83103Go!87543.43.5e-05
46Ani s 2AAF72796Go!86939.55.4e-04

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Bla g 7.0101, Sequence: AAF72534
Sequence identity: 100.00 (284/284)
Sequence 1 MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKI
           MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKI
Sequence 2 MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKI

Sequence 1 QQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLE
           QQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLE
Sequence 2 QQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLE

Sequence 1 RSEERLATATAKLAEASQAADESERARKILESKGLADEERMDALENQLKE
           RSEERLATATAKLAEASQAADESERARKILESKGLADEERMDALENQLKE
Sequence 2 RSEERLATATAKLAEASQAADESERARKILESKGLADEERMDALENQLKE

Sequence 1 ARFMAEEADKKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
           ARFMAEEADKKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
Sequence 2 ARFMAEEADKKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV

Sequence 1 GNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAEFAERSVQKLQ
           GNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAEFAERSVQKLQ
Sequence 2 GNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAEFAERSVQKLQ

Sequence 1 KEVDRLEDELVHEKEKYKYICDDLDMTFTELIGN
           KEVDRLEDELVHEKEKYKYICDDLDMTFTELIGN
Sequence 2 KEVDRLEDELVHEKEKYKYICDDLDMTFTELIGN



Alignment 2
Sequence 1:
Sequence 2: Allergen Per a 7.0102, Sequence: AAD19606
Sequence identity: 98.59 (280/284)
Sequence 1 MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKI
           MDAIKKKMQAMKLEKDNAMDRALLCEQQARDAN-RAEKAEEEARSLQKKI
Sequence 2 MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANLRAEKAEEEARSLQKKI

Sequence 1 QQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLE
           QQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLE
Sequence 2 QQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLE

Sequence 1 RSEERLATATAKLAEASQAADESERARKILESKGLADEERMDALENQLKE
           RSEERLATATAKLAEASQAADESERARKILESKGLADEERMDALENQLKE
Sequence 2 RSEERLATATAKLAEASQAADESERARKILESKGLADEERMDALENQLKE

Sequence 1 ARFMAEEADKKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
           ARFMAEEADKKYDEVARKLAMVEADLERAEERAE-GESKIVELEEELRVV
Sequence 2 ARFMAEEADKKYDEVARKLAMVEADLERAEERAESGESKIVELEEELRVV

Sequence 1 GNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAEFAERSVQKLQ
           GNNLKSLEVSEEKANLREEEYKQQIKTL-TRLKEAEARAEFAERSVQKLQ
Sequence 2 GNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAEARAEFAERSVQKLQ

Sequence 1 KEVDRLEDELVHEKEKYKYICDDLDMTFTELIGN
           KEVDRLEDELVHEKEKYK-ICDDLDMTFTELIGN
Sequence 2 KEVDRLEDELVHEKEKYKFICDDLDMTFTELIGN



Alignment 3
Sequence 1:
Sequence 2: Allergen Per a 7, Sequence: Q9UB83
Sequence identity: 97.18 (276/284)
Sequence 1 MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKI
           MDAIKKKMQAMKLEKDNAMD-ALLCEQQARDAN-RAEKAEEEARSLQKKI
Sequence 2 MDAIKKKMQAMKLEKDNAMDCALLCEQQARDANLRAEKAEEEARSLQKKI

Sequence 1 QQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLE
           QQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLE
Sequence 2 QQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLE

Sequence 1 RSEERLATATAKLAEASQAADESERARKILESKGLADEERMDALENQLKE
           RSEERLATATAKLAEASQA-DESERARKILESKGLADEERMDALENQLKE
Sequence 2 RSEERLATATAKLAEASQAVDESERARKILESKGLADEERMDALENQLKE

Sequence 1 ARFMAEEADKKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
           ARFMAEEADKKYDEVARKLAMVEADLERAEERAE-GESKIVELEEELRVV
Sequence 2 ARFMAEEADKKYDEVARKLAMVEADLERAEERAESGESKIVELEEELRVV

Sequence 1 GNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAEFAERSVQKLQ
           GNNLKSLEVSEEKANLREEEYKQQIKTL-TRLKEAEARAEFAERSVQKLQ
Sequence 2 GNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAEARAEFAERSVQKLQ

Sequence 1 KEVDRLEDELVHEKEKYKYICDDLDMTFTELIGN
           KEVDRLEDELVHEKEKYK-ICDDLDMTFTEL-G-
Sequence 2 KEVDRLEDELVHEKEKYKFICDDLDMTFTELAGY



Alignment 4
Sequence 1:
Sequence 2: Allergen Aed a 10.0101, Sequence: Q17H75
Sequence identity: 89.44 (254/284)
Sequence 1 MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKI
           MDAIKKKMQAMKLEKDNA-DRALLCEQQARDAN-RAEKAEEEAR-LQKKI
Sequence 2 MDAIKKKMQAMKLEKDNALDRALLCEQQARDANLRAEKAEEEARQLQKKI

Sequence 1 QQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLE
           Q-IENDLDQT-E-LM-VNAKL-EK-KALQNAESEVAALNRRIQLLEEDLE
Sequence 2 QAIENDLDQTQEALMAVNAKLEEKEKALQNAESEVAALNRRIQLLEEDLE

Sequence 1 RSEERLATATAKLAEASQAADESERARKILESKGLADEERMDALENQLKE
           RSEERLA-ATAKL-EAS-AADESERARK-LE---LADEERMDALENQLKE
Sequence 2 RSEERLASATAKLSEASAAADESERARKVLENRALADEERMDALENQLKE

Sequence 1 ARFMAEEADKKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
           ARFMAEEADKKYDEVARKLAMVEADLERAEERAE-GE-KIVELEEELRVV
Sequence 2 ARFMAEEADKKYDEVARKLAMVEADLERAEERAEAGEGKIVELEEELRVV

Sequence 1 GNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAEFAERSVQKLQ
           GNNLKSLEVSEEKAN-REEEYK-QIKTL-TRLKEAEARAEFAERSVQKLQ
Sequence 2 GNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAEFAERSVQKLQ

Sequence 1 KEVDRLEDELVHEKEKYKYICDDLDMTFTELIGN-
           KEVDRLEDELV-EKEKY--I-DDLD--F-ELI---
Sequence 2 KEVDRLEDELVMEKEKYREIGDDLDTAFVELILKE



Alignment 5
Sequence 1:
Sequence 2: Allergen Bomb m 3.0101, Sequence: NP_001103782
Sequence identity: 89.08 (253/284)
Sequence 1 MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKI
           MDAIKKKMQAMKLEKDNA-DRA--CEQQA-DAN-RAEKAEEEAR-LQKKI
Sequence 2 MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKI

Sequence 1 QQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLE
           Q-IEN-LDQT-E-LMQVN-KL-EK-KALQNAESEVAALNRRIQLLEEDLE
Sequence 2 QTIENELDQTQESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLE

Sequence 1 RSEERLATATAKLAEASQAADESERARKILESKGLADEERMDALENQLKE
           RSEERLATATAKL-EASQAADESERARK-LE---LADEERMDALENQLKE
Sequence 2 RSEERLATATAKLSEASQAADESERARKVLENRSLADEERMDALENQLKE

Sequence 1 ARFMAEEADKKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
           ARF-AEEADKKYDEVARKLAMVEADLERAEERAE-GESKIVELEEELRVV
Sequence 2 ARFLAEEADKKYDEVARKLAMVEADLERAEERAESGESKIVELEEELRVV

Sequence 1 GNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAEFAERSVQKLQ
           GNNLKSLEVSEEKAN-REEEYK-QIKTL-TRLKEAEARAEFAERSVQKLQ
Sequence 2 GNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAEFAERSVQKLQ

Sequence 1 KEVDRLEDELVHEKEKYKYICDDLDMTFTELIGN-
           KEVDRLEDELV-EKEKYK-I-DDLD--F-ELI---
Sequence 2 KEVDRLEDELVAEKEKYKDIGDDLDTAFVELILKE



Alignment 6
Sequence 1:
Sequence 2: Allergen Copt f 7.0101, Sequence: AGM32377.1
Sequence identity: 86.97 (247/284)
Sequence 1 MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKI
           MDAIKKKMQAMKLEKDN-MDRALLCEQQARDAN-RAEKAEEEARSLQKKI
Sequence 2 MDAIKKKMQAMKLEKDNTMDRALLCEQQARDANLRAEKAEEEARSLQKKI

Sequence 1 QQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLE
           QQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLE
Sequence 2 QQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLE

Sequence 1 RSEERLATATAKLAEASQAADESERARKILESKGLADEERMDALENQLKE
           RSEERLATATAKLAEASQAADESERARKILESKGLADEERMDALENQLKE
Sequence 2 RSEERLATATAKLAEASQAADESERARKILESKGLADEERMDALENQLKE

Sequence 1 ARFMAEEADKKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
           ARFMAEEADKKYDEVARKLAMVEADLERAEERAE-GESKIVELEEELRVV
Sequence 2 ARFMAEEADKKYDEVARKLAMVEADLERAEERAESGESKIVELEEELRVV

Sequence 1 GNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAEFAERSVQKLQ
           GNNLKSLEVSEEKANLREEEYKQQIKTL-TRLKEAEARAEFAERSVQKLQ
Sequence 2 GNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAEARAEFAERSVQKLQ

Sequence 1 KEVDRLEDELVHEKEKYKYICDDLDMTFTELIGN
           K---------------------------------
Sequence 2 KGSRQA----------------------------



Alignment 7
Sequence 1:
Sequence 2: Allergen Chi k 10, Sequence: CAA09938
Sequence identity: 86.97 (247/284)
Sequence 1 MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKI
           MDAIKKKMQAMKLEKDNA-DRALLCE-QARDAN-RAEKAEEEAR-LQKKI
Sequence 2 MDAIKKKMQAMKLEKDNALDRALLCENQARDANLRAEKAEEEARTLQKKI

Sequence 1 QQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLE
           Q-IENDLDQT--Q---VN-KL--K-KALQNAESEVAALNRRIQLL-EDL-
Sequence 2 QTIENDLDQTQGQETLVNGKLEGKEKALQNAESEVAALNRRIQLLGEDLD

Sequence 1 RSEERLATATAKLAEASQAADESERARKILESKGLADEERMDALENQLKE
           RSEERLA-ATAKL-EAS-AADESERARKILE---LADEERMDALENQLKE
Sequence 2 RSEERLASATAKLSEASAAADESERARKILENRSLADEERMDALENQLKE

Sequence 1 ARFMAEEADKKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
           ARF-AEEADKKYDEVARKLAMVEADLERAEERAE-GE-KIVELEEELRVV
Sequence 2 ARFLAEEADKKYDEVARKLAMVEADLERAEERAEAGEAKIVELEEELRVV

Sequence 1 GNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAEFAERSVQKLQ
           GNNLKSLEVSEEKAN-REEEYK-QIKTL-TRLKEAEARAEFAERSVQKLQ
Sequence 2 GNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAEFAERSVQKLQ

Sequence 1 KEVDRLEDELVHEKEKYKYICDDLDMTFTELIGN-
           KEVDRLEDELV-EKEKY--I-DDLD--F-ELI---
Sequence 2 KEVDRLEDELVSEKEKYREIGDDLDTAFVELILKE



Alignment 8
Sequence 1:
Sequence 2: Allergen Scy p 1.0101, Sequence: A7L5V2
Sequence identity: 83.10 (236/284)
Sequence 1 MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKI
           MDAIKKKMQAMKLEKDNAMDRA---EQQ---AN-RAEK-EEE-R--QKK-
Sequence 2 MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKM

Sequence 1 QQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLE
           QQ-EN-LDQ--EQL---N-KLDEK-KALQNAE-EVAALNRRIQLLEEDLE
Sequence 2 QQVENELDQAQEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLE

Sequence 1 RSEERLATATAKLAEASQAADESERARKILESKGLADEERMDALENQLKE
           RSEERL-TAT-KLAEASQAADESER-RK-LE---L-DEERMDALENQLKE
Sequence 2 RSEERLNTATTKLAEASQAADESERMRKVLENRSLSDEERMDALENQLKE

Sequence 1 ARFMAEEADKKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
           ARF-AEEAD-KYDEVARKLAMVEADLERAEERAE-GESKIVELEEELRVV
Sequence 2 ARFLAEEADRKYDEVARKLAMVEADLERAEERAESGESKIVELEEELRVV

Sequence 1 GNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAEFAERSVQKLQ
           GNNLKSLEVSEEKAN-REE-YK-QIKTL---LK-AEARAEFAERSVQKLQ
Sequence 2 GNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAEFAERSVQKLQ

Sequence 1 KEVDRLEDELVHEKEKYKYICDDLDMTFTELIGN
           KEVDRLEDELV-EKEKYK-I-D-LD-TF-EL-G-
Sequence 2 KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY



Alignment 9
Sequence 1:
Sequence 2: Allergen Hom a 1.0102, Sequence: AAC48288
Sequence identity: 82.75 (235/284)
Sequence 1 MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKI
           MDAIKKKMQAMKLEKDNAMDRA---EQQ---ANIRAEK-EEE---LQK--
Sequence 2 MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRM

Sequence 1 QQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLE
           QQ-ENDLDQ--E-L---N--L-EKDKAL-NAE-EVAALNRRIQLLEEDLE
Sequence 2 QQLENDLDQVQESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLE

Sequence 1 RSEERLATATAKLAEASQAADESERARKILESKGLADEERMDALENQLKE
           RSEERL-TAT-KLAEASQAADESER-RK-LE---L-DEERMDALENQLKE
Sequence 2 RSEERLNTATTKLAEASQAADESERMRKVLENRSLSDEERMDALENQLKE

Sequence 1 ARFMAEEADKKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
           ARF-AEEAD-KYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
Sequence 2 ARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV

Sequence 1 GNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAEFAERSVQKLQ
           GNNLKSLEVSEEKAN-REE-YK-QIKTL---LK-AEARAEFAERSVQKLQ
Sequence 2 GNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAEFAERSVQKLQ

Sequence 1 KEVDRLEDELVHEKEKYKYICDDLDMTFTELIGN
           KEVDRLEDELV-EKEKYK-I-D-LD-TF-EL-G-
Sequence 2 KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY



Alignment 10
Sequence 1:
Sequence 2: Allergen Hom a 1.0101, Sequence: O44119
Sequence identity: 83.10 (236/284)
Sequence 1 MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKI
           MDAIKKKMQAMKLEKDNAMDRA---EQQ---ANIRAEK-EEE-R---KK-
Sequence 2 MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKTEEEIRITHKKM

Sequence 1 QQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLE
           QQ-EN-LDQ--EQL---N-KL-EK-KALQNAE-EVAALNRRIQLLEEDLE
Sequence 2 QQVENELDQVQEQLSLANTKLEEKEKALQNAEGEVAALNRRIQLLEEDLE

Sequence 1 RSEERLATATAKLAEASQAADESERARKILESKGLADEERMDALENQLKE
           RSEERL-TAT-KLAEASQAADESER-RK-LE---L-DEERMDALENQLKE
Sequence 2 RSEERLNTATTKLAEASQAADESERMRKVLENRSLSDEERMDALENQLKE

Sequence 1 ARFMAEEADKKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
           ARF-AEEAD-KYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
Sequence 2 ARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV

Sequence 1 GNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAEFAERSVQKLQ
           GNNLKSLEVSEEKAN-REE-YK-QIKTL---LK-AEARAEFAERSVQKLQ
Sequence 2 GNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAEFAERSVQKLQ

Sequence 1 KEVDRLEDELVHEKEKYKYICDDLDMTFTELIGN
           KEVDRLEDELV-EKEKYK-I-D-LD-TF-EL-G-
Sequence 2 KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY



Alignment 11
Sequence 1:
Sequence 2: Allergen Pro c 1.0101, Sequence: C0LU07
Sequence identity: 82.04 (233/284)
Sequence 1 MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKI
           MDAIKKKMQA-KLEKDNAMDRA---EQQ---ANIRAEKAEEE---LQK--
Sequence 2 MDAIKKKMQATKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRM

Sequence 1 QQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLE
           Q--ENDLDQ--E-L---N--L-EKDKA--NAE-EVAALNRRIQLLEEDLE
Sequence 2 QHLENDLDQVQESLLKANTQLEEKDKAISNAEGEVAALNRRIQLLEEDLE

Sequence 1 RSEERLATATAKLAEASQAADESERARKILESKGLADEERMDALENQLKE
           RSEERL-TAT-KLAEASQAADESER-RK-LE---L-DEERMDALENQLKE
Sequence 2 RSEERLNTATTKLAEASQAADESERMRKVLENRSLSDEERMDALENQLKE

Sequence 1 ARFMAEEADKKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
           ARF-AEEAD-KYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
Sequence 2 ARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV

Sequence 1 GNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAEFAERSVQKLQ
           GNNLKSLEVSEEKAN-REE-YK-QIKTL---LK-AEARAEFAERSVQKLQ
Sequence 2 GNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAEFAERSVQKLQ

Sequence 1 KEVDRLEDELVHEKEKYKYICDDLDMTFTELIGN
           KEVDRLEDELV-EKEKYK-I-D-LD-TF-EL-G-
Sequence 2 KEVDRLEDELVNEKEKYKSITDELDQTFSELTGY



Alignment 12
Sequence 1:
Sequence 2: Allergen Por p 1.0101, Sequence: M1H607
Sequence identity: 82.04 (233/284)
Sequence 1 MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKI
           MDAIKKKMQAMKLEKD-AMDRA---EQQ---ANIRAEKAEEE---LQK--
Sequence 2 MDAIKKKMQAMKLEKDDAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRM

Sequence 1 QQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLE
           QQ-ENDLDQ--E-L---N--L-EKDKAL-NAE-EVAALNRRIQLLEEDLE
Sequence 2 QQLENDLDQVQESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLE

Sequence 1 RSEERLATATAKLAEASQAADESERARKILESKGLADEERMDALENQLKE
           RSEERL-TAT-KLAEASQAADESER-RK-LE---L-DEERMDALENQLKE
Sequence 2 RSEERLNTATTKLAEASQAADESERMRKVLENRSLSDEERMDALENQLKE

Sequence 1 ARFMAEEADKKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
           ARF-AEEAD-KYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
Sequence 2 ARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV

Sequence 1 GNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAEFAERSVQKLQ
           GNNLKSLEVSEEKAN-REE-YK-QIKTL---LK-AEARAEFAERSVQKLQ
Sequence 2 GNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ

Sequence 1 KEVDRLEDELVHEKEKYKYICDDLDMTFTELIGN
           KEVDRLEDELV-EKEKYK---D-LD--F-EL-G-
Sequence 2 KEVDRLEDELVNEKEKYKSTTDELDQAFSELSGY



Alignment 13
Sequence 1:
Sequence 2: Allergen Pen m 1, Sequence: AAX37288
Sequence identity: 82.39 (234/284)
Sequence 1 MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKI
           MDAIKKKMQAMKLEKDNAMDRA---EQQ---AN-RAEK-EEE---LQK--
Sequence 2 MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRM

Sequence 1 QQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLE
           QQ-ENDLDQ--E-L---N--L-EKDKAL-NAE-EVAALNRRIQLLEEDLE
Sequence 2 QQLENDLDQVQESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLE

Sequence 1 RSEERLATATAKLAEASQAADESERARKILESKGLADEERMDALENQLKE
           RSEERL-TAT-KLAEASQAADESER-RK-LE---L-DEERMDALENQLKE
Sequence 2 RSEERLNTATTKLAEASQAADESERMRKVLENRSLSDEERMDALENQLKE

Sequence 1 ARFMAEEADKKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
           ARF-AEEAD-KYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
Sequence 2 ARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV

Sequence 1 GNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAEFAERSVQKLQ
           GNNLKSLEVSEEKAN-REE-YK-QIKTL---LK-AEARAEFAERSVQKLQ
Sequence 2 GNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ

Sequence 1 KEVDRLEDELVHEKEKYKYICDDLDMTFTELIGN
           KEVDRLEDELV-EKEKYK-I-D-LD-TF-EL-G-
Sequence 2 KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY



Alignment 14
Sequence 1:
Sequence 2: Allergen Lit v 1.0101, Sequence: EU410072
Sequence identity: 82.39 (234/284)
Sequence 1 MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKI
           MDAIKKKMQAMKLEKDNAMDRA---EQQ---AN-RAEK-EEE---LQK--
Sequence 2 MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRM

Sequence 1 QQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLE
           QQ-ENDLDQ--E-L---N--L-EKDKAL-NAE-EVAALNRRIQLLEEDLE
Sequence 2 QQLENDLDQVQESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLE

Sequence 1 RSEERLATATAKLAEASQAADESERARKILESKGLADEERMDALENQLKE
           RSEERL-TAT-KLAEASQAADESER-RK-LE---L-DEERMDALENQLKE
Sequence 2 RSEERLNTATTKLAEASQAADESERMRKVLENRSLSDEERMDALENQLKE

Sequence 1 ARFMAEEADKKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
           ARF-AEEAD-KYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
Sequence 2 ARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV

Sequence 1 GNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAEFAERSVQKLQ
           GNNLKSLEVSEEKAN-REE-YK-QIKTL---LK-AEARAEFAERSVQKLQ
Sequence 2 GNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ

Sequence 1 KEVDRLEDELVHEKEKYKYICDDLDMTFTELIGN
           KEVDRLEDELV-EKEKYK-I-D-LD-TF-EL-G-
Sequence 2 KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY



Alignment 15
Sequence 1:
Sequence 2: Allergen Pen a 1, Sequence: 11893851
Sequence identity: 82.39 (234/284)
Sequence 1 MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKI
           MDAIKKKMQAMKLEKDNAMDRA---EQQ---AN-RAEK-EEE---LQK--
Sequence 2 MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRM

Sequence 1 QQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLE
           QQ-ENDLDQ--E-L---N--L-EKDKAL-NAE-EVAALNRRIQLLEEDLE
Sequence 2 QQLENDLDQVQESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLE

Sequence 1 RSEERLATATAKLAEASQAADESERARKILESKGLADEERMDALENQLKE
           RSEERL-TAT-KLAEASQAADESER-RK-LE---L-DEERMDALENQLKE
Sequence 2 RSEERLNTATTKLAEASQAADESERMRKVLENRSLSDEERMDALENQLKE

Sequence 1 ARFMAEEADKKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
           ARF-AEEAD-KYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
Sequence 2 ARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV

Sequence 1 GNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAEFAERSVQKLQ
           GNNLKSLEVSEEKAN-REE-YK-QIKTL---LK-AEARAEFAERSVQKLQ
Sequence 2 GNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ

Sequence 1 KEVDRLEDELVHEKEKYKYICDDLDMTFTELIGN
           KEVDRLEDELV-EKEKYK-I-D-LD-TF-EL-G-
Sequence 2 KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY



Alignment 16
Sequence 1:
Sequence 2: Allergen Mac r 1.0101, Sequence: D3XNR9
Sequence identity: 82.04 (233/284)
Sequence 1 MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKI
           MDAIKKKMQAMKLEKDNAMDRA---EQQ---AN-RAEK-EEE---LQK--
Sequence 2 MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRM

Sequence 1 QQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLE
           QQ-ENDLD---E-L---N--L-EKDKAL-NAE-EVAALNRRIQLLEEDLE
Sequence 2 QQLENDLDSVQEALLKANQHLEEKDKALSNAEGEVAALNRRIQLLEEDLE

Sequence 1 RSEERLATATAKLAEASQAADESERARKILESKGLADEERMDALENQLKE
           RSEERL-TAT-KLAEASQAADESER-RK-LE---L-DEERMDALENQLKE
Sequence 2 RSEERLNTATTKLAEASQAADESERMRKVLENRSLSDEERMDALENQLKE

Sequence 1 ARFMAEEADKKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
           ARF-AEEAD-KYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
Sequence 2 ARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV

Sequence 1 GNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAEFAERSVQKLQ
           GNNLKSLEVSEEKAN-REE-YK-QIKTL---LK-AEARAEFAERSVQKLQ
Sequence 2 GNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ

Sequence 1 KEVDRLEDELVHEKEKYKYICDDLDMTFTELIGN
           KEVDRLEDELV-EKEKYK-I-D-LD-TF-EL-G-
Sequence 2 KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY



Alignment 17
Sequence 1:
Sequence 2: Allergen Pan b 1.0101, Sequence: CBY17558
Sequence identity: 82.39 (234/284)
Sequence 1 MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKI
           MDAIKKKMQAMKLEKDNAMDRA---EQQ---AN-RAEK-EEE---LQKK-
Sequence 2 MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVFGLQKKL

Sequence 1 QQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLE
           QQ-ENDLD---E-L---N--L-EKDKAL-NAE-EVAALNRRIQLLEEDLE
Sequence 2 QQLENDLDSVQEALLKANQHLEEKDKALSNAEGEVAALNRRIQLLEEDLE

Sequence 1 RSEERLATATAKLAEASQAADESERARKILESKGLADEERMDALENQLKE
           RSEERL-TAT-KLAEASQAADESER-RK-LE---L-DEERMDALENQLKE
Sequence 2 RSEERLNTATTKLAEASQAADESERMRKVLENRSLSDEERMDALENQLKE

Sequence 1 ARFMAEEADKKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
           ARF-AEEAD-KYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
Sequence 2 ARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV

Sequence 1 GNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAEFAERSVQKLQ
           GNNLKSLEVSEEKAN-REE-YK-QIKTL---LK-AEARAEFAERSVQKLQ
Sequence 2 GNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ

Sequence 1 KEVDRLEDELVHEKEKYKYICDDLDMTFTELIGN
           KEVDRLEDELV-EKEKYK-I-D-LD-TF-EL-G-
Sequence 2 KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY



Alignment 18
Sequence 1:
Sequence 2: Allergen Mel l 1.0101, Sequence: M4M2H6
Sequence identity: 82.04 (233/284)
Sequence 1 MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKI
           MDAIKKKMQAMKLEKDNAMDRA---EQQ---ANIRAEKAE-----LQKK-
Sequence 2 MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKL

Sequence 1 QQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLE
           QQ-END-DQ--E-L---N----EKDKAL-NAE-EVAALNRRIQLLEEDLE
Sequence 2 QQLENDFDQVQEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLE

Sequence 1 RSEERLATATAKLAEASQAADESERARKILESKGLADEERMDALENQLKE
           RSEERL-TAT-KLAEASQAADESER-RK-LE---L-DEERMDALENQLKE
Sequence 2 RSEERLNTATTKLAEASQAADESERMRKVLENRSLSDEERMDALENQLKE

Sequence 1 ARFMAEEADKKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
           ARF-AEEAD-KYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
Sequence 2 ARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV

Sequence 1 GNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAEFAERSVQKLQ
           GNNLKSLEVSEEKAN-REE-YK-QIKTL---LK-AEARAEFAERSVQKLQ
Sequence 2 GNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ

Sequence 1 KEVDRLEDELVHEKEKYKYICDDLDMTFTELIGN
           KEVDRLEDELV-EKEKYK-I-D-LD-TF-EL-G-
Sequence 2 KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY



Alignment 19
Sequence 1:
Sequence 2: Allergen Der f 10.0101, Sequence: BAA04557
Sequence identity: 80.63 (229/284)
Sequence 1 ---------------MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIR
           ---------------M-AIKKKMQAMKLEKDNA-DRA---EQ-ARDAN-R
Sequence 2 FFFVAAKQQQQPSTKMEAIKKKMQAMKLEKDNAIDRAEIAEQKARDANLR

Sequence 1 AEKAEEEARSLQKKIQQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEV
           AEK-EEE-R-LQKKIQQIEN-LDQ--EQL---N-KL-EK-KALQ-AE--V
Sequence 2 AEKSEEEVRALQKKIQQIENELDQVQEQLSAANTKLEEKEKALQTAEGDV

Sequence 1 AALNRRIQLLEEDLERSEERLATATAKLAEASQAADESERARKILESKGL
           AALNRRIQL-EEDLERSEERL--ATAKL-EASQ-ADESER-RK-LE----
Sequence 2 AALNRRIQLIEEDLERSEERLKIATAKLEEASQSADESERMRKMLEHRSI

Sequence 1 ADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAEERAET
           -DEERMD-LENQLKEAR-MAE-AD-KYDEVARKLAMVEADLERAEERAET
Sequence 2 TDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAEERAET

Sequence 1 GESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEA
           GESKIVELEEELRVVGNNLKSLEVSEEKA--REE-Y-QQI------LKEA
Sequence 2 GESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEA

Sequence 1 EARAEFAERSVQKLQKEVDRLEDELVHEKEKYKYICDDLDMTFTELIGN
           EARAEFAERSVQKLQKEVDRLEDELVHEKEKYK-I-D-LD-TF-EL-G-
Sequence 2 EARAEFAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY



Alignment 20
Sequence 1:
Sequence 2: Allergen Cho a 10.0101, Sequence: AEX31649
Sequence identity: 79.58 (226/284)
Sequence 1 MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKI
           M-AIKKKMQAMKLEKDNA-DRA---EQ--RDAN--AEK-EEE-R-LQKKI
Sequence 2 MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKI

Sequence 1 QQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLE
           QQIEN-LDQ--E---Q-N-KL-EK-KALQ-AE--VAALNRRIQL-EEDLE
Sequence 2 QQIENELDQVQESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLE

Sequence 1 RSEERLATATAKLAEASQAADESERARKILESKGLADEERMDALENQLKE
           RSEERL--ATAKL-EAS-AADESER-RK-LE-----DEERMD-LENQLKE
Sequence 2 RSEERLKVATAKLEEASHAADESERMRKMLEHRSITDEERMDGLENQLKE

Sequence 1 ARFMAEEADKKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
           AR-MAE-AD-KYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
Sequence 2 ARMMAEDADRKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV

Sequence 1 GNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAEFAERSVQKLQ
           GNNLKSLEVSEEKA--REE-Y-QQI------LKEAEARAEFAERSVQKLQ
Sequence 2 GNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAEFAERSVQKLQ

Sequence 1 KEVDRLEDELVHEKEKYKYICDDLDMTFTELIGN
           KEVDRLEDELVHEKEKYK-I-D-LD-TF-EL-G-
Sequence 2 KEVDRLEDELVHEKEKYKSISDELDQTFAELTGY



Alignment 21
Sequence 1:
Sequence 2: Allergen Der p 10, Sequence: O18416
Sequence identity: 79.58 (226/284)
Sequence 1 MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKI
           M-AIK-KMQAMKLEKDNA-DRA---EQ-ARDAN-RAEK-EEE-R-LQKKI
Sequence 2 MEAIKNKMQAMKLEKDNAIDRAEIAEQKARDANLRAEKSEEEVRALQKKI

Sequence 1 QQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLE
           QQIEN-LDQ--EQL---N-KL-EK-KALQ-AE--VAALNRRIQL-EEDLE
Sequence 2 QQIENELDQVQEQLSAANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLE

Sequence 1 RSEERLATATAKLAEASQAADESERARKILESKGLADEERMDALENQLKE
           RSEERL--ATAKL-EASQ-ADESER-RK-LE-----DEERM--LENQLKE
Sequence 2 RSEERLKIATAKLEEASQSADESERMRKMLEHRSITDEERMEGLENQLKE

Sequence 1 ARFMAEEADKKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
           AR-MAE-AD-KYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
Sequence 2 ARMMAEDADRKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV

Sequence 1 GNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAEFAERSVQKLQ
           GNNLKSLEVSEEKA--REE---QQI----T-LKEAEARAEFAERSVQKLQ
Sequence 2 GNNLKSLEVSEEKAQQREEAHEQQIRIMTTKLKEAEARAEFAERSVQKLQ

Sequence 1 KEVDRLEDELVHEKEKYKYICDDLDMTFTELIGN
           KEV-RLEDELVHEKEKYK-I-D-LD-TF-EL-G-
Sequence 2 KEVGRLEDELVHEKEKYKSISDELDQTFAELTGY



Alignment 22
Sequence 1:
Sequence 2: Allergen Blo t 10.0101, Sequence: ABU97466
Sequence identity: 78.52 (223/284)
Sequence 1 MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKI
           M-AIKKKMQAMKLEKDNA-DRA---EQ--RDAN-RAEK-EEE-R-LQKKI
Sequence 2 MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRALQKKI

Sequence 1 QQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLE
           QQIEN-LDQ--E-L-Q-N-KL-EK-K-LQ-AE--VAALNRRIQL-EEDLE
Sequence 2 QQIENELDQVQESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLE

Sequence 1 RSEERLATATAKLAEASQAADESERARKILESKGLADEERMDALENQLKE
           RSEERL--ATAKL-EAS--ADESER-RK-LE-----DEERMD-LE-QLKE
Sequence 2 RSEERLKVATAKLEEASHSADESERMRKMLEHRSITDEERMDGLESQLKE

Sequence 1 ARFMAEEADKKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
           AR-MAE-AD-KYDEVARKLAMVEADLERAEERAETGE-KIVELEEELRVV
Sequence 2 ARMMAEDADRKYDEVARKLAMVEADLERAEERAETGETKIVELEEELRVV

Sequence 1 GNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAEFAERSVQKLQ
           GNNLKSLEVSEEKA--REE-Y-QQI------LKEAEARAEFAERSV-KLQ
Sequence 2 GNNLKSLEVSEEKAQQREEAYEQQIRMMTGKLKEAEARAEFAERSVRKLQ

Sequence 1 KEVDRLEDELVHEKEKYKYICDDLDMTFTELIGN
           KEVDRLEDELVHEKEKYK-I-D-LD-TF-EL-G-
Sequence 2 KEVDRLEDELVHEKEKYKSISDELDQTFAELTGY



Alignment 23
Sequence 1:
Sequence 2: Allergen Pan s 1, Sequence: O61379
Sequence identity: 79.23 (225/284)
Sequence 1 MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKI
           ----------MKLEKDNAMDRA---EQQ---ANIRAEKAEEE---LQK--
Sequence 2 ----------MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRM

Sequence 1 QQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLE
           QQ-ENDLDQ--E-L---N--L-EKDKAL-NAE-EVAALNRRIQLLEEDLE
Sequence 2 QQLENDLDQVQESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLE

Sequence 1 RSEERLATATAKLAEASQAADESERARKILESKGLADEERMDALENQLKE
           RSEERL-TAT-KLAEASQAADESER-RK-LE---L-DEERMDALENQLKE
Sequence 2 RSEERLNTATTKLAEASQAADESERMRKVLENRSLSDEERMDALENQLKE

Sequence 1 ARFMAEEADKKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
           ARF-AEEAD-KYDEVARKLAMVEADLERAEERAETGESK-VELEEELRVV
Sequence 2 ARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKFVELEEELRVV

Sequence 1 GNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAEFAERSVQKLQ
           GNNLKSLEVSEEKAN-REE-YK-QIKTL---LK-AEARAEFAERSVQKLQ
Sequence 2 GNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ

Sequence 1 KEVDRLEDELVHEKEKYKYICDDLDMTFTELIGN
           KEVDRLEDELV-EKEKYK-I-D-LD-TF-EL-G-
Sequence 2 KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY



Alignment 24
Sequence 1:
Sequence 2: Allergen Tyr p 10.0101, Sequence: AAT40866
Sequence identity: 78.17 (222/284)
Sequence 1 MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKI
           MDAIK-KMQAMKLE-DNA-DRA---EQ-ARDAN---EK-EEE-R-LQKKI
Sequence 2 MDAIKNKMQAMKLEEDNAIDRAEIAEQKARDANLKSEKTEEEVRALQKKI

Sequence 1 QQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLE
           QQIEN-LDQ--E-L-Q---KL-EK-KALQ-AE--VAALNRRIQL-EEDLE
Sequence 2 QQIENELDQVQENLTQATTKLEEKEKALQTAEADVAALNRRIQLIEEDLE

Sequence 1 RSEERLATATAKLAEASQAADESERARKILESKGLADEERMDALENQLKE
           RSEERL--ATAKL-EAS--ADESER-RK-LE-----DEERMD-LE-QLKE
Sequence 2 RSEERLKVATAKLEEASHSADESERMRKMLEHRSITDEERMDGLESQLKE

Sequence 1 ARFMAEEADKKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
           AR-MAE-AD-KYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
Sequence 2 ARLMAEDADRKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV

Sequence 1 GNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAEFAERSVQKLQ
           GNNLKSLEVSEEKA--REE-Y-QQI------LKEAEARAEFAERSVQKLQ
Sequence 2 GNNLKSLEVSEEKAQQREEAYEQQIRIMTSKLKEAEARAEFAERSVQKLQ

Sequence 1 KEVDRLEDELVHEKEKYKYICDDLDMTFTELIGN
           KEVDRLEDELVHEKEKY--I-D-LD-TF-EL-G-
Sequence 2 KEVDRLEDELVHEKEKYESISDELDQTFAELTGY



Alignment 25
Sequence 1:
Sequence 2: Allergen Lep d 10, Sequence: Q9NFZ4
Sequence identity: 78.52 (223/284)
Sequence 1 MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKI
           M-AIK-KMQAMKLEKDNA-DRA---EQ--RDAN-RAEK-EEE-R-LQKKI
Sequence 2 MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKI

Sequence 1 QQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLE
           QQIEN-LDQ--E-L-Q-N-KL-EK-K-LQ-AE--VAALNRRIQL-EEDLE
Sequence 2 QQIENELDQVQESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLE

Sequence 1 RSEERLATATAKLAEASQAADESERARKILESKGLADEERMDALENQLKE
           RSE-RL--AT-KL-EASQ-ADESER-RK-LE-----DEERM--LE-QLKE
Sequence 2 RSEGRLKIATSKLEEASQSADESERMRKMLEHRSITDEERMEGLESQLKE

Sequence 1 ARFMAEEADKKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
           AR-MAE-AD-KYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
Sequence 2 ARMMAEDADRKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV

Sequence 1 GNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAEFAERSVQKLQ
           GNNLKSLEVSEEKA--REE-Y-QQI----T-LKEAEARAEFAERSVQKLQ
Sequence 2 GNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAEFAERSVQKLQ

Sequence 1 KEVDRLEDELVHEKEKYKYICDDLDMTFTELIGN
           KEVDRLEDELVHEKEKYK-I-D-LD-TF-EL-G-
Sequence 2 KEVDRLEDELVHEKEKYKSISDELDQTFAELTGY



Alignment 26
Sequence 1:
Sequence 2: Allergen Met e 1, Sequence: Q25456
Sequence identity: 78.87 (224/284)
Sequence 1 MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKI
           ----------MKLEKDNAMDRA---EQQ---AN-RAEK-EEE---LQK--
Sequence 2 ----------MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRM

Sequence 1 QQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLE
           QQ-ENDLDQ--E-L---N--L-EKDKAL-NAE-EVAALNRRIQLLEEDLE
Sequence 2 QQLENDLDQVQESLLKANNQLVEKDKALSNAEGEVAALNRRIQLLEEDLE

Sequence 1 RSEERLATATAKLAEASQAADESERARKILESKGLADEERMDALENQLKE
           RSEERL-TAT-KLAEASQAADESER-RK-LE---L-DEERMDALENQLKE
Sequence 2 RSEERLNTATTKLAEASQAADESERMRKVLENRSLSDEERMDALENQLKE

Sequence 1 ARFMAEEADKKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
           ARF-AEEAD-KYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
Sequence 2 ARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV

Sequence 1 GNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAEFAERSVQKLQ
           GNNLKSLEVSEEKAN-REE-YK-QIKTL---LK-AEARAEFAERSVQKLQ
Sequence 2 GNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ

Sequence 1 KEVDRLEDELVHEKEKYKYICDDLDMTFTELIGN
           KEVDRLEDELV-EKEKYK-I-D-LD-TF-EL-G-
Sequence 2 KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY



Alignment 27
Sequence 1:
Sequence 2: Allergen Cha f 1, Sequence: Q9N2R3
Sequence identity: 78.17 (222/284)
Sequence 1 MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKI
           MDAIKKKMQAMKLEKDNAMDRA---EQQ---AN-RAEK-EEE-R--QKK-
Sequence 2 MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKM

Sequence 1 QQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLE
           QQ-EN-LDQ--EQL---N-KLDEK-KALQNAE-EVAALNRRIQL-EEDLE
Sequence 2 QQVENELDQAQEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLPEEDLE

Sequence 1 RSEERLATATAKLAEASQAADESERARKILESKGLADEERMDALENQLKE
           RSEERL-TAT-KLAEASQAADESER-RK-LE---L-DEERMDALENQLKE
Sequence 2 RSEERLNTATTKLAEASQAADESERMRKVLENRSLSDEERMDALENQLKE

Sequence 1 ARFMAEEADKKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
           ARF-AEEAD-KYDEVARKLAMVEADLERAEERAE-GESKIVELEEELRVV
Sequence 2 ARFLAEEADRKYDEVARKLAMVEADLERAEERAESGESKIVELEEELRVV

Sequence 1 GNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAEFAERSVQKLQ
           GNNLKSLEVSEEKAN-REE-YK-QIKTL---LK-AEARAEFAERSVQKLQ
Sequence 2 GNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAEFAERSVQKLQ

Sequence 1 KEVDRLEDELVHEKEKYKYICDDLDMTFTELIGN
           KEVDRLEDELV-EK--------------------
Sequence 2 KEVDRLEDELVNEK--------------------



Alignment 28
Sequence 1:
Sequence 2: Allergen Ani s 3, Sequence: Q9NAS5
Sequence identity: 69.72 (198/284)
Sequence 1 MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKI
           MDAIKKKMQAMK-EKDNA-DRA---E---R------E--EEE-R--QKK-
Sequence 2 MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKM

Sequence 1 QQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLE
           -Q-ENDLD---E-L---N--L-EK-K--Q-AE-EVAALNRR--LLEE-LE
Sequence 2 MQTENDLDKAQEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELE

Sequence 1 RSEERLATATAKLAEASQAADESERARKILESKGLADEERMDALENQLKE
           R-EERL--ATAKL-EA---ADESER-RK--E-----DEER----E-QLKE
Sequence 2 RAEERLKLATAKLEEATHTADESERVRKVMENRSFQDEERANTVESQLKE

Sequence 1 ARFMAEEADKKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
           A---AEEAD-KYDEVARKL-MVEADLERAEERAETGE-KIVELEEELRVV
Sequence 2 AQMLAEEADRKYDEVARKLTMVEADLERAEERAETGENKIVELEEELRVV

Sequence 1 GNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAEFAERSVQKLQ
           GNNLKSLEVSEEKA--RE--Y--QI-T---RLKEAE-RAEFAERSVQKLQ
Sequence 2 GNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAEFAERSVQKLQ

Sequence 1 KEVDRLEDELVHEKEKYKYICDDLDMTFTELIGN
           KEVDRLEDELVHEKE-YK-I---LD-TF-EL-G-
Sequence 2 KEVDRLEDELVHEKERYKSISEELDQTFQELSGY



Alignment 29
Sequence 1:
Sequence 2: Allergen Asc l 3.0101, Sequence: ACN32322
Sequence identity: 69.37 (197/284)
Sequence 1 MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKI
           MDAIKKKMQAMK-EKDNA-DRA---E---R------E--EEE-R--QKK-
Sequence 2 MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKM

Sequence 1 QQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLE
           -Q-ENDLD---E-L---N--L-EK-K--Q-AE-EVAALNRR--LLEE-LE
Sequence 2 MQTENDLDKAQEDLSVANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELE

Sequence 1 RSEERLATATAKLAEASQAADESERARKILESKGLADEERMDALENQLKE
           R-EERL--AT-KL-EA---ADESER-RK--E-----DEER----E-QLKE
Sequence 2 RAEERLKLATEKLEEATHTADESERVRKVMENRSFQDEERANTVESQLKE

Sequence 1 ARFMAEEADKKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
           A---AEEAD-KYDEVARKLAMVEADLERAEERAE-GE-KIVELEEELRVV
Sequence 2 AQMLAEEADRKYDEVARKLAMVEADLERAEERAEAGENKIVELEEELRVV

Sequence 1 GNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAEFAERSVQKLQ
           GNNLKSLEVSEEKA--RE--Y--QI-T---RLKEAE-RAEFAERSVQKLQ
Sequence 2 GNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAEFAERSVQKLQ

Sequence 1 KEVDRLEDELVHEKEKYKYICDDLDMTFTELIGN---
           KEVDRLEDELVHEKE-YK-I---LD-TF-EL-G----
Sequence 2 KEVDRLEDELVHEKERYKSISEELDQTFQELSGYRSD



Alignment 30
Sequence 1:
Sequence 2: Allergen Lep s 1, Sequence: CAC84590
Sequence identity: 64.44 (183/284)
Sequence 1 MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKI
           M-AIKKKMQAMKLEKDNAMD-A---E-QARDAN--A-K--EE---L-KK-
Sequence 2 MEAIKKKMQAMKLEKDNAMDKADALEAQARDANRKADKILEEVQDLKKKP

Sequence 1 QQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLE
           -Q-E-D---T-E-L---N--L--K-K-L-N-ESEVA-LNR--Q--EE-LE
Sequence 2 SQVETDFTTTKENLATANKNLEDKEKTLTNTESEVASLNRKVQMIEENLE

Sequence 1 RSEERLATATAKLAEASQAADESERARKILESKGLADEERMDALENQLKE
           RSEERL-TA--KL-EAS-AADE--R--K-LE-----DEERMD-L-NQLKE
Sequence 2 RSEERLGTALTKLGEASHAADEASRMCKVLENRSQQDEERMDQLTNQLKE

Sequence 1 ARFMAEEADKKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
           AR--AE-AD-K-DEV-RK-A-VE-DLE-AE-R---G-SKI-ELEEEL-VV
Sequence 2 ARMLAEDADGKSDEVSRKMAQVEDDLEVAEDRVKSGDSKIMELEEELKVV

Sequence 1 GNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAEFAERSVQKLQ
           GN-LKSLEVSEEKAN-R-EEYK-QIKTL---LKEAEARAE-AE--V-KLQ
Sequence 2 GNSLKSLEVSEEKANQRVEEYKRQIKTLTVKLKEAEARAEYAEKYVKKLQ

Sequence 1 KEVDRLEDELVHEKEKYKYICDDLDMTFTELIGN
           KEVDRLEDEL---K--Y----D--D-TF-EL-G-
Sequence 2 KEVDRLEDELGINKDRYRALADEMDQTFAELSGY



Alignment 31
Sequence 1:
Sequence 2: Allergen Aed a 10.0201, Sequence: Q17H80
Sequence identity: 61.97 (176/284)
Sequence 1 MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKI
           MDAIKKKMQAMKLEKDNA-D-A--CE-QA--AN-RA-K--EE---L-K--
Sequence 2 MDAIKKKMQAMKLEKDNAADKADTCENQAKEANLRADKIMEEVAELTKRL

Sequence 1 QQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLE
           -Q---D-------L-Q-N--L-EK-K-L---E--VAAL-R--Q--EEDLE
Sequence 2 TQVTEDHEKFKNTLEQANKDLEEKEKLLTSTEANVAALTRKVQQVEEDLE

Sequence 1 RSEERLATATAKLAEASQAADESERARKILESKGLADEERMDALENQLKE
           -SEER---A--KL-EA-Q-ADE--R--K-LE-----DEERMD-L-NQLKE
Sequence 2 KSEERSGAALSKLLEATQSADENNRMCKVLENRSQQDEERMDQLSNQLKE

Sequence 1 ARFMAEEADKKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
           AR--AE-AD-K-DEV-RKLA-VE--LE-AE-R---GE-KI-ELEEEL-VV
Sequence 2 ARMLAEDADGKSDEVSRKLAFVEDELEVAEDRVKSGEAKIMELEEELKVV

Sequence 1 GNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAEFAERSVQKLQ
           GN-LKSLEVSE-KAN-R-EE-K-Q-K-L---LKEAE-RAE-AE--V-KLQ
Sequence 2 GNSLKSLEVSEDKANQRVEEFKRQLKSLTIKLKEAETRAENAEKNVKKLQ

Sequence 1 KEVDRLEDELVHEKEKYKYICDDLDMTFTELIGN
           KEVDRLED-L--EK-KYK-ICDDLD-TF-EL-G-
Sequence 2 KEVDRLEDKLMNEKDKYKAICDDLDSTFAELTGY



Alignment 32
Sequence 1:
Sequence 2: Allergen Hel as 1, Sequence: CAB38044
Sequence identity: 62.32 (177/284)
Sequence 1 MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKI
           MDAIKKKM-AMK-EK-NA-DRA---EQ--RD------K-EE----LQKK-
Sequence 2 MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKF

Sequence 1 QQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLE
           ---END-D---EQL---N-KL----K-----ESE-A-L-RRIQLLEEDLE
Sequence 2 AILENDFDSINEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLE

Sequence 1 RSEERLATATAKLAEASQAADESERARKILESKGLADEERMDALENQLKE
           RSEERL--AT-KL-EAS-AADESER-RK-LES--LAD-ER-D-LE-QLKE
Sequence 2 RSEERLQSATEKLEEASKAADESERGRKVLESRSLADDERLDGLEAQLKE

Sequence 1 ARFMAEEADKKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
           A---AE-A--K-DE-ARKLA--E-DLERAE-R-E--E-KI-ELEEEL-VV
Sequence 2 AKYIAEDAERKFDEAARKLAITEVDLERAEARLEAAEAKILELEEELKVV

Sequence 1 GNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAEFAERSVQKLQ
           GNN-KSLE-SE--A--RE--Y---I--L--RLK-AE-RA--AER-V-KLQ
Sequence 2 GNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRASEAERTVSKLQ

Sequence 1 KEVDRLEDELVHEKEKYKYICDDLDMTFTELIGN
           KEVDRLEDEL--EKE-YK---D-LD-TF-EL-G-
Sequence 2 KEVDRLEDELLAEKERYKATSDELDSTFAELAGY



Alignment 33
Sequence 1:
Sequence 2: Allergen Hal l 1.0101, Sequence: APG42675
Sequence identity: 61.27 (174/284)
Sequence 1 MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKI
           MDAIKKKM-AMK-EK-NA-DRA---EQ--RD------K-EE----LQKK-
Sequence 2 MDAIKKKMLAMKMEKENAVDRAEQNEQKLRDTEEQKAKIEEDLNNLQKKC

Sequence 1 QQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLE
           ---END-D---EQL-----KL----K-----E-EV----R-I-LLEEDLE
Sequence 2 ANLENDFDNVNEQLQEAMTKLETSEKRVTEMEQEVSGTTRKITLLEEDLE

Sequence 1 RSEERLATATAKLAEASQAADESERARKILESKGLADEERMDALENQLKE
           R-EERL-TAT--L-EAS-AADESER-RK-LES--LAD-ER-D-LE-QLKE
Sequence 2 RNEERLQTATERLEEASKAADESERGRKVLESRSLADDERIDQLEAQLKE

Sequence 1 ARFMAEEADKKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
           A---AE-A--KYDE-ARKLA--E-DLERAE-R-E--E-KI-ELEEEL-VV
Sequence 2 AKYIAEDAERKYDEAARKLAITEVDLERAEARLEAAEAKILELEEELKVV

Sequence 1 GNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAEFAERSVQKLQ
           GNN-KSLE-SE--A--RE--Y---I--L--RLK-AE-RA--AER-V-KLQ
Sequence 2 GNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRATEAERTVSKLQ

Sequence 1 KEVDRLEDELVHEKEKYKYICDDLDMTFTELIGN
           KEVDRLEDEL--EKEKYK-I-D-LD-TF-EL-G-
Sequence 2 KEVDRLEDELLAEKEKYKAISDELDQTFAELAGY



Alignment 34
Sequence 1:
Sequence 2: Allergen Hal d 1, Sequence: AAG08987
Sequence identity: 60.92 (173/284)
Sequence 1 MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKI
           MDAIKKKM-AMK-EK-NA-DRA---EQ--RD------K-EE----LQKK-
Sequence 2 MDAIKKKMLAMKMEKENAVDRAEQNEQKLRDTEEQKAKIEEDLNNLQKKC

Sequence 1 QQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLE
           ---END-D---EQL----AKL----K-----E-EV----R-I-LLEEDLE
Sequence 2 ANLENDFDNVNEQLQEAMAKLETSEKRVTEMEQEVSGTTRKITLLEEDLE

Sequence 1 RSEERLATATAKLAEASQAADESERARKILESKGLADEERMDALENQLKE
           R-EERL-TAT--L-EAS-AADESER----LES--LAD-ER-D-LE-QLKE
Sequence 2 RNEERLQTATERLEEASKAADESERGARVLESRSLADDERIDQLEAQLKE

Sequence 1 ARFMAEEADKKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
           A---AE-A--KYDE-ARKLA--E-DLERAE-R-E--E-KI-ELEEEL-VV
Sequence 2 AKYIAEDAERKYDEAARKLAITEVDLERAEARLEAAEAKILELEEELKVV

Sequence 1 GNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAEFAERSVQKLQ
           GNN-KSLE-SE--A--RE--Y---I--L--RLK-AE-RA--AER-V-KLQ
Sequence 2 GNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRATEAERTVSKLQ

Sequence 1 KEVDRLEDELVHEKEKYKYICDDLDMTFTELIGN
           KEVDRLEDEL--EKEKYK-I-D-LD-TF-EL-G-
Sequence 2 KEVDRLEDELLAEKEKYKAISDELDQTFAELAGY



Alignment 35
Sequence 1:
Sequence 2: Allergen Sac g 1.0101, Sequence: AVD53650
Sequence identity: 59.51 (169/284)
Sequence 1 MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKI
           MD-IKKKM-AMK-EK-NA-DRA---EQQ-RD------K-EE----LQKK-
Sequence 2 MDSIKKKMIAMKMEKENAQDRAEQLEQQLRDTEEQKAKIEEDLTTLQKKH

Sequence 1 QQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLE
           ---EN--D---E------AK--E--K-----E-E---LNRRIQLLEED-E
Sequence 2 SNLENEFDIVNEKYQDCQAKYEEAEKKASESEQEIQSLNRRIQLLEEDME

Sequence 1 RSEERLATATAKLAEASQAADESERARKILESKGLADEERMDALENQLKE
           RSEERL-TAT-KL-EAS-AADESER-RK-LE----A-EER-D-LE-QL-E
Sequence 2 RSEERLQTATEKLEEASKAADESERNRKVLENLNNASEERTDVLEKQLTE

Sequence 1 ARFMAEEADKKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
           A---AEEADKKYDE-ARKLA--E-DLERAE-R-E--E-K---LEE-L-VV
Sequence 2 AKLIAEEADKKYDEAARKLAITEVDLERAEARLEAAEAKVIDLEEQLSVV

Sequence 1 GNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAEFAERSVQKLQ
           GNN-K-L-V----A--RE--Y---I--L--RLK-AE-RA--AER-V-KLQ
Sequence 2 GNNIKTLQVQNDQASQREDSYEETIRDLTQRLKDAENRATEAERTVSKLQ

Sequence 1 KEVDRLEDELVHEKEKYKYICDDLDMTFTELIGN
           KEVDRLEDEL--EKE-YK-I-D-LD-TF-EL-G-
Sequence 2 KEVDRLEDELLAEKERYKAISDELDQTFAELAGY



Alignment 36
Sequence 1:
Sequence 2: Allergen Per v 1, Sequence: AAG08988
Sequence identity: 55.99 (159/284)
Sequence 1 MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKI
           MDAIKKKM-AMK-EK-NA-DRA---EQ--R-------K-E----SL-KK-
Sequence 2 MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKN

Sequence 1 QQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLE
           -Q-END-D----QL--V-AK-----K--Q--E-E---L-R-I-LLEE---
Sequence 2 IQTENDYDNCNTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIM

Sequence 1 RSEERLATATAKLAEASQAADESERARKILESKGLADEERMDALENQLKE
           --EER--TA--KL-EAS-AADESER-RK-LE-------ER-D-LE-QL-E
Sequence 2 KAEERFTTASGKLEEASKAADESERNRKVLENLNSGNDERIDQLEKQLTE

Sequence 1 ARFMAEEADKKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
           A---AEEADKKY-E-ARKLA--E-DLERAE-R-E--E-K---LEE-L-VV
Sequence 2 AKWIAEEADKKYEEAARKLAITEVDLERAEARLEAAEAKVIDLEEQLTVV

Sequence 1 GNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAEFAERSVQKLQ
           G-N-K-L-V----A--RE--Y---I--L--RLK-AE-RA--AER-V-KLQ
Sequence 2 GANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRATEAERTVSKLQ

Sequence 1 KEVDRLEDELVHEKEKYKYICDDLDMTFTELIGN
           KEVDRLEDEL--EKEKYK-I-D-LD-TF-EL-G-
Sequence 2 KEVDRLEDELLTEKEKYKAISDELDATFAELAGY



Alignment 37
Sequence 1:
Sequence 2: Allergen Mim n 1, Sequence: AAG08989
Sequence identity: 55.28 (157/284)
Sequence 1 MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKI
           MDAIKKKMQAMK----NA-D-A---EQ---D------K-EEE---LQKK-
Sequence 2 MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKL

Sequence 1 QQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLE
           ---EN--D---EQL---N-KL----K-----ES-V--L-RR--LLEED-E
Sequence 2 TATENNYDTVNEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYE

Sequence 1 RSEERLATATAKLAEASQAADESERARKILESKGLADEERMDALENQLKE
           RSEE-L---T-KL-EAS-AADESER-RK-LE------EER-D-LE-QL--
Sequence 2 RSEEKLNSTTEKLEEASKAADESERNRKVLEGRSNSYEERIDELEKQLET

Sequence 1 ARFMAEEADKKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
           A---A--AD-K-DE-ARKLA--E-DLERAE-R-E----K--ELEEEL-VV
Sequence 2 AKNVATDADHKFDEAARKLAITEVDLERAETRLEAADAKVLELEEELTVV

Sequence 1 GNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAEFAERSVQKLQ
           G-N-K-L-V----A--RE--Y---I--L---LK-AE-RA--AER-V-KLQ
Sequence 2 GANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRATEAERQVVKLQ

Sequence 1 KEVDRLEDELVHEKEKYKYICDDLDMTFTELIGN
           KEVDRLEDEL--EKE-YK-I-DDLD-TF-E--G-
Sequence 2 KEVDRLEDELLAEKERYKAISDDLDQTFAEIAGY



Alignment 38
Sequence 1:
Sequence 2: Allergen Pan h 4.0201, Sequence: XP_026775428
Sequence identity: 53.52 (152/284)
Sequence 1 MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKI
           MDAIKKKMQ--KL-K-NA-DRA---E-----A--R----E-----LQKK-
Sequence 2 MDAIKKKMQMLKLDKENALDRAEQAESDKKAAEDRSKQLEDDLVALQKKL

Sequence 1 QQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLE
           ---E--LD---E-L-----KL----K----AE--VA-LNRRIQL-EE-L-
Sequence 2 KGTEDELDKYSEALKDAQEKLELSEKKAADAEADVASLNRRIQLVEEELD

Sequence 1 RSEERLATATAKLAEASQAADESERARKILESKGLADEERMDALENQLKE
           R--ERLATA--KL-EA--AADESER--K--E---L-DEE-M---E-QLKE
Sequence 2 RAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMEIQEIQLKE

Sequence 1 ARFMAEEADKKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
           A---AEEAD-KY-EVARKL--VE--LER-EERAE--E-K--ELEEEL--V
Sequence 2 AKHIAEEADRKYEEVARKLVIVEGELERTEERAELSEGKCAELEEELKTV

Sequence 1 GNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAEFAERSVQKLQ
           -N-LKSLE---EK----E--Y---IK-L---LKEAE-RAEFAER-V-KL-
Sequence 2 TNTLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAEFAERTVAKLE

Sequence 1 KEVDRLEDELVHEKEKYKYICDDLDMTFTELIGN
           K--D-LEDEL---K-KYK-I---LD---------
Sequence 2 KTIDDLEDELYSQKLKYKAISEELDHALNDMTSI



Alignment 39
Sequence 1:
Sequence 2: Allergen Sal s 4.0101, Sequence: NP_001117128
Sequence identity: 53.17 (151/284)
Sequence 1 MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKI
           MDAIKKKMQ--KL-K-NA-DRA---E-----A-------E-----LQKK-
Sequence 2 MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKL

Sequence 1 QQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLE
           ---E--LD---E-L-----KL----K----AE--VA-LNRRIQL-EE-L-
Sequence 2 KGTEDELDKYSESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELD

Sequence 1 RSEERLATATAKLAEASQAADESERARKILESKGLADEERMDALENQLKE
           R--ERLATA--KL-EA--AADESER--K--E-----DEE-M-----QLKE
Sequence 2 RAQERLATALTKLEEAEKAADESERGMKVIENRASKDEEKMELQDIQLKE

Sequence 1 ARFMAEEADKKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
           A---AEEAD-KY-EVARKL---E-DLER-EERAE--E-K--ELEEEL--V
Sequence 2 AKHIAEEADRKYEEVARKLVIIESDLERTEERAELSEGKCSELEEELKTV

Sequence 1 GNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAEFAERSVQKLQ
           -NNLKSLE---EK----E--Y---IK-L---LKEAE-RAEFAERSV-KL-
Sequence 2 TNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAEFAERSVAKLE

Sequence 1 KEVDRLEDELVHEKEKYKYICDDLDMTFTELIGN
           K--D-LEDEL---K-KYK-I---LD---------
Sequence 2 KTIDDLEDELYAQKLKYKAISEELDNALNDMTSI



Alignment 40
Sequence 1:
Sequence 2: Allergen Cra g 1, Sequence: AAK96889
Sequence identity: 50.35 (143/284)
Sequence 1 MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKI
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLE
           -------D---E-------K--E--K----AE-E---LNRRIQLLEED-E
Sequence 2 -NSARGFDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDME

Sequence 1 RSEERLATATAKLAEASQAADESERARKILESKGLADEERMDALENQLKE
           RSEERL-TAT-KL-EAS-AADESER-RK-LE----A-EER-D-LE-QL-E
Sequence 2 RSEERLQTATEKLEEASKAADESERNRKVLENLNNASEERTDVLEKQLTE

Sequence 1 ARFMAEEADKKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
           A---AEEADKKYDE-ARKLA--E-DLERAE-R-E--E-K--ELEEEL-VV
Sequence 2 AKLIAEEADKKYDEAARKLAITEVDLERAEARLEAAEAKVLELEEELKVV

Sequence 1 GNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAEFAERSVQKLQ
           GNN-KSLE-SE--A--RE--Y---I--L--RLK-AE-RA--AER-V-KLQ
Sequence 2 GNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRATEAERTVSKLQ

Sequence 1 KEVDRLEDELVHEKEKYKYICDDLDMTFTELIGN
           KEVDRLEDEL--EKE-YK-I-D-LD-TF-EL-G-
Sequence 2 KEVDRLEDELLAEKERYKAISDELDQTFAELAGY



Alignment 41
Sequence 1:
Sequence 2: Allergen Pan h 4.0101, Sequence: XP_026781482
Sequence identity: 50.35 (143/284)
Sequence 1 MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKI
           M-AIKKKMQ--K--K-NA-DRA---E-------------E-E---LQKK-
Sequence 2 MEAIKKKMQMLKGDKENAFDRAEQAELDKKVSEDKCKQLEDELLGLQKKL

Sequence 1 QQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLE
           ---E---D---E-L-----KL----K----AE-EVAALNRRIQL-EE-L-
Sequence 2 KGTEDEVDKYSEALKDAQEKLELSEKKATDAEGEVAALNRRIQLIEEELD

Sequence 1 RSEERLATATAKLAEASQAADESERARKILESKGLADEERMDALENQLKE
           R---RL-TA--KL-EA---ADESER--K--E-----DEE-M---E-QLKE
Sequence 2 RAQGRLGTALQKLEEAEKQADESERGMKVIENRAMKDEEKMEIQELQLKE

Sequence 1 ARFMAEEADKKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVV
           A---AE--D-KYDEVARKL---E--LERAEERAE--E-K---LEEEL--V
Sequence 2 AKQIAEDSDRKYDEVARKLVVIEGELERAEERAEVSELKSGDLEEELKNV

Sequence 1 GNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAEFAERSVQKLQ
           -N-LKSLE---EK----E--Y---I--LN--LKEAE-RAEFAE--V-KL-
Sequence 2 TNTLKSLEAQAEKYSDKEDKYEEEINLLNEKLKEAETRAEFAEKTVSKLE

Sequence 1 KEVDRLEDELVHEKEKYKYICDDLDMTFTELIGN
           K--D-LEDEL---K-K-K-IC--LD---------
Sequence 2 KTIDDLEDELYNQKLKVKAICEELDNALNDMTTL



Alignment 42
Sequence 1:
Sequence 2: Allergen Der f 11.0101, Sequence: AAK39511
Sequence identity: 21.83 (62/284)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MNKKRDSELAKLRKLLEDVHIESEETAHHLRQKHQAAIQEMQDQLDQLQK

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 AKNKSDKEKQKFQAEVFELLAQLETANKEKLTALKNVEKLEYTVHELNIK

Sequence 1 ---------------------MDAIKKKMQAMKLEKDNAMDRALLCEQQA
           --------------------------K-----KL--DNA--------QQ-
Sequence 2 IEEINRTVIELTSHKQRLSQENTELIKEVHEVKLQLDNANHLKTQIAQQL

Sequence 1 RDANIRAEKAEEEARSLQKKIQQIENDLDQTMEQL-MQVNAKLDEKDKAL
           -D---R-E--E----SL-------E--L-----QL-----A-L-E----L
Sequence 2 EDTRHRLEEEERKRASLENHAHTLEVELESLKVQLDEESEARL-ELERQL

Sequence 1 QNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAADESERARK
           --A----A---------E--L------------K-A---Q---E-E----
Sequence 2 TKANGDAASWKSKY---EAELQAHADEVEELRRKMA---QKISEYEEQLE

Sequence 1 ILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLER
           -L--K----E-----L-----------E-A-----------A--E-----
Sequence 2 ALLNKCSSLEKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEKINLD

Sequence 1 AEERAETGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTL
           -----E-----------ELRV----L--L----EK------------K-L
Sequence 2 LKNKLEEVTMLMEQAQKELRVKIAELQKLQHEYEKLRDQRDQLARENKKL

Sequence 1 NTRLKEAEARAEFAERSVQKLQKEVDRLEDELVHEKEKYKYICDDLDMTF
           ---L-EA------A-R-------E--RLE-E-------YK----------
Sequence 2 TDDLAEAKSQLNDAHRRIHEQEIEIKRLENERDELSAAYKEAETLRKQEE

Sequence 1 TELIGN--------------------------------------------
           --------------------------------------------------
Sequence 2 AKNQRLIAELAQVRHDYEKRLAQKDEEIEALRKQYQIEIEQLNMRLAEAE

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 AKLKTEIARLKKKYQAQITELELSLDAANKANIDLQKTIKKQALQITELQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 AHYDEVHRQLQQAVDQLGVTQRRCQALQAELEEMRIALEQANRAKRQAEQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 LHEEAVVRVNELTTINVNLASAKSKLESEFSALQADYDEVHKELRISDER

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 VQKLTIELKSTKDLLIEEQERLVKLETVKKSLEQEVRTLHVRIEEVEANA

Sequence 1 -------------------------------------------------
           -------------------------------------------------
Sequence 2 LAGGKRVIAKLESRIRDVEIEVEEERRRHAETDKMLRKKDHRVKELLLQ



Alignment 43
Sequence 1:
Sequence 2: Allergen Rap v 2.0101, Sequence: QPB41107
Sequence identity: 25.70 (73/284)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MDYGSDINVVRKVSRTYNVYRGSSPSTQNRLESRIRELEDALDSERDGRV

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 RAEKMVAELNFRVDQLQDSLDEQGTSTSAQMEISKKRESEIMKLRKDMEL

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 ASAQFEATESSMRKRHQESVNDLSDQVDYLNKNKNRVEKEKQTLVVELDG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 LTGQLESVSKAKATLESRVDAAERSASGLKSQVDDLTRQLSELTSLKSRL

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 TQENFDLQHQVQELDSNNAALGKARSQLQASNDDLKRQLDDETRQRQNLQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 VNLSALQADYDNLNVRLEEEAETSTNLRNQLSKVNADYSALKSRFDKELA

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 LKMEEMEDLKRRMQVRITELEDTCEQLRVKNSSLEKAKTKLANEIKEITI

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 ELENTQIIVQDLTKRNRQLENENAGLQRRIEELTGENNTLRNEKALLEQD

Sequence 1 -------------------------MDAIKKKMQAMKLEKDNAMD-RALL
           --------------------------D-------A-K-------D-R-L-
Sequence 2 VQKLRVSNAELTERNDNLQRENKHLSDQLREANLALKDANRELADLRQLR

Sequence 1 CEQQA-RDANIRAEKAEEEA-RSLQKKIQQIENDLDQTMEQLMQVNAKLD
           ----A-RD----A-K--EEA-R----K-------L-Q-----------L-
Sequence 2 SQLEAERDSLAAALKDTEEALRDAEAKLASAQAALNQLK---IDMENRLR

Sequence 1 EKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLA--------
           EKD----N-----A---R-I--L---L---E-R--T--------------
Sequence 2 EKDEEIENVRRSSA---RAIEELQRTLVEVETRYKTEISRMKKKFESDIR

Sequence 1 EASQAADESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDE
           E---A-D---RA-------------R---LE--L-E-R------------
Sequence 2 ELEAALDNANRANSEYLKQIKSLQQRVKELETLLEEERRVSDDLRNQLGV

Sequence 1 VARKLAMVEADLERAEERAETGESKIVELEEELRVVGNNLK--SLEVSEE
           --RK-------LE-A----E--E------E-EL------L----L-V---
Sequence 2 AERKRVALAQELEDARALLEGAERARKNAETELADTSTRLSEITLQVTSL

Sequence 1 KANLREEEYKQQIKTLNTRLKEAEARAEFAERSVQKLQKEVDRLEDELVH
           ----R--E-----------L--A------AE-----L--E--RL-DEL--
Sequence 2 TNDKRRLE--ADLSAMQSDLDDAINNQRGAEERAERLAAENGRLADELRQ

Sequence 1 EKEKYKYICDDLDMTFTELIGN----------------------------
           E-E-YK-----------E--------------------------------
Sequence 2 EQENYKNAESLRKQLEVEIREITIRLEEAEAFATKEGRRLVAKLQVRVRD

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 LEAELENEARRVRESVANQRKAERLHKELVAQTEEERRQLAELASLNDQL

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QLRIKTYKRQLEEAEDVASLTMNKYRKAQALIDEADARADAAEKNLQTVR

Sequence 1 -----------------
           -----------------
Sequence 2 RARSMSVTREITRVIKV



Alignment 44
Sequence 1:
Sequence 2: Allergen Der p 11, Sequence: AAO73464
Sequence identity: 21.48 (61/284)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MSARTAKYMYRSSGAGASGDISVEYGTDLGALTRLEDKIRLLSDDLESER

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 EMRQRIEREKAELQIQVMSLSERLEEAEGSSESVTEMNKKRDSELAKLRK

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 LLEDVHMESEETAHHLRQKHQAAVHEMQDQLDQLQKAKNKSDKEKQKFQA

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 EVFELLSQLETANKEKLTALKSVEKLEYTVHELNIKIEEINRTVIELTSH

Sequence 1 -------MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEA
           ------------K-----KL--DNA--------QQ--D---R-E--E---
Sequence 2 KQRLTQENTELIKEVHEVKLQLDNANHLKQQIAQQLEDTRHRLEEEERKR

Sequence 1 RSLQKKIQQIENDLDQTMEQLM-QVNAKLDEKDKALQNAESEVAALNRRI
           -SL-------E--L-----QL-----A-L-E----L--A----A------
Sequence 2 SSLENHAHTLEVELESLKVQLDDESEARL-ELERQLTKANGDAASWKSKY

Sequence 1 QLLEEDLERSEERLATATAKLAEASQAADESERARKILESKGLADEERMD
           ---E--L------------K-A---Q---E-E-----L--K----E----
Sequence 2 ---EAELQAHADEVEELRRKMA---QKISEYEEQLEALLNKCSSLEKQKS

Sequence 1 ALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAEERAETGESKIVE
           -L-----------E-A-----------A--E----------E--------
Sequence 2 RLQSEVEVLIMDLEKAAAHAQQLEKRVAQLEKINLDLKDKLEEVTMLMEQ

Sequence 1 LEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAEFA
           ---ELR-----L--L----EK------------K-L---L-EA------A
Sequence 2 AQKELRIKIGELQKLQHEYEKVRDQRDQLARENKKLTDDLAEAKSQLNDA

Sequence 1 ERSVQKLQKEVDRLEDELVHEKEKYKYICDDLDMTFTELIGN--------
           -R-------E--RLE-E-------YK------------------------
Sequence 2 HRRIHEQEIEIKRLENERDELSAAYKEAETLRKQEEAKNQRLIAELAQVR

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 HDYEKRLAQKDEEIEALRKQYQIEIEQLNMRLAEAEAKLKTEIARLKKKY

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QAQITELELSLDAANKANIDLQKTIKKQALQITELQAHYDEVHRQLQQAV

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 DQLGVTQRRCQALQAELEEMRIALEQASRAKRQAEQLHEEAVVRVNELTT

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 INVNLASAKSKLESEFSALQADYDEVHKELRISDERVQKLTIELKSTKDL

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 LIEEQERLVKLETVKKSLEQEVRTLHVRIEEVEANALAGGKRVIAKLESR

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 IRDVEIEVEEERRRHAETEKMLRKKDHRVKELLLQNEEDHKQIQLLQEMT

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 DKLNEKVKVYKRQMQEQEGMSQQNLTRVRRFQRELEAAEDRADQAESNLS

Sequence 1 --------------------------------
           --------------------------------
Sequence 2 FIRAKHRSWVTTSQVPGGTRQVFTTQEETTNY



Alignment 45
Sequence 1:
Sequence 2: Allergen Blo t 11, Sequence: AAM83103
Sequence identity: 21.13 (60/284)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MAARSAKYMYQSSRAGHGGDISIEYGTDLGALTRLEDKIRLLSEDLESER

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 ELRQRVEREKSDITVQLMNLTERLEETEGSSESVTEMNKKRDSELAKLRK

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 LLEDVHMESEETAHHLRQKHQAAIQEMQDQLDQVQKAKNKSDKEKQKFQA

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 EVFELLAQVETANKDKLVAQKTVEKLEYTVHELNIKIEEINRTVVEVTAH

Sequence 1 -------MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEA
           ------------K-----K---DNA--------QQ--D---R-E--E---
Sequence 2 RQRLSQENSELIKEVHEYKISLDNANHLKGQIAQQLEDTRHRLEDEERKR

Sequence 1 RSLQKKIQQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQ
           -SL-------E--L-----QL--------E----L--A----A-------
Sequence 2 SSLENHAHTLEVELESLKVQLEEESEARLELERQLTKANGDAASWKSKYE

Sequence 1 L-LEEDLERSEERLATATAKLAEASQAADESERARKILESKGLADEERMD
           --L-------EE-------K--E--------------LE-----------
Sequence 2 AELQAHVDEVEELRRKMAQKISEYGEQLEALLNKCSALEKQKARLQSEVE

Sequence 1 ALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAEERAETGESKIVE
           -L---L--A---A----K--------------DL----E------S---E
Sequence 2 VLIMDLEKATAHAQALEKRVSQLEK----INLDLKSKLEEV----SMLLE

Sequence 1 -LEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAEF
           -----LRV----L--L----EK-----E------K-L---L-EA------
Sequence 2 QTQKDLRVKIADLQKLQHEYEKLRDQKEALARENKKLADDLAEAKSQLND

Sequence 1 AERSVQKLQKEVDRLEDELVHEKEKYKYICDDLDMTFTELIGN-------
           A-R-------E--RLE-E-------YK-----------------------
Sequence 2 AHRRIHEQEIEIKRLENEREELAAAYKEAETLRKQEEAKNQRLTAELAQT

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 RHDYEKRLAQKEEEIEALRKQYQIEIEQLNMRLAEAEAKLKTEVARLKKK

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 YQAQITELELSLDAANKANIDLQKTIKKQALQITGLQAHYDEVHRQLQQA

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 VDQLGVTQRRCQALTAELEEMRVNLEQALRAKRAAEQMHEEAVVRVNELT

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 TINVNLASAKSKLETEFSALQNDYDEVHKELRISDERVQKLTIEVKSTKD

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 LLESETERVTKLETIKKSLETEVRNLQIRIEEVEANALAGGKRVIAKLES

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 RIRDVEIEVEEERRRHAETEKMLRKKDHRVKELLLQNEEDHKQIQLLQEM

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 SDKLNEKVKVYKRQMQEQEGMSQQNLTRVRRFQRELEAAEDRADQAESNL

Sequence 1 ---------------------------------
           ---------------------------------
Sequence 2 SFIRAKHRSWVTTSQVPGGTRQVFVTEQESSNF



Alignment 46
Sequence 1:
Sequence 2: Allergen Ani s 2, Sequence: AAF72796
Sequence identity: 26.41 (75/284)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MSDTLYRSPSMAIRSSTADMGALTSMSVADLGSLTRLEDKIRLLQDDFES

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 ERELRNRIERERADLSVQLIALTDRLQDAECATDSQIESNRKREVELSKL

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 RKLLEESQLENEDAMNVLRKKHQDVCLDYTEQIEQLQKKNSKIDRERQRL

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QHEVIELTATIDQLQKDKHVAEKMAQKFEQQTIELSNKVEDLNKHVNDLA

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QQRQRLQAENSDLLAEIHDQKVQLDNLQHVKYQLAQQLEESRRRLEDAER

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 ERSQMQAQLHQVQLELDSVRVALDEESAARVEAEHKLSLANTEITQWKSK

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 FDAEVALHHEEVEDLRKKMMQKQAEYEEQIEIMLQKVSQLEKAKARLQSE

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 VEVLIVDLEKAQNTIAILERAKEQLEKQVLEMKSRIDELLVELEAAQREA

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 RAALAELQKMKQLYEKAVEQKEALARENKKLQDDLHEANEALADANRKLH

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 ELDLENARLAGEIRDLQVALKESEAARRDAEARAQRALAELQQVRIEMER

Sequence 1 --------MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIR----AEK
           --------M-A--K-MQ--------A----------A--A--R----AE-
Sequence 2 RLQEKEEEMEALRKSMQ-FEIDRLTAALADAEARMKAEIARLRKKYQAEI

Sequence 1 AEEEAR--SLQKKIQQIENDLDQTMEQLMQVNAKLDEKDKALQNAESEVA
           AE-E-----L---------------EQ--Q--A-L------LQ------A
Sequence 2 AELEMTVDNLNRANLEAQKTIKKQSEQIIQLQANLEDTQRQLQQTLDQYA

Sequence 1 ALNRRIQLLEEDLERSEERLATATAKLAEASQAADESERARKILESKGLA
           ---R-I--L---LE--E---A---A--A-----AD--E----I-------
Sequence 2 LAQRKISALSAELE--ECKTALDNAIRARKQAEADLEEAHVRISDLTSIN

Sequence 1 DEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAEERAETG
           ------A--N-L-E-------AD---DEV---L----AD-ERA-------
Sequence 2 SN--LTAIKNKL-ETELSTAQAD--LDEVTKELHA--AD-ERANRALADA

Sequence 1 ESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAE
           -----EL-EE---------S---------L-E-----Q-K-L-----EAE
Sequence 2 ARAVQELHEEQE------HSMKIDALRKSLEE-----QVKQLQVQIQEAE

Sequence 1 ARAEFA-ERSVQKLQKEVDRLEDELVHEKEKYKYICDDLDMTFTELIGN-
           A-A-----R---KL------LE--L--E----K-----L-----------
Sequence 2 AAALLGGKRVIAKLETRIRDLEVALDEETRRHKETQSALRKKDRRIKEVQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MQIDEEHKMFVMAQDTADRMLEKLNIQKRQLGEAEAMTMQNLQRVRRYQR

Sequence 1 -----------------------------------------
           -----------------------------------------
Sequence 2 ELEDAEGRADQAESSLNLIRAKHRGTVAVGKATDVYVVEED


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.