The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Act d 9.0101

Sequence 195249738

Full FASTA alignment

Sequence name:
Query sequence:
MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
LIIGIYDEP

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Act d 9.0101FG438715Go!109179.31.7e-47
2Cap a 2CAD10376Go!131175.23.8e-46
3Lyc e 1AAL29690Go!131170.78.4e-45
4Hev b 8.0102Q9STB6Go!131165.33.6e-43
5Gly m 3O65809Go!131164.36.9e-43
6Hev b 8.0101O65812Go!131163.99.6e-43
7Lyc e 1CAD10377Go!131163.11.6e-42
8Gly m 3O65810Go!131161.54.9e-42
9Citr l 2.0101Q5XWE1Go!131161.35.8e-42
10Ara h 5Q9SQI9Go!131161.06.8e-42
11Pru p 4.0201CAD37202Go!131160.69.4e-42
12Cor a 2Q9AXH4Go!131159.61.8e-41
13Lit c 1AAL07320Go!131159.42.1e-41
14Mal d 4Q9XF41Go!131159.42.1e-41
15Che a 2AAL92870Go!131159.12.5e-41
16Pru p 4.0101CAD37201Go!131159.12.5e-41
17Pru du 4.0101AY081850Go!131158.92.9e-41
18Pru du 4.0102AY081852Go!131158.92.9e-41
19Cor a 2AAK01235Go!131158.24.8e-41
20Cuc m 2AAP13533Go!131158.05.6e-41
21Pru av 4Q9XF39Go!131157.57.8e-41
22Hev b 8.0201Q9M7N0Go!131157.57.8e-41
23Mal d 4Q9XF42Go!131156.12.1e-40
24Ory s 12.0101Q9FUD1Go!131155.43.4e-40
25Pho d 2.0101Q8L5D8Go!131154.75.5e-40
26Pyr c 4Q9XF38Go!131154.46.5e-40
27Ara t 8Q42449Go!131154.46.5e-40
28Hev b 8.0204Q9LEI8Go!131154.46.5e-40
29Cit s 2.0101P84177Go!131153.71.1e-39
30Hev b 8.0203Q9M7M8Go!131153.31.5e-39
31Ana c 1AAK54835Go!131153.31.5e-39
32Cyn d 12O04725Go!131153.31.5e-39
33Hev b 8.0202Q9M7M9Go!131153.01.7e-39
34Sin a 4.0101ABU95412Go!131152.82.0e-39
35Zea m 12.0101P35081Go!131152.62.4e-39
36Phl p 12.0102O24650Go!131152.13.3e-39
37Ama r 2.0101ACP43298Go!133152.13.4e-39
38Sal k 4.0101ACS34771Go!133152.13.4e-39
39Mus a 1.0101AF377948Go!131150.97.5e-39
40Zea m 12.0103P35083Go!131150.97.5e-39
41Phl p 12.0101CAA54686Go!131150.41.0e-38
42Phl p 12.0101P35079Go!131150.41.0e-38
43Mal d 4Q9XF40Go!131150.41.0e-38
44Ole e 2O24171Go!134150.21.3e-38
45Ole e 2O24169Go!134150.21.3e-38
46Ole e 2O24170Go!134150.21.3e-38
47Aca f 2A0A0A0RCW1Go!133148.83.3e-38
48Dau c 4AAL76933Go!134148.83.3e-38
49Api g 4Q9XF37Go!134148.34.6e-38
50Phl p 12.0103O24282Go!131148.15.3e-38
51Mer a 1O49894Go!133148.15.4e-38
52Par j 3Q9XG85Go!132147.67.4e-38
53Zea m 12.0104O22655Go!131147.48.7e-38
54Cro s 1.0101Q5EF31Go!131147.48.7e-38
55Tri a 12.0104FM164277Go!131147.11.0e-37
56Hor v 12.0101P52184Go!131146.02.3e-37
57Tri a 12.0101P49232Go!138146.02.4e-37
58Tri a 12.0102P49233Go!141146.02.5e-37
59Zea m 12.0105Q9FR39Go!131145.53.2e-37
60Par j 3Q9T0M8Go!131145.04.5e-37
61Bet v 2P25816Go!133144.85.3e-37
62Tri a 12.0103P49234Go!140144.37.7e-37
63Zea m 12.0102P35082Go!131143.61.2e-36
64Art v 4.0101AJ421030Go!133143.61.2e-36
65Sal k 4.0201ADK22841Go!133142.23.2e-36
66Art v 4.0201AJ421031Go!133142.03.8e-36
67Can s 2.0101XP030492464Go!133141.36.1e-36
68Hel a 2O81982Go!133138.73.7e-35

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Act d 9.0101, Sequence: FG438715
Sequence identity: 100.00 (109/109)
Sequence 1 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
           MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
Sequence 2 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI

Sequence 1 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
           MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
Sequence 2 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA

Sequence 1 LIIGIYDEP
           LIIGIYDEP
Sequence 2 LIIGIYDEP



Alignment 2
Sequence 1:
Sequence 2: Allergen Cap a 2, Sequence: CAD10376
Sequence identity: 95.41 (104/109)
Sequence 1 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
           MSWQTYVDDHLMCEIEGN-LTSAAIIGQDGS-WAQSA-FPQFKPEEITAI
Sequence 2 MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAI

Sequence 1 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
           MNDF-EPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGG-TVKKTNQA
Sequence 2 MNDFAEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQA

Sequence 1 LIIGIYDEP----------------------
           LIIGIYDEP----------------------
Sequence 2 LIIGIYDEPMTPGQCNMIVERLGDYLIEQSL



Alignment 3
Sequence 1:
Sequence 2: Allergen Lyc e 1, Sequence: AAL29690
Sequence identity: 92.66 (101/109)
Sequence 1 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
           MSWQTYVDDHLMC-IEGN-LTSAAIIGQDGS-WAQSA-FPQFKPEEITAI
Sequence 2 MSWQTYVDDHLMCDIEGNHLTSAAIIGQDGSVWAQSANFPQFKPEEITAI

Sequence 1 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
           MNDF-EPGTLAPTGL-LGGTKYMVIQGEAGAVIRGKKG-GG-TVKKTNQA
Sequence 2 MNDFAEPGTLAPTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTNQA

Sequence 1 LIIGIYDEP----------------------
           LIIGIYDEP----------------------
Sequence 2 LIIGIYDEPMTPGQCNMIVERLGDYIIEQGL



Alignment 4
Sequence 1:
Sequence 2: Allergen Hev b 8.0102, Sequence: Q9STB6
Sequence identity: 88.99 (97/109)
Sequence 1 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
           MSWQ-YVDDHLMCEIEGN-L--AAIIGQDGS-WAQSA-FPQFK-EEIT-I
Sequence 2 MSWQAYVDDHLMCEIEGNHLSAAAIIGQDGSVWAQSANFPQFKSEEITGI

Sequence 1 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
           M-DF-EPGTLAPTGLY-GGTKYMVIQGE-GAVIRGKKGPGGVTVKKTNQA
Sequence 2 MSDFHEPGTLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQA

Sequence 1 LIIGIYDEP----------------------
           LIIGIYDEP----------------------
Sequence 2 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGY



Alignment 5
Sequence 1:
Sequence 2: Allergen Gly m 3, Sequence: O65809
Sequence identity: 88.07 (96/109)
Sequence 1 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
           MSWQ-YVDDHL-C-IEGN-LT-AAIIGQDGS-WAQS--FPQFKPEEITAI
Sequence 2 MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAI

Sequence 1 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
           MNDF-EPG-LAPTGLYLGGTKYMVIQGE-GAVIRGKKGPGGVTVKKT--A
Sequence 2 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAA

Sequence 1 LIIGIYDEP----------------------
           LIIGIYDEP----------------------
Sequence 2 LIIGIYDEPMTPGQCNMVVERPGDYLIDQGY



Alignment 6
Sequence 1:
Sequence 2: Allergen Hev b 8.0101, Sequence: O65812
Sequence identity: 88.99 (97/109)
Sequence 1 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
           MSWQTYVD--LMCEIEGN-LT-AAIIGQDGS-WAQS--FPQFK-EEITAI
Sequence 2 MSWQTYVDERLMCEIEGNHLTAAAIIGQDGSVWAQSSNFPQFKSEEITAI

Sequence 1 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
           M-DF-EPGTLAPTGL-LGGTKYMVIQGEAGAVIRGKKGPGGVTV-KTNQA
Sequence 2 MSDFDEPGTLAPTGLHLGGTKYMVIQGEAGAVIRGKKGPGGVTVRKTNQA

Sequence 1 LIIGIYDEP----------------------
           LIIGIYDEP----------------------
Sequence 2 LIIGIYDEPMTPGQCNMIVERLGDYLLEQGM



Alignment 7
Sequence 1:
Sequence 2: Allergen Lyc e 1, Sequence: CAD10377
Sequence identity: 87.16 (95/109)
Sequence 1 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
           MSWQTYVD-HL-CE-EGN-LTSAAIIGQDG--WAQSA-FPQFKPEEIT-I
Sequence 2 MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGI

Sequence 1 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
           MNDF--PGTLAPTGLYLGGTKYMVIQGE--AVIRGKKGPGG-T-KKTNQA
Sequence 2 MNDFAVPGTLAPTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQA

Sequence 1 LIIGIYDEP----------------------
           LIIGIYDEP----------------------
Sequence 2 LIIGIYDEPMTPGQCNMIVERLGDYLIEQSL



Alignment 8
Sequence 1:
Sequence 2: Allergen Gly m 3, Sequence: O65810
Sequence identity: 87.16 (95/109)
Sequence 1 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
           MSWQ-YVDDHL-C-IEGN-LT-AAIIGQDGS-W-QS--FPQFKPEEITAI
Sequence 2 MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAI

Sequence 1 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
           MNDF-EPG-LAPTGLYLGGTKYMVIQGE-GAVIRGKKGPGGVTVKKT--A
Sequence 2 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAA

Sequence 1 LIIGIYDEP----------------------
           LIIGIYDEP----------------------
Sequence 2 LIIGIYDEPMTPGQCNMVVERLGDYLIDQGY



Alignment 9
Sequence 1:
Sequence 2: Allergen Citr l 2.0101, Sequence: Q5XWE1
Sequence identity: 85.32 (93/109)
Sequence 1 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
           MSWQ-YVDDHLMCEIEGN-LTSAAIIGQDGS-WA-S--FPQ-KPEEIT-I
Sequence 2 MSWQAYVDDHLMCEIEGNHLTSAAIIGQDGSVWAKSENFPQLKPEEITGI

Sequence 1 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
           -NDF-EPGTLAPTGLY-GG-KYMVIQGE-GAVIRGKKGPGGVTVKKT--A
Sequence 2 LNDFNEPGTLAPTGLYIGGSKYMVIQGEPGAVIRGKKGPGGVTVKKTALA

Sequence 1 LIIGIYDEP----------------------
           L-IGIYDEP----------------------
Sequence 2 LVIGIYDEPMTPGQCNMIVERLGDYLIEQGL



Alignment 10
Sequence 1:
Sequence 2: Allergen Ara h 5, Sequence: Q9SQI9
Sequence identity: 83.49 (91/109)
Sequence 1 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
           MSWQTYVD-HL-CEIEG--L-SAAI-GQDG--WAQS--FPQFKPEEITAI
Sequence 2 MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAI

Sequence 1 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
           MNDF-EPG-LAPTGLYLGGTKYMVIQGE-GA-I-GKKGPGGVT--KTNQA
Sequence 2 MNDFAEPGSLAPTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQA

Sequence 1 LIIGIYDEP----------------------
           LIIGIYD-P----------------------
Sequence 2 LIIGIYDKPMTPGQCNMIVERLGDYLIDTGL



Alignment 11
Sequence 1:
Sequence 2: Allergen Pru p 4.0201, Sequence: CAD37202
Sequence identity: 83.49 (91/109)
Sequence 1 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
           MSWQ-YVDDHLMCEIEGN-L--AAIIG-DGS-WAQSA-FPQ-KPEE-T-I
Sequence 2 MSWQAYVDDHLMCEIEGNHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGI

Sequence 1 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
           -NDF-EPG-LAPTGLYLGGTKYMVIQGE-GAVIRGKKGPGGVTVKK---A
Sequence 2 LNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKSTLA

Sequence 1 LIIGIYDEP----------------------
           L-IGIYDEP----------------------
Sequence 2 LLIGIYDEPMTPGQCNMIVERLGDYLVEQGL



Alignment 12
Sequence 1:
Sequence 2: Allergen Cor a 2, Sequence: Q9AXH4
Sequence identity: 84.40 (92/109)
Sequence 1 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
           MSWQ-Y-D-HLMCEIEGN-L--AAIIG-DGS-WAQS--FPQ-KPEEIT--
Sequence 2 MSWQAYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV

Sequence 1 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
           MNDF-EPG-LAPTGLYLGGTKYMVIQGE-GAVIRGKKGPGGVTVKKT-QA
Sequence 2 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTSQA

Sequence 1 LIIGIYDEP----------------------
           LIIGIYDEP----------------------
Sequence 2 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL



Alignment 13
Sequence 1:
Sequence 2: Allergen Lit c 1, Sequence: AAL07320
Sequence identity: 84.40 (92/109)
Sequence 1 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
           MSWQTYVDDHLMCE--G--LT-AAIIG-DGS-WAQSA-FPQFKP-EI-AI
Sequence 2 MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAI

Sequence 1 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
           M-DF-EPG-LAPTGL-LGGTKYMVIQGE-GAVIRGKKGPGG-TVKKT-QA
Sequence 2 MKDFDEPGSLAPTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQA

Sequence 1 LIIGIYDEP----------------------
           LIIGIYDEP----------------------
Sequence 2 LIIGIYDEPMTPGQCNMVVERLGDYLVDQGL



Alignment 14
Sequence 1:
Sequence 2: Allergen Mal d 4, Sequence: Q9XF41
Sequence identity: 82.57 (90/109)
Sequence 1 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
           MSWQ-YVDDHLMCEIEGN-L--AAIIG--GS-WAQSA-FPQ-KPEE-T-I
Sequence 2 MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGI

Sequence 1 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
           MNDF-EPG-LAPTGLYLGGTKYMVIQGE-G-VIRGKKGPGGVTVKK---A
Sequence 2 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMA

Sequence 1 LIIGIYDEP----------------------
           L-IGIYDEP----------------------
Sequence 2 LLIGIYDEPMTPGQCNMVVERLGDYLIEQGL



Alignment 15
Sequence 1:
Sequence 2: Allergen Che a 2, Sequence: AAL92870
Sequence identity: 82.57 (90/109)
Sequence 1 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
           MSWQTYVDDHLMC-IEGN-L-SAAI-G-DG--WAQS-SFPQ-KPEE--AI
Sequence 2 MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAI

Sequence 1 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
           M-DF-EPG-LAPTGL-LGGTKYMVIQGE-G-VIRGKKGPGGVT-KKTNQA
Sequence 2 MKDFNEPGSLAPTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQA

Sequence 1 LIIGIYDEP----------------------
           LIIGIY-EP----------------------
Sequence 2 LIIGIYGEPMTPGQCNMVVERIGDYLVEQGM



Alignment 16
Sequence 1:
Sequence 2: Allergen Pru p 4.0101, Sequence: CAD37201
Sequence identity: 83.49 (91/109)
Sequence 1 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
           MSWQ-YVDDHLMC-I-GN-LT-AAI-GQDGS-W-QSA-FP-FKPEEI-AI
Sequence 2 MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAI

Sequence 1 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
           --DF--PGTLAPTGL-LGGTKYMVIQGEAGAVIRGKKG-GG-TVKKTNQA
Sequence 2 LKDFDQPGTLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQA

Sequence 1 LIIGIYDEP----------------------
           LIIGIYDEP----------------------
Sequence 2 LIIGIYDEPLTPGQCNMIVERLGDYLIEQGL



Alignment 17
Sequence 1:
Sequence 2: Allergen Pru du 4.0101, Sequence: AY081850
Sequence identity: 83.49 (91/109)
Sequence 1 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
           MSWQ-YVDDHLMC-I-GN-LT-AAI-GQDGS-W-QSA-FP-FKPEEI-AI
Sequence 2 MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAI

Sequence 1 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
           --DF--PGTLAPTGL-LGGTKYMVIQGEAGAVIRGKKG-GG-TVKKTNQA
Sequence 2 LKDFDQPGTLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQA

Sequence 1 LIIGIYDEP----------------------
           LIIGIYDEP----------------------
Sequence 2 LIIGIYDEPLTPGQCNMIVERLGDYLIEQGL



Alignment 18
Sequence 1:
Sequence 2: Allergen Pru du 4.0102, Sequence: AY081852
Sequence identity: 83.49 (91/109)
Sequence 1 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
           MSWQ-YVDDHLMC-I-GN-LT-AAI-GQDGS-W-QSA-FP-FKPEEI-AI
Sequence 2 MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAI

Sequence 1 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
           --DF--PGTLAPTGL-LGGTKYMVIQGEAGAVIRGKKG-GG-TVKKTNQA
Sequence 2 LKDFDQPGTLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQA

Sequence 1 LIIGIYDEP----------------------
           LIIGIYDEP----------------------
Sequence 2 LIIGIYDEPLTPGQCNMIVERLGDYLIEQGL



Alignment 19
Sequence 1:
Sequence 2: Allergen Cor a 2, Sequence: AAK01235
Sequence identity: 84.40 (92/109)
Sequence 1 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
           MSWQTY-D-HLMCEIEGN-L--AAIIG-DGS-WAQS--FPQ-KPEEIT--
Sequence 2 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV

Sequence 1 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
           MNDF-EPG-LAPTGLYLGGTKYMVIQGE-GAVIR-KKGPGGVTVKKT-QA
Sequence 2 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA

Sequence 1 LIIGIYDEP----------------------
           LIIGIYDEP----------------------
Sequence 2 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL



Alignment 20
Sequence 1:
Sequence 2: Allergen Cuc m 2, Sequence: AAP13533
Sequence identity: 82.57 (90/109)
Sequence 1 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
           MSWQ-YVD-HLMCEIEGN-LTSAAIIGQDGS-WAQS--FPQ-KPEE---I
Sequence 2 MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGI

Sequence 1 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
           --DF--PGTLAPTGLY-GGTKYMVIQGE-GAVIRGKKGPGGVTVKKT--A
Sequence 2 VGDFADPGTLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMA

Sequence 1 LIIGIYDEP----------------------
           L-IGIYDEP----------------------
Sequence 2 LVIGIYDEPMTPGQCNMIVERLGDYLIDQGL



Alignment 21
Sequence 1:
Sequence 2: Allergen Pru av 4, Sequence: Q9XF39
Sequence identity: 82.57 (90/109)
Sequence 1 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
           MSWQ-YVDDHLMC-I-GN-LT-AAI-GQDGS-W-QSA-FP-FKPEEI-AI
Sequence 2 MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAI

Sequence 1 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
           --D---PGTLAPTGL-LGGTKYMVIQGEAGAVIRGKKG-GG-TVKKTNQA
Sequence 2 LKDLDQPGTLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQA

Sequence 1 LIIGIYDEP----------------------
           LIIGIYDEP----------------------
Sequence 2 LIIGIYDEPLTPGQCNMIVERLGDYLIEQGL



Alignment 22
Sequence 1:
Sequence 2: Allergen Hev b 8.0201, Sequence: Q9M7N0
Sequence identity: 82.57 (90/109)
Sequence 1 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
           MSWQTYVD-HLMC-I-G--LT-AAIIG-DGS-WAQS-SFPQFKPEE--AI
Sequence 2 MSWQTYVDEHLMCDIDGHHLTAAAIIGHDGSVWAQSSSFPQFKPEEVAAI

Sequence 1 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
           M-DF-EPG-LAPTGL-LGGTKYMVIQGE-GAVIRGKKG-GG-TVKKT-QA
Sequence 2 MKDFDEPGSLAPTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQA

Sequence 1 LIIGIYDEP----------------------
           LIIGIYDEP----------------------
Sequence 2 LIIGIYDEPLTPGQCNMIVERLGDYLLEQGM



Alignment 23
Sequence 1:
Sequence 2: Allergen Mal d 4, Sequence: Q9XF42
Sequence identity: 80.73 (88/109)
Sequence 1 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
           MSWQ-YVDDHLMC-I-GN-LT-AAI-GQDGS-W-QSASFP-FKPEEI-AI
Sequence 2 MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAI

Sequence 1 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
           --DF--PGTLAPTGL-LGGTKYMVIQGE-GAVIRGKKG-GG-T-KKT-QA
Sequence 2 LKDFDQPGTLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQA

Sequence 1 LIIGIYDEP----------------------
           L-IGIYDEP----------------------
Sequence 2 LLIGIYDEPVTPGQCNIVVERLGDYLIEQGL



Alignment 24
Sequence 1:
Sequence 2: Allergen Ory s 12.0101, Sequence: Q9FUD1
Sequence identity: 80.73 (88/109)
Sequence 1 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
           MSWQTYVD-HLMCEIEG--LTSAAI-G-DG--WAQSA-FPQFKPEE-T-I
Sequence 2 MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNI

Sequence 1 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
           M-DF-EPG-LAPTGL-LG-TKYMVIQGE-GAVIRGKKG-GG-TVKKT-QA
Sequence 2 MKDFDEPGFLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQA

Sequence 1 LIIGIYDEP----------------------
           L--GIYDEP----------------------
Sequence 2 LVVGIYDEPMTPGQCNMVVERLGDYLVEQGL



Alignment 25
Sequence 1:
Sequence 2: Allergen Pho d 2.0101, Sequence: Q8L5D8
Sequence identity: 82.57 (90/109)
Sequence 1 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
           MSWQ-YVD-HLMCEI-G--LT-AAI-G-DGS-WAQS-SFPQFK-EEIT-I
Sequence 2 MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNI

Sequence 1 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
           MNDF-EPG-LAPTGLYLG-TKYMVIQGE-GAVIRGKKG-GGVTVKKTNQA
Sequence 2 MNDFNEPGSLAPTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQA

Sequence 1 LIIGIYDEP----------------------
           LI-GIY-EP----------------------
Sequence 2 LIFGIYEEPMTPGQCNMVVERLGDYLIEQGM



Alignment 26
Sequence 1:
Sequence 2: Allergen Pyr c 4, Sequence: Q9XF38
Sequence identity: 79.82 (87/109)
Sequence 1 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
           MSWQ-YVDDHLMC-I-G--LT-AAI-G-DGS-WAQS--FP-FKPEEITAI
Sequence 2 MSWQAYVDDHLMCDIDGHHLTAAAILGHDGSVWAQSSTFPKFKPEEITAI

Sequence 1 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
           M-DF-EPG-LAPTGL-LGGTKYMVIQGE-GAVIRGKKG-GGVTVKKT-QA
Sequence 2 MKDFDEPGSLAPTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTSQA

Sequence 1 LIIGIYDEP----------------------
           L--GIY-EP----------------------
Sequence 2 LVFGIYEEPLTPGQCNMIVERLGDYLIDQGL



Alignment 27
Sequence 1:
Sequence 2: Allergen Ara t 8, Sequence: Q42449
Sequence identity: 78.90 (86/109)
Sequence 1 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
           MSWQ-YVDDHLMC--EGN-LT-AAI-GQDGS-WAQSA-FPQ-KP-EI--I
Sequence 2 MSWQSYVDDHLMCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGI

Sequence 1 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
           --DF-EPG-LAPTGL-LGG-KYMVIQGE-GAVIRGKKGPGGVT-KKTNQA
Sequence 2 KKDFEEPGFLAPTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQA

Sequence 1 LIIGIYDEP----------------------
           L--G-YDEP----------------------
Sequence 2 LVFGFYDEPMTGGQCNLVVERLGDYLIESEL



Alignment 28
Sequence 1:
Sequence 2: Allergen Hev b 8.0204, Sequence: Q9LEI8
Sequence identity: 80.73 (88/109)
Sequence 1 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
           MSWQTYVDDHLMC-I-G--LT-AAIIG-DGS-WAQS-SFPQFK--E--A-
Sequence 2 MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAV

Sequence 1 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
           M-DF-EPG-LAPTGL-LGGTKYMVIQGE-GAVIRGKKG-GG-TVKKT-QA
Sequence 2 MKDFDEPGSLAPTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQA

Sequence 1 LIIGIYDEP----------------------
           LIIGIYDEP----------------------
Sequence 2 LIIGIYDEPLTPGQCNMIVERLGDYLLDQGL



Alignment 29
Sequence 1:
Sequence 2: Allergen Cit s 2.0101, Sequence: P84177
Sequence identity: 80.73 (88/109)
Sequence 1 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
           MSWQ-YVDDHLMC-I-GN-LT-AAI-GQDGS-W-QSA-FP-F--EEI-AI
Sequence 2 MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAI

Sequence 1 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
           --DF--PGTLAPTGL-LGGTKYMVIQGEAGAVIRGKKG-GG--VKKTNQA
Sequence 2 LKDFDQPGTLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQA

Sequence 1 LIIGIYDEP----------------------
           LIIGIYDEP----------------------
Sequence 2 LIIGIYDEPLTPGQCNMIVERLGDYLIEQGL



Alignment 30
Sequence 1:
Sequence 2: Allergen Hev b 8.0203, Sequence: Q9M7M8
Sequence identity: 79.82 (87/109)
Sequence 1 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
           MSWQTYVDDHLMC-I-G--LT-AAIIG-DGS-WAQS--FPQFK--E--A-
Sequence 2 MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSGFPQFKSDEVAAV

Sequence 1 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
           M-DF-EPG-LAPTGL-LGGTKYMVIQGE-GAVIRGKKG-GG-TVKKT-QA
Sequence 2 MKDFDEPGSLAPTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQA

Sequence 1 LIIGIYDEP----------------------
           LIIGIYDEP----------------------
Sequence 2 LIIGIYDEPLTPGQCNMIVERLGDYLLEQGM



Alignment 31
Sequence 1:
Sequence 2: Allergen Ana c 1, Sequence: AAK54835
Sequence identity: 78.90 (86/109)
Sequence 1 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
           MSWQ-YVDDHLMCEI-G--L-SAAI-G-D---WAQS--FPQFKPEEI-AI
Sequence 2 MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAI

Sequence 1 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
           -NDF--PG-LAPTGLYLGGTKYMVIQGE-G-VIRGKKG-GG-TVKKTN-A
Sequence 2 LNDFENPGSLAPTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLA

Sequence 1 LIIGIYDEP----------------------
           LIIG-YDEP----------------------
Sequence 2 LIIGVYDEPMTPGQCNMVVERLGDYLLEQGF



Alignment 32
Sequence 1:
Sequence 2: Allergen Cyn d 12, Sequence: O04725
Sequence identity: 81.65 (89/109)
Sequence 1 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
           MSWQ-YVDDHLMCEIEG--LTSAAIIG-DG--WAQSA-FP-FKPEE---I
Sequence 2 MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANI

Sequence 1 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
           M-DF-EPG-LAPTGL-LG-TKYMVIQGE-GAVIRGKKG-GGVTVKKT-QA
Sequence 2 MKDFDEPGFLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQA

Sequence 1 LIIGIYDEP----------------------
           L-IGIYDEP----------------------
Sequence 2 LVIGIYDEPMTPGQCNMVIEKLGDYLIEQGM



Alignment 33
Sequence 1:
Sequence 2: Allergen Hev b 8.0202, Sequence: Q9M7M9
Sequence identity: 80.73 (88/109)
Sequence 1 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
           MSWQTYVDDHLMC-I-G--LT-AAIIG-DGS-WAQS-SFPQFK--E--AI
Sequence 2 MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAI

Sequence 1 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
           M-DF-EPG-LAPTGL-LG-TKYMVIQGE-GAVIRGKKG-GG-TVKKT-QA
Sequence 2 MKDFDEPGSLAPTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQA

Sequence 1 LIIGIYDEP----------------------
           LIIGIYDEP----------------------
Sequence 2 LIIGIYDEPLTPGQCNMIVERLGDYLLEQGM



Alignment 34
Sequence 1:
Sequence 2: Allergen Sin a 4.0101, Sequence: ABU95412
Sequence identity: 78.90 (86/109)
Sequence 1 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
           MSWQTYVDDHLMC--EGN-LT-AAI-GQDGS-WAQSA-FPQ-KPEEI--I
Sequence 2 MSWQTYVDDHLMCDVEGNRLTAAAILGQDGSVWAQSANFPQLKPEEIKGI

Sequence 1 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
           -NDF-EPGTLAPTGL--GGTKYMVIQGE--AVIRGKKG-GGVT-KKT-QA
Sequence 2 NNDFAEPGTLAPTGLFIGGTKYMVIQGEPNAVIRGKKGAGGVTIKKTTQA

Sequence 1 LIIGIYDEP----------------------
           ---GIY-EP----------------------
Sequence 2 FVFGIYEEPMTPGQCNMVVERLGDYLIEQGL



Alignment 35
Sequence 1:
Sequence 2: Allergen Zea m 12.0101, Sequence: P35081
Sequence identity: 80.73 (88/109)
Sequence 1 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
           MSWQTYVD-HLMCEIEG--LTSAAI-G-DG--WAQS--FP-FKPEE--AI
Sequence 2 MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAI

Sequence 1 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
           M-DF-EPG-LAPTGL-LGGTKYMVIQGE-GAVIRGKKG-GG-TVKKT-Q-
Sequence 2 MKDFDEPGHLAPTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQS

Sequence 1 LIIGIYDEP----------------------
           LIIGIYDEP----------------------
Sequence 2 LIIGIYDEPMTPGQCNLVVERLGDYLLEQGM



Alignment 36
Sequence 1:
Sequence 2: Allergen Phl p 12.0102, Sequence: O24650
Sequence identity: 77.06 (84/109)
Sequence 1 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
           MSWQTYVD-HLMCEIEG--L-SAAI-G-DG--WAQSA-FPQFKPEEIT-I
Sequence 2 MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGI

Sequence 1 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
           M-DF-EPG-LAPTG----G-KYMVIQGE-GAVIRGKKG-GG-T-KKT-QA
Sequence 2 MKDFDEPGHLAPTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQA

Sequence 1 LIIGIYDEP----------------------
           L--GIYDEP----------------------
Sequence 2 LVVGIYDEPMTPGQCNMVVERLGDYLVEQGM



Alignment 37
Sequence 1:
Sequence 2: Allergen Ama r 2.0101, Sequence: ACP43298
Sequence identity: 81.65 (89/109)
Sequence 1 MSWQTYVDDHLMCEIEG--NYLTSAAIIGQDGSIWAQSASFPQFKPEEIT
           MSWQ-YVDDHLMCEIEG--N-LT-AAI-G-DGS-WAQSA-FPQFKP-EI-
Sequence 2 MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIA

Sequence 1 AIMNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTN
           AI--DF-EPGTLAPTGL-LGGTKYMVIQGE-GAVIRGKKG-GG--VKKT-
Sequence 2 AIVEDFDEPGTLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTG

Sequence 1 QALIIGIYDEP----------------------
           QAL--GIYDEP----------------------
Sequence 2 QALVMGIYDEPVTPGQCNMIVERLGDYLIEQGY



Alignment 38
Sequence 1:
Sequence 2: Allergen Sal k 4.0101, Sequence: ACS34771
Sequence identity: 81.65 (89/109)
Sequence 1 MSWQTYVDDHLMCEIEG--NYLTSAAIIGQDGSIWAQSASFPQFKPEEIT
           MSWQTYVDDHLMCEIEG--N-LT-AAI-G-DGS-WAQSA-FPQFKP-EI-
Sequence 2 MSWQTYVDDHLMCEIEGTNNHLTAAAILGVDGSVWAQSANFPQFKPDEIS

Sequence 1 AIMNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTN
           A----F-E-GTLAPTGL-LGGTKYMVIQGEAG-VIRGKKGPGG--VKKT-
Sequence 2 AVVKEFDEAGTLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTG

Sequence 1 QALIIGIYDEP----------------------
           QALI-GIYDEP----------------------
Sequence 2 QALIFGIYDEPVTPGQCNMIVERLGDYLVEQGM



Alignment 39
Sequence 1:
Sequence 2: Allergen Mus a 1.0101, Sequence: AF377948
Sequence identity: 79.82 (87/109)
Sequence 1 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
           MSWQ-YVDDHL-C-I-G--LT-AAI-G-DGS-WAQS--FPQ-KPEEI-AI
Sequence 2 MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAI

Sequence 1 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
           M-DF-EPG-LAPTGLYLGGTKYMVIQGE-GAVIRGKKG-GGVT-KKTN-A
Sequence 2 MKDFDEPGSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLA

Sequence 1 LIIGIYDEP----------------------
           LIIGIY-EP----------------------
Sequence 2 LIIGIYNEPMTPGQCNMVVERLGDYLFDQGF



Alignment 40
Sequence 1:
Sequence 2: Allergen Zea m 12.0103, Sequence: P35083
Sequence identity: 77.98 (85/109)
Sequence 1 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
           MSWQTYVD-HLMCEIEG--L-SAAI-G-DG--WAQS--FPQFKPEE-T-I
Sequence 2 MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNI

Sequence 1 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
           --DF-EPG-LAP-GL-LG-TKYMVIQGE-GAVIRGKKG-GG-TVKKT-QA
Sequence 2 IKDFDEPGFLAPIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQA

Sequence 1 LIIGIYDEP----------------------
           L-IGIYDEP----------------------
Sequence 2 LVIGIYDEPMTPGQCNMVVERLGDYLVEQGL



Alignment 41
Sequence 1:
Sequence 2: Allergen Phl p 12.0101, Sequence: CAA54686
Sequence identity: 76.15 (83/109)
Sequence 1 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
           MSWQTYVD-HLMCEIEG--L-SAAI-G-DG--WAQSA-FPQFKPEEIT-I
Sequence 2 MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGI

Sequence 1 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
           M-DF-EPG-LAPTG----G-KYMVIQGE-G-VIRGKKG-GG-T-KKT-QA
Sequence 2 MKDFDEPGHLAPTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQA

Sequence 1 LIIGIYDEP----------------------
           L--GIYDEP----------------------
Sequence 2 LVVGIYDEPMTPGQCNMVVERLGDYLVEQGM



Alignment 42
Sequence 1:
Sequence 2: Allergen Phl p 12.0101, Sequence: P35079
Sequence identity: 76.15 (83/109)
Sequence 1 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
           MSWQTYVD-HLMCEIEG--L-SAAI-G-DG--WAQSA-FPQFKPEEIT-I
Sequence 2 MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGI

Sequence 1 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
           M-DF-EPG-LAPTG----G-KYMVIQGE-G-VIRGKKG-GG-T-KKT-QA
Sequence 2 MKDFDEPGHLAPTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQA

Sequence 1 LIIGIYDEP----------------------
           L--GIYDEP----------------------
Sequence 2 LVVGIYDEPMTPGQCNMVVERLGDYLVEQGM



Alignment 43
Sequence 1:
Sequence 2: Allergen Mal d 4, Sequence: Q9XF40
Sequence identity: 77.98 (85/109)
Sequence 1 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
           MSWQ-YVDD-LMC-I-G--LT-AAI-G-DGS-WA-S--FP-FKPEEITAI
Sequence 2 MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAI

Sequence 1 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
           M-DF-EPG-LAPTGL-LGGTKYMVIQGE-GAVIRGKKG-GGVTVKKT-QA
Sequence 2 MKDFDEPGSLAPTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQA

Sequence 1 LIIGIYDEP----------------------
           L--GIY-EP----------------------
Sequence 2 LVFGIYEEPLTPGQCNMIVERLGDYLIDQGL



Alignment 44
Sequence 1:
Sequence 2: Allergen Ole e 2, Sequence: O24171
Sequence identity: 78.90 (86/109)
Sequence 1 MSWQTYVDDHLMCEIEGN---YLTSAAIIGQDGSIWAQSASFPQFKPEEI
           MSWQ-YVDDHLMC-IEG-----LT-AAI-G-DGS-WAQSA-FPQFKPEE-
Sequence 2 MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEM

Sequence 1 TAIMNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKT
           --IM-DF-EPG-LAPTGL-LGGTKYMVIQGEAGAVIRGKKG-GG-T-KKT
Sequence 2 NGIMTDFNEPGHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKT

Sequence 1 NQALIIGIYDEP----------------------
           -QAL--GIY-EP----------------------
Sequence 2 GQALVFGIYEEPVTPGQCNMVAERLGDYLLEQGL



Alignment 45
Sequence 1:
Sequence 2: Allergen Ole e 2, Sequence: O24169
Sequence identity: 78.90 (86/109)
Sequence 1 MSWQTYVDDHLMCEIEGN---YLTSAAIIGQDGSIWAQSASFPQFKPEEI
           MSWQ-YVDDHLMC-IEG-----LT-AAI-G-DGS-WAQSA-FPQFKPEE-
Sequence 2 MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEM

Sequence 1 TAIMNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKT
           --IM-DF-EPG-LAPTGL-LGGTKYMVIQGEAGAVIRGKKG-GG-T-KKT
Sequence 2 NGIMTDFNEPGHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKT

Sequence 1 NQALIIGIYDEP----------------------
           -QAL--GIY-EP----------------------
Sequence 2 GQALVFGIYEEPVTPGQCNMVVERLGDYLVEQGM



Alignment 46
Sequence 1:
Sequence 2: Allergen Ole e 2, Sequence: O24170
Sequence identity: 78.90 (86/109)
Sequence 1 MSWQTYVDDHLMCEIEGN---YLTSAAIIGQDGSIWAQSASFPQFKPEEI
           MSWQ-YVDDHLMC-IEG-----LT-AAI-G-DGS-WAQSA-FPQFKPEE-
Sequence 2 MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEM

Sequence 1 TAIMNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKT
           --IM-DF-EPG-LAPTGL-LGGTKYMVIQGEAGAVIRGKKG-GG-T-KKT
Sequence 2 NGIMTDFNEPGHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKT

Sequence 1 NQALIIGIYDEP----------------------
           -QAL--GIY-EP----------------------
Sequence 2 GQALVFGIYEEPVTPGQCNMVVERLGDYLLEQGL



Alignment 47
Sequence 1:
Sequence 2: Allergen Aca f 2, Sequence: A0A0A0RCW1
Sequence identity: 78.90 (86/109)
Sequence 1 MSWQTYVDDHLMCEIEG--NYLTSAAIIGQDGSIWAQSASFPQFKPEEIT
           M-WQTYVDDHLMCEIEG--N-L--AAI-G-DGS-WAQSASFPQFKP-EI-
Sequence 2 MCWQTYVDDHLMCEIEGTNNHLSGAAILGVDGSVWAQSASFPQFKPDEIA

Sequence 1 AIMNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTN
           A---DF--PGTLAPTGL-LGGTKYMVIQGE-G--IRGKKGPGG--VKKT-
Sequence 2 AVVKDFDGPGTLAPTGLHLGGTKYMVIQGEPGRFIRGKKGPGGICVKKTG

Sequence 1 QALIIGIYDEP----------------------
           QAL--GIYDEP----------------------
Sequence 2 QALVFGIYDEPVTPGQCNMIVERLGDYLVEQGM



Alignment 48
Sequence 1:
Sequence 2: Allergen Dau c 4, Sequence: AAL76933
Sequence identity: 78.90 (86/109)
Sequence 1 MSWQTYVDDHLMCEIEGN---YLTSAAIIGQDGSIWAQSASFPQFKPEEI
           MSWQTYVDDHLMCE--GN----L--AAIIG-DGS-WAQS--FP-FKPEEI
Sequence 2 MSWQTYVDDHLMCEVDGNPGQQLSAAAIIGHDGSVWAQSSTFPKFKPEEI

Sequence 1 TAIMNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKT
           T-IM--F-EPG-LAPTGLYLGGTKYMVIQGE--AVIRGKKG-GGVT-KKT
Sequence 2 TGIMKNFDEPGHLAPTGLYLGGTKYMVIQGEPIAVIRGKKGSGGVTIKKT

Sequence 1 NQALIIGIYDEP----------------------
           -QAL--G-YDEP----------------------
Sequence 2 GQALVFGVYDEPVTPGQCNLIVERLGDYLIEQGL



Alignment 49
Sequence 1:
Sequence 2: Allergen Api g 4, Sequence: Q9XF37
Sequence identity: 78.90 (86/109)
Sequence 1 MSWQTYVDDHLMCEIEGN---YLTSAAIIGQDGSIWAQSASFPQFKPEEI
           MSWQ-YVDDHLMCE-EGN----LT-AAIIG-DGS-WAQS--FPQ-KPEEI
Sequence 2 MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEI

Sequence 1 TAIMNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKT
           --IM-DF-EPG-LAPTGLYLGG-KYMVIQGE--AVIRGKKG-GGVT-KKT
Sequence 2 AGIMKDFDEPGHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKT

Sequence 1 NQALIIGIYDEP----------------------
           -QAL--G-YDEP----------------------
Sequence 2 GQALVFGVYDEPVTPGQCNVIVERLGDYLIDQGL



Alignment 50
Sequence 1:
Sequence 2: Allergen Phl p 12.0103, Sequence: O24282
Sequence identity: 75.23 (82/109)
Sequence 1 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
           MSWQTYVD-HLMCEIEG--L-SAAI-G-DG--WAQSA-FPQFKPEEIT-I
Sequence 2 MSWQTYVDEHLMCEIEGHHLASAAIFGHDGTVWAQSADFPQFKPEEITGI

Sequence 1 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
           M-D--EPG-LAPTG------KYMVIQGE-GAVIRGKKG-GG-T-KKT-QA
Sequence 2 MKDLDEPGHLAPTGMFVAAAKYMVIQGEPGAVIRGKKGAGGITIKKTGQA

Sequence 1 LIIGIYDEP----------------------
           L--GIYDEP----------------------
Sequence 2 LVVGIYDEPMTPGQCNMVVERLGDYLVEQGM



Alignment 51
Sequence 1:
Sequence 2: Allergen Mer a 1, Sequence: O49894
Sequence identity: 77.98 (85/109)
Sequence 1 MSWQTYVDDHLMCEIEGN--YLTSAAIIGQDGSIWAQSASFPQFKPEEIT
           MSWQTYVDDHLMC-I-G----L--A-I-G-DGSIWAQSASFPQ-KPEEIT
Sequence 2 MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEIT

Sequence 1 AIMNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTN
           -IM-DF-EPG-LAPTGLY--GTKYMVIQGE-GAVIRGKKG-GG-T-KKT-
Sequence 2 GIMKDFDEPGHLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTG

Sequence 1 QALIIGIYDEP----------------------
           QAL--GIY-EP----------------------
Sequence 2 QALVFGIYEEPVTPGQCNMVVERLGDYLIEQGM



Alignment 52
Sequence 1:
Sequence 2: Allergen Par j 3, Sequence: Q9XG85
Sequence identity: 77.98 (85/109)
Sequence 1 MSWQTYVDDHLMCEI-EGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITA
           MSWQ-YVDDHLMC----GN---SAAIIG-DGS-WAQSA-FPQ-KPEE-T-
Sequence 2 MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTG

Sequence 1 IMNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQ
           IMNDF-E-G-LAPTGL-LGGTKYMVIQGE-GAVIRGKKG-GG-T-KKT-Q
Sequence 2 IMNDFNEAGFLAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQ

Sequence 1 ALIIGIYDEP----------------------
           A--IGIYDEP----------------------
Sequence 2 AIVIGIYDEPMTPGQCNLVVERLGDYLLEQGL



Alignment 53
Sequence 1:
Sequence 2: Allergen Zea m 12.0104, Sequence: O22655
Sequence identity: 73.39 (80/109)
Sequence 1 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
           MSWQ-YVD-HLMCEIEG--L--AAI-G-DGS-WAQS-SFP--KPEE---I
Sequence 2 MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGI

Sequence 1 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
           --DF-EPGTLAPTGL--GGTKYMVIQGE-G-VIRGKKG-GG-T-KKT---
Sequence 2 IKDFDEPGTLAPTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMS

Sequence 1 LIIGIYDEP----------------------
           LIIG-YDEP----------------------
Sequence 2 LIIGVYDEPMTPGQCNMVVERLGDYLIEQGF



Alignment 54
Sequence 1:
Sequence 2: Allergen Cro s 1.0101, Sequence: Q5EF31
Sequence identity: 74.31 (81/109)
Sequence 1 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
           MSWQTYVD-HLMC---G--LTSAAI-G-DGS-WAQSA-FP--KP-EITAI
Sequence 2 MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAI

Sequence 1 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
           -NDF-EPG-LAPTG-Y--G-KYMVIQGE-G-VIRGKKG-GGVT-KK-N-A
Sequence 2 LNDFNEPGSLAPTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMA

Sequence 1 LIIGIYDEP----------------------
           LI-G-YDEP----------------------
Sequence 2 LIFGLYDEPMTPGQCNLVVERLGDYLIEQGY



Alignment 55
Sequence 1:
Sequence 2: Allergen Tri a 12.0104, Sequence: FM164277
Sequence identity: 76.15 (83/109)
Sequence 1 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
           MSW--YVDDHL-CEI-G--LTSAAI-G-DGS-WAQS--FPQFKPEEI--I
Sequence 2 MSWKAYVDDHLCCEIDGQHLTSAAILGHDGSVWAQSPNFPQFKPEEIAGI

Sequence 1 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
           --DF-EPG-LAPTGL-LGGTKYMVIQGE-G-VIRGKKG-GG-T-KKT--A
Sequence 2 VKDFEEPGHLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMA

Sequence 1 LIIGIYDEP----------------------
           LI-GIYDEP----------------------
Sequence 2 LILGIYDEPMTPGQCNLVVERLGDYLIDQGY



Alignment 56
Sequence 1:
Sequence 2: Allergen Hor v 12.0101, Sequence: P52184
Sequence identity: 75.23 (82/109)
Sequence 1 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
           MSWQTYVDDHL-CEI-G--LTSAAI-G-DG--W-QS--FPQFKPEEI--I
Sequence 2 MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGI

Sequence 1 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
           --DF-EPG-LAPTGL-LGGTKYMVIQGE-G-VIRGKKG-GG-T-KKT---
Sequence 2 IKDFDEPGHLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMP

Sequence 1 LIIGIYDEP----------------------
           LI-GIYDEP----------------------
Sequence 2 LILGIYDEPMTPGQCNLVVERLGDYLVEQGF



Alignment 57
Sequence 1:
Sequence 2: Allergen Tri a 12.0101, Sequence: P49232
Sequence identity: 75.23 (82/109)
Sequence 1 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
           MSWQTYVDDHL-CEI-G--LTSAAI-G-DGS-W--S--FP-FKPEEI--I
Sequence 2 MSWQTYVDDHLCCEIDGQHLTSAAILGHDGSVWTESPNFPKFKPEEIAGI

Sequence 1 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
           --DF-EPG-LAPTGL-LGGTKYMVIQGE-G-VIRGKKG-GG-T-KKT--A
Sequence 2 VKDFEEPGHLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMA

Sequence 1 LIIGIYDEP-----------------------------
           LI-GIYDEP-----------------------------
Sequence 2 LILGIYDEPMTPGQCNLVVERLGDYLIDQGYWVPSSNS



Alignment 58
Sequence 1:
Sequence 2: Allergen Tri a 12.0102, Sequence: P49233
Sequence identity: 75.23 (82/109)
Sequence 1 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
           MSWQ-YVDDHL-CEI-G--LTSAAI-G-DGS-WA-S--FP-FKPEEI--I
Sequence 2 MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGI

Sequence 1 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
           --DF-EPG-LAPTGL-LGGTKYMVIQGE-G-VIRGKKG-GG-T-KKT--A
Sequence 2 VKDFEEPGHLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMA

Sequence 1 LIIGIYDEP--------------------------------
           LI-GIYDEP--------------------------------
Sequence 2 LILGIYDEPMTPGQCNLVVERLGDYLIDQGYYVGSHHHHHH



Alignment 59
Sequence 1:
Sequence 2: Allergen Zea m 12.0105, Sequence: Q9FR39
Sequence identity: 71.56 (78/109)
Sequence 1 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
           MSWQ-YVDDHL-C-IEG--L--AAI-G-DGS-WAQS--FP--KPEE----
Sequence 2 MSWQAYVDDHLLCDIEGQHLSAAAIVGHDGSVWAQSENFPELKPEEVAGM

Sequence 1 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
           --DF-EPGTLAPTGL--GGTKYMVIQGE-G-VIRGKKG-GG-T-KKT---
Sequence 2 IKDFDEPGTLAPTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMS

Sequence 1 LIIGIYDEP----------------------
           LIIGIYDEP----------------------
Sequence 2 LIIGIYDEPMTPGQCNMVVERLGDYLIEQGF



Alignment 60
Sequence 1:
Sequence 2: Allergen Par j 3, Sequence: Q9T0M8
Sequence identity: 77.98 (85/109)
Sequence 1 MSWQTYVDDHLMCEI-EGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITA
           MSWQ-YVDDHLMC----GN-L-SAAIIG-DGS-WAQSA-FPQ-KPEE-T-
Sequence 2 MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTG

Sequence 1 IMNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQ
           IMNDF-E-G-LAPTGL-LGGTKYMVIQGE-GAVI-GKKG-GG-T-KKT-Q
Sequence 2 IMNDFNEGGFLAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQ

Sequence 1 ALIIGIYDEP----------------------
           A--IGIYDEP----------------------
Sequence 2 AIVIGIYDEPMTPGQCNLVVERLGDYLLEQGM



Alignment 61
Sequence 1:
Sequence 2: Allergen Bet v 2, Sequence: P25816
Sequence identity: 77.98 (85/109)
Sequence 1 MSWQTYVDDHLMCEIEG---NYLTSAAIIGQDGSIWAQSASFPQFKPEEI
           MSWQTYVD-HLMC-I-G---N-L-SA-I-G-DGS-WAQS-SFPQFKP-EI
Sequence 2 MSWQTYVDEHLMCDIDGQASNSLASA-IVGHDGSVWAQSSSFPQFKPQEI

Sequence 1 TAIMNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKT
           T-IM-DF-EPG-LAPTGL-LGG-KYMVIQGEAGAVIRGKKG-GG-T-KKT
Sequence 2 TGIMKDFEEPGHLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKT

Sequence 1 NQALIIGIYDEP----------------------
           -QAL--GIY-EP----------------------
Sequence 2 GQALVFGIYEEPVTPGQCNMVVERLGDYLIDQGL



Alignment 62
Sequence 1:
Sequence 2: Allergen Tri a 12.0103, Sequence: P49234
Sequence identity: 75.23 (82/109)
Sequence 1 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
           MSW--YVDDHL-CEI-G--LTSAAI-G-DGS-WAQS--FPQFKPEE---I
Sequence 2 MSWKAYVDDHLCCEIDGQNLTSAAILGHDGSVWAQSPNFPQFKPEENAGI

Sequence 1 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
           --DF-EPG-LAPTGL-LGGTKYMVIQGE-G-VIRGKKG-GG-T-KKT--A
Sequence 2 VKDFEEPGHLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMA

Sequence 1 LIIGIYDEP-------------------------------
           LI-GIYDEP-------------------------------
Sequence 2 LILGIYDEPMTPGQCNLVVERLGDYLIDQGYCGSHHHHHH



Alignment 63
Sequence 1:
Sequence 2: Allergen Zea m 12.0102, Sequence: P35082
Sequence identity: 73.39 (80/109)
Sequence 1 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI
           MSWQ-YVD-HLMCEIEG--L--AAI-G-DG--WAQS--FP-FK-E----I
Sequence 2 MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANI

Sequence 1 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA
           M-DF-EPG-LAPTGL-LG-TKYMVIQGE-GAVIRGKKG-GG-TVKKT-QA
Sequence 2 MKDFDEPGHLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQA

Sequence 1 LIIGIYDEP----------------------
           L--GIYDEP----------------------
Sequence 2 LVVGIYDEPMTPGQCNMVVERLGDYLLEQGM



Alignment 64
Sequence 1:
Sequence 2: Allergen Art v 4.0101, Sequence: AJ421030
Sequence identity: 75.23 (82/109)
Sequence 1 MSWQTYVDDHLMCEIEGN--YLTSAAIIGQDGSIWAQSASFPQFKPEEIT
           MSWQTYVDDHLMC-IEG----LTSAAI-G-DG--WA-SASFP-FKP-EI-
Sequence 2 MSWQTYVDDHLMCDIEGTGQHLTSAAIFGTDGTVWAKSASFPEFKPNEID

Sequence 1 AIMNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTN
           AI---F-E-G-LAPTGL-LGG-KYMVIQGEAGAVIRGKKG-GG---KKT-
Sequence 2 AIIKEFNEAGQLAPTGLFLGGAKYMVIQGEAGAVIRGKKGAGGICIKKTG

Sequence 1 QALIIGIYDEP----------------------
           QA---GIYDEP----------------------
Sequence 2 QAMVFGIYDEPVAPGQCNMVVERLGDYLLDQGM



Alignment 65
Sequence 1:
Sequence 2: Allergen Sal k 4.0201, Sequence: ADK22841
Sequence identity: 77.06 (84/109)
Sequence 1 MSWQTYVDDHLMCEIE--GNYLTSAAIIGQDGSIWAQSASFPQFKPEEIT
           MSWQ-YVD-HLMC-IE--GN-LTS-AI-G-DGSIWAQS--FPQ-KP-EI-
Sequence 2 MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIE

Sequence 1 AIMNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTN
           AI---F--P-TLAPTGL-LGG-KYMVIQGE-GAVIRGKKGPGGV--KKT-
Sequence 2 AINKEFDGPNTLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTT

Sequence 1 QALIIGIYDEP----------------------
           QALI-GIYDEP----------------------
Sequence 2 QALIFGIYDEPVAPGQCNMVVERLGDYLIEQGL



Alignment 66
Sequence 1:
Sequence 2: Allergen Art v 4.0201, Sequence: AJ421031
Sequence identity: 72.48 (79/109)
Sequence 1 MSWQTYVDDHLMCEIEGN--YLTSAAIIGQDGSIWAQSASFPQFKPEEIT
           MSWQTYVDDHLMC-IEG----LT-AAI-G-DG--WA-S--FP-FKPEE--
Sequence 2 MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMK

Sequence 1 AIMNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTN
           -I-N-F-E-GTLAPTGL-LGG-KYMV-QGEAGAVIRGKKG-GG---KKT-
Sequence 2 GIINEFNEVGTLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTG

Sequence 1 QALIIGIYDEP----------------------
           QA---GIYDEP----------------------
Sequence 2 QAMVMGIYDEPVAPGQCNMIVERLGDYLVDQNM



Alignment 67
Sequence 1:
Sequence 2: Allergen Can s 2.0101, Sequence: XP030492464
Sequence identity: 77.98 (85/109)
Sequence 1 MSWQTYVDDHLMCEIEGN--YLTSAAIIGQDGSIWAQSASFPQFKPEEIT
           MSWQTYVD-HLMC-I-G----LT-AAIIG-DGSIWAQS-SFPQ-K--EIT
Sequence 2 MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEIT

Sequence 1 AIMNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTN
           -I--DF-EPG-LAPTGL-L-GTKYMVIQGE-GAVIRGKKG-GGVT-KKT-
Sequence 2 DITKDFEEPGHLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTG

Sequence 1 QALIIGIYDEP----------------------
           QALI-GIY-EP----------------------
Sequence 2 QALIFGIYEEPVTPGQCNMVVERLGDYLVDQGL



Alignment 68
Sequence 1:
Sequence 2: Allergen Hel a 2, Sequence: O81982
Sequence identity: 70.64 (77/109)
Sequence 1 MSWQTYVDDHLMCEIEGN--YLTSAAIIGQDGSIWAQSASFPQFKPEEIT
           MSWQ-YVD-HLMC-IEG----LTSAAI-G-DG--WAQSA-FPQFKPEE--
Sequence 2 MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMK

Sequence 1 AIMNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTN
           -I---F-E-GTLAPTG----G-KYMV-QGE-GAVIRGKKG-GG---KKT-
Sequence 2 GIIKEFDEAGTLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTG

Sequence 1 QALIIGIYDEP----------------------
           QA-I-GIYDEP----------------------
Sequence 2 QAMIMGIYDEPVAPGQCNMVVERLGDYLLEQGM


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.