The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Asp v 13.0101

Sequence 294441150

Full FASTA alignment

Sequence name:
Query sequence:
MYSIKRTILLLGALLPAVFGAPILEARRQTEKVPGKYIVTFKSGLQAEQI
DAHTTWASNVHKRNLERRDLTDRDLYPGIEKNFKIHKFAAYVGSFDDATI
EEIRNHKDVAHVEEDQVWYLDALTTQSDAPWGLGAISHQGDASSDYIYDT
SAGADTYAYVVDTGINVDHSEFDGRASLAYNAAGGQHVDSVGHGTHVAGT
IGGKTFGVSKKANLLSVKVFEGESSSTSIILDGYNWAANDIVSKSRTGKS
AINLSLGGGYSYAFSNAVESAFDEGVLSVVAAGNENVDASNTSPASAPNA
LTVAASTERNARASFSNYGEVVDIFAPGEDILSAWIGGNSATNTISGTSM
ATPHIVGLSLYLIALEGLSSPGDVTSRIKELATQGALSGVSGSPNALAYN
GAE

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Asp v 13.0101ADE74975Go!403530.74.6e-152
2Asp f 13P28296Go!403423.86.9e-120
3Asp o 13CAA35594Go!403408.13.8e-115
4Asp fl proteaseAAD47202Go!403407.17.7e-115
5Pen c 13.0101AAD25926Go!397206.41.9e-54
6Pen ch 13AAF23726Go!397205.82.9e-54
7Tri r 2.0101AAD52013Go!412168.17.0e-43
8Pen ch 18AAF71379Go!494152.15.2e-38
9Rho m 2.0101Q32ZM1Go!342148.44.8e-37
10Cur l 4.0101ACF19589Go!506103.91.8e-23
11Alt a 15.0101A0A0F6N3V8Go!507102.25.6e-23
12Cla c 9.0101ABQ59329Go!38899.82.4e-22
13Pen o 18AAG44478Go!50398.48.0e-22
14Cla h 9.0101AAX14379Go!51897.41.6e-21
15Asp f 18.0101Y13338Go!49594.89.8e-21
16Fus p 9.0101A0A0U1Y1N5Go!38691.38.6e-20
17Cuc m 1BAA06905Go!73141.51.5e-04

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Asp v 13.0101, Sequence: ADE74975
Sequence identity: 100.00 (403/403)
Sequence 1 MYSIKRTILLLGALLPAVFGAPILEARRQTEKVPGKYIVTFKSGLQAEQI
           MYSIKRTILLLGALLPAVFGAPILEARRQTEKVPGKYIVTFKSGLQAEQI
Sequence 2 MYSIKRTILLLGALLPAVFGAPILEARRQTEKVPGKYIVTFKSGLQAEQI

Sequence 1 DAHTTWASNVHKRNLERRDLTDRDLYPGIEKNFKIHKFAAYVGSFDDATI
           DAHTTWASNVHKRNLERRDLTDRDLYPGIEKNFKIHKFAAYVGSFDDATI
Sequence 2 DAHTTWASNVHKRNLERRDLTDRDLYPGIEKNFKIHKFAAYVGSFDDATI

Sequence 1 EEIRNHKDVAHVEEDQVWYLDALTTQSDAPWGLGAISHQGDASSDYIYDT
           EEIRNHKDVAHVEEDQVWYLDALTTQSDAPWGLGAISHQGDASSDYIYDT
Sequence 2 EEIRNHKDVAHVEEDQVWYLDALTTQSDAPWGLGAISHQGDASSDYIYDT

Sequence 1 SAGADTYAYVVDTGINVDHSEFDGRASLAYNAAGGQHVDSVGHGTHVAGT
           SAGADTYAYVVDTGINVDHSEFDGRASLAYNAAGGQHVDSVGHGTHVAGT
Sequence 2 SAGADTYAYVVDTGINVDHSEFDGRASLAYNAAGGQHVDSVGHGTHVAGT

Sequence 1 IGGKTFGVSKKANLLSVKVFEGESSSTSIILDGYNWAANDIVSKSRTGKS
           IGGKTFGVSKKANLLSVKVFEGESSSTSIILDGYNWAANDIVSKSRTGKS
Sequence 2 IGGKTFGVSKKANLLSVKVFEGESSSTSIILDGYNWAANDIVSKSRTGKS

Sequence 1 AINLSLGGGYSYAFSNAVESAFDEGVLSVVAAGNENVDASNTSPASAPNA
           AINLSLGGGYSYAFSNAVESAFDEGVLSVVAAGNENVDASNTSPASAPNA
Sequence 2 AINLSLGGGYSYAFSNAVESAFDEGVLSVVAAGNENVDASNTSPASAPNA

Sequence 1 LTVAASTERNARASFSNYGEVVDIFAPGEDILSAWIGGNSATNTISGTSM
           LTVAASTERNARASFSNYGEVVDIFAPGEDILSAWIGGNSATNTISGTSM
Sequence 2 LTVAASTERNARASFSNYGEVVDIFAPGEDILSAWIGGNSATNTISGTSM

Sequence 1 ATPHIVGLSLYLIALEGLSSPGDVTSRIKELATQGALSGVSGSPNALAYN
           ATPHIVGLSLYLIALEGLSSPGDVTSRIKELATQGALSGVSGSPNALAYN
Sequence 2 ATPHIVGLSLYLIALEGLSSPGDVTSRIKELATQGALSGVSGSPNALAYN

Sequence 1 GAE
           GAE
Sequence 2 GAE



Alignment 2
Sequence 1:
Sequence 2: Allergen Asp f 13, Sequence: P28296
Sequence identity: 77.42 (312/403)
Sequence 1 MYSIKRTILLLGALLPAVFGAPILEARRQTEKVPGKYIVTFKSGLQAEQI
           M-SIKRT-LLLGA-LPAVFGAP--E-RR---K-PGKYIVTFK-G-----I
Sequence 2 MLSIKRTLLLLGAVLPAVFGAPVQETRRAAQKIPGKYIVTFKPGTDTATI

Sequence 1 DAHTTWASNVHKRNLERRDLTDRDLYPGIEKNFKIHKFAAYVGSFDDATI
           --HT-WA---HKRNLERRD-T------GIEK--KI--FAAY-GSFDDATI
Sequence 2 ESHTLWATDLHKRNLERRDTTSGEPPVGIEKSYKIKDFAAYAGSFDDATI

Sequence 1 EEIRNHKDVAHVEEDQVWYLDALTTQSDAPWGLGAISHQGDASSDYIYDT
           EEIR---DVAHVEEDQ-WYLDALTTQ--APWGLG-ISH-G-AS-DYIYDT
Sequence 2 EEIRKRGDVAHVEEDQIWYLDALTTQKGAPWGLGSISHKGQASTDYIYDT

Sequence 1 SAGADTYAYVVDTGINVDHSEFDGRASLAYNAAGGQHVDSVGHGTHVAGT
           SAGA-TYAYVVD-GINV-H-EF--RASLAYNAAGG-HVDS-GHGTHVAGT
Sequence 2 SAGAGTYAYVVDSGINVNHVEFESRASLAYNAAGGSHVDSIGHGTHVAGT

Sequence 1 IGGKTFGVSKKANLLSVKVFEGESSSTSIILDGYNWAANDIVSKSRTGKS
           IGGKT-GV-KK-NLLSVKVF-GESSSTSIILDG-NWA-NDIVSK-RT-K-
Sequence 2 IGGKTYGVAKKTNLLSVKVFQGESSSTSIILDGFNWAVNDIVSKGRTKKA

Sequence 1 AINLSLGGGYSYAFSNAVESAFDEGVLSVVAAGNENVDASNTSPASAPNA
           AIN-SLGGGYSYAF-NAVE-AFDEGVLSVVAAGNEN-DASNTSPASAPNA
Sequence 2 AINMSLGGGYSYAFNNAVENAFDEGVLSVVAAGNENSDASNTSPASAPNA

Sequence 1 LTVAASTERNARASFSNYGEVVDIFAPGEDILSAWIGGNSATNTISGTSM
           LTVAA----NARASFSNYG-VVDIFAPG-DILSAWIG---ATNTISGTSM
Sequence 2 LTVAAINKSNARASFSNYGSVVDIFAPGQDILSAWIGSTTATNTISGTSM

Sequence 1 ATPHIVGLSLYLIALEGLSSPGDVTSRIKELATQGALSGVSGSPNALAYN
           ATPHIVGLS-YL--LE-LS-P--VT-RIKELAT-G----V-GSPN-LAYN
Sequence 2 ATPHIVGLSVYLMGLENLSGPAAVTARIKELATNGVVTNVKGSPNKLAYN

Sequence 1 GAE
           G--
Sequence 2 GNA



Alignment 3
Sequence 1:
Sequence 2: Allergen Asp o 13, Sequence: CAA35594
Sequence identity: 73.45 (296/403)
Sequence 1 MYSIKRTILLLGALLPAVFGAPILEARRQTEKVPGKYIVTFKSGLQAEQI
           M-SIKRT-LLLGA-LPAV-GAP--E-RR--EK-PGKYIVTFK-G-----I
Sequence 2 MQSIKRTLLLLGAILPAVLGAPVQETRRAAEKLPGKYIVTFKPGIDEAKI

Sequence 1 DAHTTWASNVHKRNLERRDLTDRDLYPGIEKNFKIHKFAAYVGSFDDATI
           --HTTWA-N-H-R-LERR--T--DL--GIE-N-KI-KFAAY-GSFDDATI
Sequence 2 QEHTTWATNIHQRSLERRGATGGDLPVGIERNYKINKFAAYAGSFDDATI

Sequence 1 EEIRNHKDVAHVEEDQVWYLDALTTQSDAPWGLGAISHQGDASSDYIYDT
           EEIR---DVA-VEEDQ--YLD-LTTQ--APWGLG-ISH-G--S-DYIYDT
Sequence 2 EEIRKNEDVAYVEEDQIYYLDGLTTQKSAPWGLGSISHKGQQSTDYIYDT

Sequence 1 SAGADTYAYVVDTGINVDHSEFDGRASLAYNAAGGQHVDSVGHGTHVAGT
           SAG--TYAYVVD-G-NVDH-EF-GRAS-AYNAAGGQHVDS-GHGTHV-GT
Sequence 2 SAGEGTYAYVVDSGVNVDHEEFEGRASKAYNAAGGQHVDSIGHGTHVSGT

Sequence 1 IGGKTFGVSKKANLLSVKVFEGESSSTSIILDGYNWAANDIVSKSRTGKS
           I-GKT-G--KKA--LSVKVF-GESSSTS-ILDG-NWAANDIVSK-RT-K-
Sequence 2 IAGKTYGIAKKASILSVKVFQGESSSTSVILDGFNWAANDIVSKKRTSKA

Sequence 1 AINLSLGGGYSYAFSNAVESAFDEGVLSVVAAGNENVDASNTSPASAPNA
           AIN-SLGGGYS-AF--AVE-AF--GVLSVVAAGNEN-DA--TSPASAP-A
Sequence 2 AINMSLGGGYSKAFNDAVENAFEQGVLSVVAAGNENSDAGQTSPASAPDA

Sequence 1 LTVAASTERNARASFSNYGEVVDIFAPGEDILSAWIGGNSATNTISGTSM
           -TVAA----N-RASFSN-G-VVD-FAPG-DILSAWIG--SATNTISGTSM
Sequence 2 ITVAAIQKSNNRASFSNFGKVVDVFAPGQDILSAWIGSSSATNTISGTSM

Sequence 1 ATPHIVGLSLYLIALEGLSSPGDVTSRIKELATQGALSGVSGSPNALAYN
           ATPHIVGLSLYL-ALE-L--P--VT-RIKELAT------V-GSPN-LAYN
Sequence 2 ATPHIVGLSLYLAALENLDGPAAVTKRIKELATKDVVKDVKGSPNLLAYN

Sequence 1 GAE
           G--
Sequence 2 GNA



Alignment 4
Sequence 1:
Sequence 2: Allergen Asp fl protease, Sequence: AAD47202
Sequence identity: 73.20 (295/403)
Sequence 1 MYSIKRTILLLGALLPAVFGAPILEARRQTEKVPGKYIVTFKSGLQAEQI
           M-SIKRT-LLLGA-LPAV-GAP--E-RR--EK-PGKYIVTFK-G-----I
Sequence 2 MQSIKRTLLLLGAILPAVLGAPVQETRRAAEKLPGKYIVTFKPGIDEAKI

Sequence 1 DAHTTWASNVHKRNLERRDLTDRDLYPGIEKNFKIHKFAAYVGSFDDATI
           --HTTWA-N-H-R-LERR--T--DL--GIE-N-KI-KFAAY-GSFDDATI
Sequence 2 QEHTTWATNIHQRSLERRGATGGDLPVGIERNYKINKFAAYAGSFDDATI

Sequence 1 EEIRNHKDVAHVEEDQVWYLDALTTQSDAPWGLGAISHQGDASSDYIYDT
           EEIR---DVA-VEEDQ--YLD-LTTQ--APWGLG-ISH-G--S-DYIYDT
Sequence 2 EEIRKNEDVAYVEEDQIYYLDGLTTQKSAPWGLGSISHKGQQSTDYIYDT

Sequence 1 SAGADTYAYVVDTGINVDHSEFDGRASLAYNAAGGQHVDSVGHGTHVAGT
           SAG--TYAYVVD-G-NVDH-EF-GRAS-AYNAAGGQHVDS-GHGTHV-GT
Sequence 2 SAGEGTYAYVVDSGVNVDHEEFEGRASKAYNAAGGQHVDSIGHGTHVSGT

Sequence 1 IGGKTFGVSKKANLLSVKVFEGESSSTSIILDGYNWAANDIVSKSRTGKS
           I-GKT-G--KKA--LSVKVF-GESSSTS-ILDG-NWAANDIVSK-RT-K-
Sequence 2 IAGKTYGIAKKASILSVKVFQGESSSTSVILDGFNWAANDIVSKKRTSKA

Sequence 1 AINLSLGGGYSYAFSNAVESAFDEGVLSVVAAGNENVDASNTSPASAPNA
           AIN-SLGGGYS-AF--AVE-AF--GVLSVVAAGNEN-DA--TSPASAP-A
Sequence 2 AINMSLGGGYSKAFNDAVENAFEQGVLSVVAAGNENSDAGQTSPASAPDA

Sequence 1 LTVAASTERNARASFSNYGEVVDIFAPGEDILSAWIGGNSATNTISGTSM
           -TVAA----N-RASFSN-G-VVD-FAPG-DILSAWIG--SATNTISGTSM
Sequence 2 ITVAAIQKSNNRASFSNFGKVVDVFAPGQDILSAWIGSSSATNTISGTSM

Sequence 1 ATPHIVGLSLYLIALEGLSSPGDVTSRIKELATQGALSGVSGSPNALAYN
           ATPHIVGLSLYL-ALE-L--P--VT-RI-ELAT------V-GSPN-LAYN
Sequence 2 ATPHIVGLSLYLAALENLDGPAAVTKRIEELATKDVVKDVKGSPNLLAYN

Sequence 1 GAE
           G--
Sequence 2 GNA



Alignment 5
Sequence 1:
Sequence 2: Allergen Pen c 13.0101, Sequence: AAD25926
Sequence identity: 40.20 (162/403)
Sequence 1 MYSIKRTILLLGALLPAVFGAPILEARRQTEKVPGKYIVTFKSGLQAEQI
           ------------A-L--V-----L-A-------P--YIV-----------
Sequence 2 -MGFLKVLATSLATLAVVDAGTLLTASNTDAVIPSSYIVVMNDDVSTAEF

Sequence 1 DAHTTWASNVHKRNLERRDLTDRDLYPGIEKNFKIHKFAAYVGSFDDATI
           --H--WA-NVH-R-L-RR--------PG--K-F-I-----Y--SFD--T-
Sequence 2 NTHREWATNVHAR-LSRRK--NGETGPG--KHFEINGLKGYTASFDESTA

Sequence 1 EEIRNHKDVAHVEEDQVWYLDALTTQSDAP-WGLGAISHQGDASSDYIYD
           --I-N---V---E-D------A---QS--P-WGL--IS--------Y-YD
Sequence 2 KDIANDPAVKYIEPDMIVNATANVVQSNVPSWGLARISSKRTGTTSYTYD

Sequence 1 TSAGADTYAYVVDTGINVDHSEFDGRASLAYNAAGGQHVDSVGHGTHVAG
           --AG-----Y-VDTGI---HS-F-GRA----N-------D--GHGTH-A-
Sequence 2 STAGEGVVFYGVDTGIDISHSDFGGRAKWGTNVVDNDNTDGNGHGTHTAS

Sequence 1 TIGGKTFGVSKKANLLSVKVFEGESSST-SIILDGYNWAANDIVSKSRTG
           T--G---GV-KKA-L--VKV-----S-T-S----G--WA--D--S----G
Sequence 2 TAAGSKYGVAKKATLVAVKVLGADGSGTNSGVISGMDWAVKDAKSRGANG

Sequence 1 KSAINLSLGGGYSYAFSNAVESAFDEGVLSVVAAGNENVDASNTSPASAP
           K---N-SLGG--S-A---A-------G----VAAGNE---ASN-SPASA-
Sequence 2 KYVMNMSLGGEFSKAVNDAAANVVKSGIFLSVAAGNEAENASNSSPASAA

Sequence 1 NALTVAASTERNARASFSNYGEVVDIFAPGEDILSAWIGGNSATNTISGT
           ---T-AAST-----ASF-N-G-VVD--APG--I--A--GG-S---T-SGT
Sequence 2 EVCTIAASTSTDGSASFTNFGSVVDLYAPGQSITAAYPGGGS--KTLSGT

Sequence 1 SMATPHIVGLSLYLIALEGLSSPGDVTSRIKELATQGALSGVSGSPNALA
           SMA-PH--G---YL-ALEG-S--G----RI--LAT-------SG----L-
Sequence 2 SMAAPHVAGVAAYLMALEGVSA-GNACARIVQLATSSISRAPSGTTSKLL

Sequence 1 YNGAE-
           YNG---
Sequence 2 YNGINV



Alignment 6
Sequence 1:
Sequence 2: Allergen Pen ch 13, Sequence: AAF23726
Sequence identity: 40.45 (163/403)
Sequence 1 MYSIKRTILLLGALLPAVFGAPILEARRQTEKVPGKYIVTFKSGLQAEQI
           ------------A-L--V-----L-A-------P--YIV-----------
Sequence 2 -MGFLKVLATSLATLAVVDAGTLLTASNTDAVIPSSYIVVMNDDVSTAEF

Sequence 1 DAHTTWASNVHKRNLERRDLTDRDLYPGIEKNFKIHKFAAYVGSFDDATI
           --H--WA-NVH-R-L-RR--------PG--K-F-I-----Y--SFD--T-
Sequence 2 STHREWATNVHAR-LSRRK--NGETGPG--KHFEINGLKGYTASFDENTA

Sequence 1 EEIRNHKDVAHVEEDQVWYLDALTTQSDAP-WGLGAISHQGDASSDYIYD
           --I-N---V---E-D------A---QS--P-WGL--IS--------Y-YD
Sequence 2 KDIANDPAVKYIEPDMIVNATANVVQSNVPSWGLARISSKRTGTTSYTYD

Sequence 1 TSAGADTYAYVVDTGINVDHSEFDGRASLAYNAAGGQHVDSVGHGTHVAG
           --AG-----Y-VDTGI---HS-F-GRA----N-------D--GHGTH-A-
Sequence 2 STAGEGVVFYGVDTGIDISHSDFGGRAKWGTNVVDNDNTDGNGHGTHTAS

Sequence 1 TIGGKTFGVSKKANLLSVKVFEGESSST-SIILDGYNWAANDIVSKSRTG
           T--G---GV-KKA-L--VKV-----S-T-S----G--WA--D--S----G
Sequence 2 TAAGSKYGVAKKATLVAVKVLGADGSGTNSGVISGMDWAVKDAKSRGANG

Sequence 1 KSAINLSLGGGYSYAFSNAVESAFDEGVLSVVAAGNENVDASNTSPASAP
           K---N-SLGG--S-A---A-------G----VAAGNE---ASN-SPASA-
Sequence 2 KYVMNTSLGGEFSKAVNDAAANVVKSGIFLSVAAGNEAENASNSSPASAA

Sequence 1 NALTVAASTERNARASFSNYGEVVDIFAPGEDILSAWIGGNSATNTISGT
           -A-T-AAST-----ASF-N-G-VVD--APG--I--A--GG-S---T-SGT
Sequence 2 EACTIAASTSTDGSASFTNFGSVVDLYAPGQSITAAYPGGGS--KTLSGT

Sequence 1 SMATPHIVGLSLYLIALEGLSSPGDVTSRIKELATQGALSGVSGSPNALA
           SMA-PH--G---YL-ALEG-S--G----RI--LAT-------SG----L-
Sequence 2 SMAAPHVAGVAAYLMALEGVSA-GNACARIVQLATSSISRAPSGTTSKLL

Sequence 1 YNGAE-
           YNG---
Sequence 2 YNGINV



Alignment 7
Sequence 1:
Sequence 2: Allergen Tri r 2.0101, Sequence: AAD52013
Sequence identity: 42.93 (173/403)
Sequence 1 MYSIKRTILLLGALLPAVFGAPILEARRQTEKVPGKYIVTFKSGLQAEQI
           M--I---I----A-L--V-GA-ILEA----E--P-KYIV--K-----E--
Sequence 2 MGFITKAIPIVLAALSTVNGARILEAGPHAEAIPNKYIVVMKREVSDEAF

Sequence 1 DAHTTWASNVHKRNLERRDLTDRDLYPGIEKNFKIHK-FAAYVGSFDDAT
           -AHTTW-S--------RR---------G----------F-AY-G-FDDA-
Sequence 2 NAHTTWLSQSLNSRIMRRAGSSKPM-AGMQDKYSLGGIFRAYSGEFDDAM

Sequence 1 IEEIRNHKDVAHVEEDQVWYLDA----LTTQSDAP-WGLGAISHQGDASS
           I--I--H-DV---E-D-V---------LT-Q---P-WGL-----------
Sequence 2 IKDISSHDDVDFIEPDFVVRTTTNGTNLTHQDNVPSWGLARVGSKKPGGT

Sequence 1 DYIYDTSAGADTYAYVVDTGINVDHSEFDGRASLAYNAAGGQHVDSVGHG
           -Y-YD-SAG----AY--DTGI--DH--F-GRA----N----Q--D--GHG
Sequence 2 TYYYDPSAGKGVTAYIIDTGIDIDHEDFQGRAKWGENFVDQQNTDCNGHG

Sequence 1 THVAGTIGGKTFGVSKKANLLSVKVFEGESS-STSIILDGYNWAANDIV-
           THVAGT-GG---G--K---L--VKV-----S-S-S----G--WA------
Sequence 2 THVAGTVGGTKYGLAKGVSLVAVKVLDCDGSGSNSGVIKGMEWAMRQASG

Sequence 1 ----SKSRTGKSAINLSLGGGYSYAFSNAVESAFDEGVLSVVAAGNENVD
           ---------GKS--N-SLGG--S-A---A-----D-G----VAAGNEN-D
Sequence 2 GGNGTAKAAGKSVMNMSLGGPRSEASNQAAKAISDAGIFMAVAAGNENMD

Sequence 1 ASNTSPASAPNALTVAASTERNARASFSNYGEVVDIFAPGEDILSAWIGG
           A---SPAS-P---TVAAST-----A-FSNYG-VVD--APG-DI-S---GG
Sequence 2 AQHSSPASEPSVCTVAASTKDDGKADFSNYGAVVDVYAPGKDITSLKPGG

Sequence 1 NSATNTISGTSMATPHIVGLSLYLIALEGLSSPGDVTSRIKELATQGALS
           ---T-T-SGTSMA-PH--GL--YLI-L-----PG-----IK--A-----S
Sequence 2 S--TDTLSGTSMASPHVCGLGAYLIGLGKQGGPG-LCDTIKKMANDVIQS

Sequence 1 GVSGSPNALAYNGAE-
           ---G----L-YNG---
Sequence 2 PGEGTTGKLIYNGSGK



Alignment 8
Sequence 1:
Sequence 2: Allergen Pen ch 18, Sequence: AAF71379
Sequence identity: 43.18 (174/403)
Sequence 1 --------MYSIKRTILLLGALLPAVFGAPILEARRQTEKVPGKYIVTFK
           ----------------------------APIL---------P--YIV-FK
Sequence 2 MKGFLSLTLLPLLVAASPVAVNSIHNDAAPILSSMT-SKDIPDSYIVVFK

Sequence 1 SGLQAEQIDAHTTWASNVHKRNLERRDLTDRDLYP-------GIEKNFKI
           ---------AH--W---VH-----R--L--R-L---------G----F-I
Sequence 2 KHVDPSSASAHQSWLQEVHTAHTGRMELKKRSLFGFDFEAFMGLKHTFHI

Sequence 1 H-KFAAYVGSFDDATIEEIRNHKDVAHVEED-QVWYLDALTTQSDAPWGL
           ------Y-G-F----IE-IR-H-DV---E-D--V-----------APWGL
Sequence 2 AGSLLGYAGHFHEDVIEQIRRHPDVDYIEKDSEVRTMSEGSVEKNAPWGL

Sequence 1 GAISHQGDAS----SDYIYDTSAGADTYAYVVDTGINVDHSEFDGRASLA
           --ISH----S------Y-Y----G----AYV-DTG-NV-H--F-GRA---
Sequence 2 ARISHRESLSFGNFNKYLYAEEGGEGVDAYVIDTGANVKHVDFEGRANWG

Sequence 1 YNAA-GGQHVDSVGHGTHVAGTIGGKTFGVSKKANLLSVKVFEGESSST-
           -----G----D--GHGTH--GTI-GK-FGV-KKAN---VKV-----S-T-
Sequence 2 KTIPQGDADEDGNGHGTHCSGTIAGKKFGVAKKANVYAVKVLRSNGSGTM

Sequence 1 SIILDGYNWAANDIVSKSRTGK-----SAINLSLGGGYSYAFSNAVESAF
           S----G--WAA-----KS--G------S--N-SLGGG-S-----AV--A-
Sequence 2 SDVVKGVEWAAEAHIKKSKKGDKKFKGSVANMSLGGGSSRTLDLAVNAAV

Sequence 1 DEGVLSVVAAGNENVDASNTSPASAPNALTVAASTERNARASFSNYGEVV
           D-G----VAAGN-N-DA-N-SPA-A--A-TV-AST----RA-FSNYG---
Sequence 2 DAGIHFAVAAGNDNADACNYSPAAAEKAITVGASTLADERAYFSNYGKCT

Sequence 1 DIFAPGEDILSAWIGGNSATNTISGTSMATPHIVGLSLYLIAL----EGL
           DIFAPG--ILS-W-G---ATNTISGTSMA-PHI-GL--Y---L-------
Sequence 2 DIFAPGLNILSTWVGSDHATNTISGTSMASPHIAGLLAYYVSLAPAKDSA

Sequence 1 SSPGDVTSR-----IKELATQGALSGV-SGSPNALAYNGAE---------
           ----DVT-----------AT-G-L----S--PN-LA-NG-----------
Sequence 2 YAVADVTPKQLKAALISVATEGTLTDIPSDTPNLLAWNGGGSANYTKILA

Sequence 1 ---------------------------------------------
           ---------------------------------------------
Sequence 2 DGGYKAHNAETTVEDRIGIIIDSAEKAFHKELGAIYSEIKDAVSV



Alignment 9
Sequence 1:
Sequence 2: Allergen Rho m 2.0101, Sequence: Q32ZM1
Sequence identity: 34.74 (140/403)
Sequence 1 MYSIKRTILLLGALLPAVFGAPILEARRQTEKVPGKYIVTFKSGLQAEQI
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 DAHTTWASNVHKRNLERRDLTDRDLYPGIEKNFKIHKFAAYVGSFDDATI
           -------------------------------------------------I
Sequence 2 -----------------------------------------TMELLEDLI

Sequence 1 EEIRNHKDVAHVEEDQVWYLDALTTQSDAPWGLGAISHQGDAS----SDY
           E--R----V---E----------T----APWGL--ISH----S------Y
Sequence 2 EQVRQLPMVNFIEKNSLVHANEFTVAKGAPWGLARISHRDPLSLGSFDQY

Sequence 1 IYDTSAGADTYAYVVDTGINVDHSEFDGRASLAYNAA-GGQHVDSVGHGT
           -YD---G-----YV-DTG-NV-H--F-GRA--------G----D--GHGT
Sequence 2 LYDSNGGTGVTSYVIDTGVNVHHEQFEGRAKWGKTIPQGDEDEDGNGHGT

Sequence 1 HVAGTIGGKTFGVSKKANLLSVKVFEGESS-STSIILDGYNWAAN---DI
           H-AGTIG----GV-K-A----VKV-----S-S-S----G---A-----D-
Sequence 2 HCAGTIGSNAYGVAKNAEIVAVKVLRSNGSGSMSDVIKGVEFAVKSHQDS

Sequence 1 VSKSRTGKSAINLSLGGGYSYAFSNAVESAFDEGVLSVVAAGNENVDASN
           V-K-----S--N-SLGGG-S-A---AV--A---G----VAAGNEN-DA-N
Sequence 2 VKKGKNSFSTANMSLGGGKSPALDLAVNAAVKAGLHFAVAAGNENQDACN

Sequence 1 TSPASAPNALTVAASTERNARASFSNYGEVVDIFAPGEDILSAWIGGNSA
           TSPASA-NA-TV-AST---ARA-FSNYG--VDIFAPG--ILS--IG---A
Sequence 2 TSPASAENAITVGASTISDARAYFSNYGKCVDIFAPGLNILSTYIGSDAA

Sequence 1 TNTISGTSMATPHIVGLSLYLIALEGLS-----------SPGDVTSRIKE
           T---SGTSMA-PHI-GL--Y---L---S------------P---------
Sequence 2 TAYLSGTSMASPHIAGLLTYYLSLQPSSDSEFFIGAEGITPAQLKKNLIA

Sequence 1 LATQGALSGV-SGSPNALAYNGAE---------
           --T---L-------PN-LA-NGA----------
Sequence 2 FGTPDVLADIPADTPNILAFNGAGQNLTKFWGH



Alignment 10
Sequence 1:
Sequence 2: Allergen Cur l 4.0101, Sequence: ACF19589
Sequence identity: 43.67 (176/403)
Sequence 1 --------MYSIKRTILLLGALLPAVFGAPILEARRQTEKVPGKYIVTFK
           ----------------------------AP-L------E-VP--Y-V-FK
Sequence 2 MKYSLIAALPALAAASPTFSTETIHKQSAPVLSSTSAKE-VPNSYMVVFK

Sequence 1 SGLQAEQIDAHTTWASNVHKRNL-ERRDLTDR--DL------YPGIEKNF
           ----------H--W---VH--N--ER--L--R--DL--------G-----
Sequence 2 K--HVKDASKHHDWVQSVHSKNTQERMELRKRSSDLPVSNEVFAGLKHTY

Sequence 1 KIHKFAAYVGSFDDATIEEIRNHKDVAHVEED-QVWYL--DALTTQSDAP
           -------Y-G-FDD-T-E-IRNH-DV---E-D--V--L--D---T----P
Sequence 2 ELSGLKGYSGHFDDETLEAIRNHPDVDYIERDSEVRILGGDEPETENNSP

Sequence 1 WGLGAISHQGDAS----SDYIYDTSAGADTYAYVVDTGINVDHSEFDGRA
           WGL--ISH----S------Y-Y----G-----YV-DTG-NVDH--F-GRA
Sequence 2 WGLARISHRDSLSFGTWNKYLYAADGGEGVDVYVIDTGTNVDHVDFEGRA

Sequence 1 SLAYNAAGGQ-HVDSVGHGTHVAGTIGGKTFGVSKKANLLSVKVFEGESS
           --------G----D--GHGTH--GT--GK--GV-KKA----VKV-----S
Sequence 2 KWGKTIPNGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVYAVKVLRSNGS

Sequence 1 ST-SIILDGYNWAA---NDIVSKSRTGK------SAINLSLGGGYSYAFS
           -T-S----G---AA------VS----GK------S--N-SLGGG-S----
Sequence 2 GTMSDVVKGVEFAAKSHSEAVSAAKNGKKKGFKGSTANMSLGGGKSTTLD

Sequence 1 NAVESAFDEGVLSVVAAGNENVDASNTSPASAPNALTVAASTERNARASF
           -AV--A-D-G----VAAGN-N-D--N-SPA-A-NA-TV-AST----RA-F
Sequence 2 MAVNAAVDAGLHFAVAAGNDNADSCNYSPAAAENAVTVGASTLLDERAYF

Sequence 1 SNYGEVVDIFAPGEDILSAWIGGNSATNTISGTSMATPHIVGLSLYLIAL
           SNYG---DIFAPG--ILS-WIG---ATNTISGTSMA-PHI-GL--Y---L
Sequence 2 SNYGKCNDIFAPGLNILSTWIGSKHATNTISGTSMASPHIAGLLAYMLSL

Sequence 1 EGLS---------SPGDVTSRIKELATQGALSGV-SGSPNALAYNGAE--
           --------------P-----------T-GALS-V-S---N-LA-NG----
Sequence 2 QPAKDSAYAVADITPKKLKANLIAIGTVGALSDVPSNTANVLAWNGGGSS

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 NYTDIIEKGGYTVKKAASKEEEKESEFRITIPSLSELEDDFEKAKESAGR

Sequence 1 ---------
           ---------
Sequence 2 KAHHVGGKL



Alignment 11
Sequence 1:
Sequence 2: Allergen Alt a 15.0101, Sequence: A0A0F6N3V8
Sequence identity: 42.18 (170/403)
Sequence 1 MYSIKRTILLLGALLPAVFGAPILEARRQTEKVPGKYIVTFKSGLQAEQI
           --------------------------------VP--Y-V-FK--------
Sequence 2 ----------------------PQRQMDSAKEVPNSYMVVFKK--HVKDA

Sequence 1 DAHTTWASNVH-KRNLERRDLTDR--------DLYPGIEKNFKIHKFAAY
           --H--W---VH-K-N-ER--L--R------------G------------Y
Sequence 2 SKHHDWVQSVHSKNNEERMELRKRSSQFPVTTEVFDGLKHVYEMAGMKGY

Sequence 1 VGSFDDATIEEIRNHKDVAHVEED-QVWYL--DALTTQSDAPWGLGAISH
           -G-FDD-TIE-IRNH-DV---E-D--V--L--D--------PWGL--ISH
Sequence 2 SGHFDDETIEAIRNHPDVDYIERDSEVHTLGHDEPEIEKNSPWGLARISH

Sequence 1 QGDAS----SDYIYDTSAGADTYAYVVDTGINVDHSEFDGRASLAYNAAG
           ----S------Y-Y----G-----YV-DTG-N--H--F-GRA--------
Sequence 2 RDSLSFGTWNKYLYAADGGEGVDVYVIDTGTNTKHVDFEGRAKWGKTIPN

Sequence 1 GQ-HVDSVGHGTHVAGTIGGKTFGVSKKANLLSVKVFEGESSST-SIILD
           G----D--GHGTH--GT--GK--GV-KKA----VKV-----S-T-S----
Sequence 2 GDADEDGNGHGTHCSGTVAGKKYGVAKKAHVYAVKVLRSNGSGTMSDVVK

Sequence 1 GYNWAA---NDIVSKSRTGK------SAINLSLGGGYSYAFSNAVESAFD
           G---AA----D-V-----GK------SA-N-SLGGG-S-----AV--A-D
Sequence 2 GVEYAAKAHSDTVQAAKDGKKKGFKGSAANMSLGGGKSTTLDLAVNAAVD

Sequence 1 EGVLSVVAAGNENVDASNTSPASAPNALTVAASTERNARASFSNYGEVVD
           -G----VAAGN-N-D--N-SPA-A-NA-TV-AST----RA-FSNYG---D
Sequence 2 AGIHFAVAAGNDNADSCNYSPAAAENAVTVGASTLLDERAYFSNYGKCND

Sequence 1 IFAPGEDILSAWIGGNSATNTISGTSMATPHIVGLSLYLIALEGLS----
           IFAPG--ILS-WIG---ATNTISGTSMA-PHI-GL--Y---L--------
Sequence 2 IFAPGLNILSTWIGSEHATNTISGTSMASPHIAGLLAYMLSLQPAKDSAY

Sequence 1 -----SPGDVTSRIKELATQGALSGVS-GSPNALAYNGAE----------
           ------P----------AT-GALS-V-----N-LA-NG------------
Sequence 2 AVADITPKKLKANLISVATVGALSDVPRNTKNILAWNGGGSSNYTEIVEK

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 GGYTVKKAAEKNEEESEFRITIPSLSEIEDDFEKAKESAGRNAHRVGGKL

Sequence 1 -------------------------------
           -------------------------------
Sequence 2 QHLEAEIEDFIAEEMESMFEKVKERVASQKL



Alignment 12
Sequence 1:
Sequence 2: Allergen Cla c 9.0101, Sequence: ABQ59329
Sequence identity: 34.00 (137/403)
Sequence 1 MYSIKRTILLLGALLPAVFGAPILEARRQTEKVPGKYIVTFKSGLQAEQI
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 DAHTTWASNVHKRNLERRDLTDRDLYPGIEKNFKIHKFAAYVGSFDDATI
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 EEIRNHKDVAHVEEDQVWYLDALTTQSDAPWGLGAISHQGDAS----SDY
           ----------------------------APWGL--ISH----S------Y
Sequence 2 ------------DQEVHVLKSESEVEKNAPWGLARISHRDSLSFGTFNKY

Sequence 1 IYDTSAGADTYAYVVDTGINVDHSEFDGRASLAYNAAGGQ-HVDSVGHGT
           -Y----G-----YVVDTG-NVDH--F-GRAS-------G----D--GHGT
Sequence 2 LYTEDGGEGVDVYVVDTGTNVDHVDFEGRASWGKTIPQGDADEDGNGHGT

Sequence 1 HVAGTIGGKTFGVSKKANLLSVKVFEGE-SSSTSIILDGYNWAAN---DI
           H--GT--GK--GV-KKA----VKV-----S-S-S----G---AA------
Sequence 2 HCSGTVAGKKYGVAKKAHVKAVKVLRSNGSGSMSDVVKGVEYAAESHLEQ

Sequence 1 VSKSRTGK------SAINLSLGGGYSYAFSNAVESAFDEGVLSVVAAGNE
           VS----GK------S--N-SLGGG-S-----AV--A-D-G----VAAGN-
Sequence 2 VSIAKKGKRKGFKGSTANMSLGGGKSPILDKAVNAAVDAGIHFAVAAGND

Sequence 1 NVDASNTSPASAPNALTVAASTERNARASFSNYGEVVDIFAPGEDILSAW
           N-D--N-SPA-A-NA-TV-AST----RA-FSNYG---DIFAPG--I-S-W
Sequence 2 NADSCNYSPAAAENAVTVGASTLSDERAYFSNYGKCNDIFAPGLNIQSTW

Sequence 1 IGGNSATNTISGTSMATPHIVGLSLYLIALEGLS---------SPGDVTS
           IG---A-NTISGTSMA-PH--GL--YL--L-------------SP-----
Sequence 2 IGSKYAVNTISGTSMASPHVAGLLAYLLSLQPAKDSAFAVADISPKKLKA

Sequence 1 RIKELATQGALSGV-SGSPNALAYNGAE----------------------
           -----AT-GAL--V-S---N-LA-NG------------------------
Sequence 2 NLISIATVGALTDVPSNTANILAWNGGGESNYSAIVEKGGYKAAVRPTML

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 EEIESEAKVASKKVYSEGDELAKKVAELTEKIEDLISGDLKDMFRDLKRE



Alignment 13
Sequence 1:
Sequence 2: Allergen Pen o 18, Sequence: AAG44478
Sequence identity: 43.92 (177/403)
Sequence 1 -------MYSIKRTILLLGALLPAVFGAPILEARRQTEKVPGKYIVTFKS
           --------------------------GA--L---------P--YIV-FK-
Sequence 2 MKGLLSLTLLPLLAAASPTWSETIHNGAAPLISSTSAKEIPDSYIVVFKK

Sequence 1 GLQAEQIDAHTTWASNVHKRNLERRDLTDRDLY-----P--GIEKNFKIH
           ---A----AH--W----H--N--R--L--R-L------P--G----F---
Sequence 2 HVGASAASAHHSWVQDIHSDNV-RMELKKRSLFGFESEPYLGVKHTFHVA

Sequence 1 -KFAAYVGSFDDATIEEIRNHKDVAHVEED-QVWYLDALTTQSDAPWGLG
           -----Y-G-F----IE--R-H-DV---E-D--V-----------APWGL-
Sequence 2 GSLMGYAGHFHEDVIEQVRRHPDVEYIEKDSEVHHFEDPAIEKNAPWGLA

Sequence 1 AISHQGDAS----SDYIYDTSAGADTYAYVVDTGINVDHSEFDGRASLAY
           -ISH----S------Y-Y----G----AYV-DTG-NVDH--F-GRAS---
Sequence 2 RISHRDSLSFGSFNKYLYAEDGGEGVDAYVIDTGTNVDHVDFEGRASWGK

Sequence 1 NAA-GGQHVDSVGHGTHVAGTIGGKTFGVSKKANLLSVKVFEGESSST-S
           ----G-Q-VD--GHGTH--GTI-GK--GV-KKAN---VKV-----S-T-S
Sequence 2 TIPQGDQDVDGNGHGTHCSGTIAGKKYGVAKKANVYAVKVLRSNGSGTMS

Sequence 1 IILDGYNWAANDIVSKSRTGK---------SAINLSLGGGYSYAFSNAVE
           ----G--WAA-----KS---K---------S--N-SLGGG-S-----AV-
Sequence 2 DVVKGVEWAAEAHIKKSKAAKDGKAKGFKGSVANMSLGGGSSRTLDLAVN

Sequence 1 SAFDEGVLSVVAAGNENVDASNTSPASAPNALTVAASTERNARASFSNYG
           -A-D-G----VAAGN-N-DA-N-SPA-A--A-TV-AST----RA-FSNYG
Sequence 2 AAVDAGMHFAVAAGNDNADACNYSPAAAEKAVTVGASTLADERAYFSNYG

Sequence 1 EVVDIFAPGEDILSAWIGGNSATNTISGTSMATPHIVGLSLYLIALEGLS
           ---DIFAPG--ILS-WIG---A-NTISGTSMA-PHI-GL--Y---L---S
Sequence 2 KCTDIFAPGLNILSTWIGSKYAVNTISGTSMASPHIAGLLAYYVSLQPAS

Sequence 1 ---------SPGDVTSRIKELATQGALSGV-SGSPNALAYNGAE------
           ----------P----------AT-GALS---S--PN-LA-NG--------
Sequence 2 DSAYAVEEITPKKLKDALITIATSGALSDIPSDTPNLLAWNGGGSSNYTE

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 IVSKGGYKAGASESMKKHLDELVGKVEEVIAKEQKVLSHELGAIYSEIKD

Sequence 1 ----
           ----
Sequence 2 AVSA



Alignment 14
Sequence 1:
Sequence 2: Allergen Cla h 9.0101, Sequence: AAX14379
Sequence identity: 42.68 (172/403)
Sequence 1 --------MYSIKRTILLLGALLPAVFGAPILEARRQTEKVPGKYIVTFK
           --------------T-------------API--A----E-----Y---FK
Sequence 2 MRGALAGLSLATLATASPVLVNSIHNDAAPIISASNAKE-IADNYMIKFK

Sequence 1 SGLQAEQIDAHTTWASNVH-KRNLERRDLTDR-------DLYPGIEKNFK
           ----------H--W----H-K-------L--R-------D---G------
Sequence 2 DHVTQNLAAEHHGWVQDLHEKTQVAKTELRKRSQSPMVDDIFNGLKHTYN

Sequence 1 IHK-FAAYVGSFDDATIEEIRNHKDVAHVEEDQ-VWYLDALT-TQSDAPW
           I------Y-G-FD---IE-IR-H-DV--VE-DQ-V--L---------APW
Sequence 2 IAGGLMGYAGHFDEDVIEQIRRHPDVELVERDQEVHVLGSESEVEKNAPW

Sequence 1 GLGAISHQGDAS----SDYIYDTSAGADTYAYVVDTGINVDHSEFDGRAS
           GL--ISH----S------Y-Y----G-----YVVDTG-NVDH--F-GRAS
Sequence 2 GLARISHRDSLSFGTFNKYLYTEDGGEGVDVYVVDTGTNVDHVDFEGRAS

Sequence 1 LAYNAA-GGQHVDSVGHGTHVAGTIGGKTFGVSKKANLLSVKVFEGE-SS
           -------G----D--GHGTH--GT--GK--GV-KKA----VKV-----S-
Sequence 2 WGKTIPQGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVKAVKVLRSNGSG

Sequence 1 STSIILDGYNWAAN---DIVSKSRTGK------SAINLSLGGGYSYAFSN
           S-S----G---AA------VS----GK------S--N-SLGGG-S-----
Sequence 2 SMSDVVKGVEYAAESHLEQVSITKKGKRKGFKGSTANMSLGGGKSPILDK

Sequence 1 AVESAFDEGVLSVVAAGNENVDASNTSPASAPNALTVAASTERNARASFS
           AV--A-D-G----VAAGN-N-D--N-SPA-A-NA-TV-AST----RA-FS
Sequence 2 AVNAAVDAGIHFAVAAGNDNADSCNYSPAAAENAVTVGASTLADERAYFS

Sequence 1 NYGEVVDIFAPGEDILSAWIGGNSATNTISGTSMATPHIVGLSLYLIALE
           NYG---DIFAPG--I-S-WIG---A-NTISGTSMA-PH--GL--YL--L-
Sequence 2 NYGKCNDIFAPGLNIQSTWIGSKYAVNTISGTSMASPHVAGLLAYLLSLQ

Sequence 1 GLS---------SPGDVTSRIKELATQGALSGV-SGSPNALAYNGAE---
           ------------SP----------AT-GAL--V-S---N-LA-NG-----
Sequence 2 PAKDSAFAVADISPKKLKANLISIATVGALTDVPSNTANILAWNGGGESN

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 YSAIVEKGGYKATHRPTMLEEIESEAKVASKKVYSEGDELAHKVAELTEK

Sequence 1 -------------------
           -------------------
Sequence 2 VEDLIAGELKDMFRELKRE



Alignment 15
Sequence 1:
Sequence 2: Allergen Asp f 18.0101, Sequence: Y13338
Sequence identity: 43.67 (176/403)
Sequence 1 --------MYSIKRTILLLGALLPAVFGAPILEARRQTEKVPGKYIVTFK
           ----------------------------APIL------E-VP--YIV-FK
Sequence 2 MKGYLSLSILPLLVAASPVVVDSIHNGAAPILSSMNAKE-VPDSYIVVFK

Sequence 1 SGLQAEQIDAHTTWASNVHKRNLERRDLTDRDL-------YPGIEKNFKI
           ----AE---AH--W----H----ER--L--R-L-------Y-G----F-I
Sequence 2 KHVNAESAAAHHSWVQDIHSAQNERVELRKRSLFGFGEEAYLGLKNTFDI

Sequence 1 H-KFAAYVGSFDDATIEEIRNHKDVAHVEED-QVWYLDALTTQSDAPWGL
           ------Y-G-F----IE--R-H-DV---E-D--V------T----APWGL
Sequence 2 AGSLVGYSGHFHEDVIEQVRKHPDVEYIEKDSEVHTMEDPTVEKSAPWGL

Sequence 1 GAISHQGDAS----SDYIYDTSAGADTYAYVVDTGINVDHSEFDGRASLA
           --ISH----S------Y-Y----G----AY--DTGINVDH--F-GRA---
Sequence 2 ARISHRDSLSFGTFNKYLYASEGGEGVDAYTIDTGINVDHVDFEGRAQWG

Sequence 1 YNA-AGGQHVDSVGHGTHVAGTIGGKTFGVSKKANLLSVKVFEGESSST-
           ----------D--GHGTH--GTI-G---GV-KKANL--VKV-----S-T-
Sequence 2 KTIPTDDEDADGNGHGTHCSGTIAGRKYGVAKKANLYAVKVLRSSGSGTM

Sequence 1 SIILDGYNWAANDIVSK---SRTGK------SAINLSLGGGYSYAFSNAV
           S----G--WA------K------GK------S--N-SLGGG-S-----AV
Sequence 2 SDVVAGVEWAVKSHLKKVKDAKDGKIKGFKGSVANMSLGGGKSRTLEAAV

Sequence 1 ESAFDEGVLSVVAAGNENVDASNTSPASAPNALTVAASTERNARASFSNY
           ------G----VAAGN-N-DA-N-SPA-A-N--TV-AST----RA-FSNY
Sequence 2 NAGVEAGLHFAVAAGNDNADACNYSPAAAENPITVGASTLQDERAYFSNY

Sequence 1 GEVVDIFAPGEDILSAWIGGNSATNTISGTSMATPHIVGLSLYLIALEGL
           G---DIFAPG--ILS-WIG---A-NTISGTSMA-PHI-GL--Y---L---
Sequence 2 GKCTDIFAPGLNILSTWIGSKHAVNTISGTSMASPHIAGLLAYFVSLQPS

Sequence 1 S---------SPGDVTSRIKELATQGALSGV-SGSPNALAYNGAE-----
           -----------P------I---ATQGAL----S--PN-LA-NG-------
Sequence 2 KDSAFAVDELTPKKLKKDIIAIATQGALTDIPSDTPNLLAWNGGGSSNYT

Sequence 1 ----------------------------------------------
           ----------------------------------------------
Sequence 2 DIIASGGYKVNASVKDRFEGLVHKAEKLLTEELGAIYSEIHDAAVA



Alignment 16
Sequence 1:
Sequence 2: Allergen Fus p 9.0101, Sequence: A0A0U1Y1N5
Sequence identity: 33.25 (134/403)
Sequence 1 MYSIKRTILLLGALLPAVFGAPILEARRQTEKVPGKYIVTFKSGLQAEQI
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 DAHTTWASNVHKRNLERRDLTDRDLYPGIEKNFKIHKFAAYVGSFDDATI
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 EEIRNHKDVAHVEEDQVWYLDALTTQSDAPWGLGAISHQGDAS----SDY
           ------------------------T---APWGL--ISH-----------Y
Sequence 2 ------------------DKCDGETERQAPWGLARISHRNTLNFGTFNKY

Sequence 1 IYDTSAGADTYAYVVDTGINVDHSEFDGRASLAYNA-AGGQHVDSVGHGT
           -Y----G----AY-VDTG-NVDH--F-GRA--------G----D--GHGT
Sequence 2 LYSSDGGEGVDAYIVDTGTNVDHVDFEGRAHWGKTIPSGDADEDGNGHGT

Sequence 1 HVAGTIGGKTFGVSKKANLLSVKVFEGE-SSSTSIILDGYNWAANDIV--
           H--GT--GK--GV-KKAN---VKV-----S-S-S----G---AA------
Sequence 2 HCSGTVAGKKYGVAKKANVYAVKVLRSNGSGSMSDVVKGVEFAATSHLEQ

Sequence 1 -SKSRTGK------SAINLSLGGGYSYAFSNAVESAFDEGVLSVVAAGNE
           --K---GK------S--N-SLGGG---A---AV--A---G----VAAGN-
Sequence 2 KKKAKDGKRKGFKGSVANMSLGGGKTQALDAAVNAAVRTGIHFAVAAGND

Sequence 1 NVDASNTSPASAPNALTVAASTERNARASFSNYGEVVDIFAPGEDILSAW
           N-DA-N-SPA-A----TV-AS-----RA-FSNYG---DIFAPG--I-S-W
Sequence 2 NADACNYSPAAASEPVTVGASALDDSRAYFSNYGKCTDIFAPGLNIQSTW

Sequence 1 IGGNSATNTISGTSMATPHIVGLSLYLIALE-------GLSS--PGDVTS
           IG---A-NTISGTSMA-PHI-GL--Y---L---------L-S--P-----
Sequence 2 IGSKYAVNTISGTSMASPHIAGLLAYYLSLQPAEDSEYALASITPKKLKE

Sequence 1 RIKELATQGALSGV-SGSPNALAYNGAE----------------------
           -----AT--ALS---S--PN-LA-NG------------------------
Sequence 2 NLISVATEDALSDIPSDTPNLLAWNGGGCSDYKKIVEAGSYKVKAAPSSR

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 VEEIKHAVEQEVNLVSGKLTTGAKELGSKAEKFSKKIHELVDEELEEFLK

Sequence 1 ----
           ----
Sequence 2 ELNL



Alignment 17
Sequence 1:
Sequence 2: Allergen Cuc m 1, Sequence: BAA06905
Sequence identity: 18.36 (74/403)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MSSSLIFKLFFFSLFFSNRLASRLDSDDDGKNIYIVYMGRKLEDPDSAHL

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 HHRAMLEQVVGSTFAPESVLHTYKRSFNGFAVKLTEEEAEKIASMEGVVS

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 VFLNEMNELHTTRSWDFLGFPLTVPRRSQVESNIVVGVLDTGIWPESPSF

Sequence 1 ----------------------------------------MYSIKRTILL
           --------------------------------------------------
Sequence 2 DDEGFSPPPPKWKGTCETSNNFRCNRKIIGARSYHIGRPISPGDVNGPRD

Sequence 1 LGALLPAVFGAPILEARRQTEKVPGKYIVTFKSGLQAEQIDAHTTWASNV
           ------------------Q-----------------A--------W----
Sequence 2 TNGHGTHTASTAAGGLVSQANLYGLGLGTARGGVPLARIAAYKVCWNDGC

Sequence 1 HKRNLERRDLTDRDLYPGIEKNFKIHKFAAYVGSFDDATIEEIRNHKDVA
           ------------------I------------------A------------
Sequence 2 SDTDILAAYDDAIADGVDIISLSVGGANPRHYFVDAIAIGSFHAVERGIL

Sequence 1 HVEEDQVWYLDALTTQSDAPWGLGAISHQGDASSDYIYDTSAGADTYAYV
           -------------TT-S--PW-L-------D-----------G-------
Sequence 2 TSNSAGNGGPNFFTTASLSPWLLSVAASTMDRK--FVTQVQIG-NGQSF-

Sequence 1 VDTGINVDHSEFDGRASLAYNAAGGQHVDSVGHGTHVAGTIGGKTFGVSK
           ---G-------FD------Y----G------G-----------K----S-
Sequence 2 --QGVSIN--TFDNQY---YPLVSGRDIPNTGFDKSTSRFCTDK----SV

Sequence 1 KANLLSVKVFEGESS-STSIILDGYNWAANDIVSKSRTGKSAINLSLGGG
           --NLL--K----E-S------------AA------S-T---A----L---
Sequence 2 NPNLLKGKIVVCEASFGPHEFFKSLDGAAG-VLMTSNTRDYADSYPLPS-

Sequence 1 YSYAFSNAVESAFDEGVLSVVAAGNENVDASNTSPASAPNALTVAASTER
           -S----N-----------S----G-----------ASAP----V--S---
Sequence 2 -SVLDPNDLLATL-RYIYSIRSPGATIFKSTTILNASAP--VVVSFSSRG

Sequence 1 NARASFSNYGEVV--DIFAPGEDILSAW-----IGG---NSATNTISGTS
           --RA-------V---DI--PG--IL-AW------GG---N---N-ISGTS
Sequence 2 PNRAT----KDVIKPDISGPGVEILAAWPSVAPVGGIRRNTLFNIISGTS

Sequence 1 MATPHIVGLSLYLIALEGLSSPGDVTSRIKELATQGALSGVSGSPNALAY
           M--PHI-G---Y--------SP----S-----A-------------A---
Sequence 2 MSCPHITGIATYVKTYNPTWSPAAIKSALMTTASPMNARFNPQAEFAYGS

Sequence 1 NGAE----------------------------------------------
           --------------------------------------------------
Sequence 2 GHVNPLKAVRPGLVYDANESDYVKFLCGQGYNTQAVRRITGDYSACTSGN

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 TGRVWDLNYPSFGLSVSPSQTFNQYFNRTLTSVAPQASTYRAMISAPQGL

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 TISVNPNVLSFNGLGDRKSFTLTVRGSIKGFVVSASLVWSDGVHYVRSPI

Sequence 1 ------
           ------
Sequence 2 TITSLV


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.