The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Sor h 2.0101

Sequence A0A077B7S9_SORHL

Full FASTA alignment

Sequence name:
Query sequence:
MASSSSFLLAMAALAALLAVGSCSTLMTWTIGKDSTSTRLVLVASADVSE
VAVKDKGATDFSDDLKESPAKTFTYESKEPIKGPLSVRFAVKGQGYRTTD
DVIPADFKPGSVYKTKEQV

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Sor h 2.0101A0A077B7S9Go!119170.01.5e-44
2Sor h 2.0201A0A077B2S0Go!121119.62.4e-29
3Cyn d 2CAA10346Go!12254.59.7e-10
4Phl p 2P43214Go!12253.81.5e-09
5Poa p 2CAA10348Go!12253.81.5e-09
6Dac g 2CAA10345Go!12253.61.8e-09
7Cyn d 1.0204AAF80379Go!24448.21.5e-07
8Cyn d 1.0201AAK96255Go!24448.01.7e-07
9Cyn d 1O04701Go!24646.93.6e-07
10Cyn d 1.0202AAL14077Go!26246.93.8e-07
11Uro m 1.0101A0A4D6FZ45Go!26246.93.8e-07
12Cyn d 1.0203AAL14079Go!26246.93.8e-07
13Cyn d 15AAP80171Go!11245.06.2e-07
14Cyn d 1AAL14078Go!26245.88.1e-07
15Ory s 1AAF72983Go!26745.41.1e-06
16Zoy m 1.0101QCX36431Go!27244.12.8e-06
17Lol p 2P14947Go!9742.33.4e-06
18Uro m 1.0201A0A4D6G2J8Go!22943.24.6e-06
19Ory s 1AAF72991Go!26741.02.3e-05
20Tri a 3CAA90746Go!11839.82.4e-05
21Ory s 1Q40638Go!26340.82.6e-05
22Lol p 2CAA51775Go!8838.83.6e-05
23Phl p 3.01012JNZ_AGo!10838.26.6e-05
24Phl p 1.0101CAA81613Go!26339.18.9e-05
25Hol l 1CAA10140Go!26338.91.0e-04
26Phl p 1P43213Go!26338.61.2e-04
27Dac g 3P93124Go!9637.11.3e-04
28Poa p aCAA10520Go!26338.41.4e-04
29Sor h 1.0101ABC58726Go!23938.21.5e-04
30Hol l 1.0102CAA93121Go!24837.72.1e-04
31Hol l 1P43216Go!26537.82.2e-04
32Lol p 1.0101AAA63279Go!26337.52.6e-04
33Lol p 1.0102AAA63278Go!25237.13.4e-04
34Lol p 1.0103CAB63699Go!26336.94.0e-04
35Lol p 1P14946Go!26336.55.5e-04
36Zea m 1Q07154Go!19134.31.7e-03
37Zea m 1P58738Go!26934.71.9e-03
38Lol p 3P14948Go!9733.22.0e-03
39Ory s 1AAF72988Go!32734.82.1e-03
40Pha a 1Q41260Go!26934.12.9e-03
41Gly m 2AAA50175Go!27733.44.7e-03

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Sor h 2.0101, Sequence: A0A077B7S9
Sequence identity: 100.00 (119/119)
Sequence 1 MASSSSFLLAMAALAALLAVGSCSTLMTWTIGKDSTSTRLVLVASADVSE
           MASSSSFLLAMAALAALLAVGSCSTLMTWTIGKDSTSTRLVLVASADVSE
Sequence 2 MASSSSFLLAMAALAALLAVGSCSTLMTWTIGKDSTSTRLVLVASADVSE

Sequence 1 VAVKDKGATDFSDDLKESPAKTFTYESKEPIKGPLSVRFAVKGQGYRTTD
           VAVKDKGATDFSDDLKESPAKTFTYESKEPIKGPLSVRFAVKGQGYRTTD
Sequence 2 VAVKDKGATDFSDDLKESPAKTFTYESKEPIKGPLSVRFAVKGQGYRTTD

Sequence 1 DVIPADFKPGSVYKTKEQV
           DVIPADFKPGSVYKTKEQV
Sequence 2 DVIPADFKPGSVYKTKEQV



Alignment 2
Sequence 1:
Sequence 2: Allergen Sor h 2.0201, Sequence: A0A077B2S0
Sequence identity: 68.07 (81/119)
Sequence 1 MASSSSF--LLAMAALAALLAVGSCSTLMTWTIGKDSTSTRLVLVASADV
           MASSSSF--LLA--ALAAL-A-GSC-T--T---GKDSTST-L-L------
Sequence 2 MASSSSFCFLLAVVALAALFAIGSCGTTLTIEVGKDSTSTKLSLITNVAI

Sequence 1 SEVAVKDKGATDFSDDLKESPAKTFTYESKEPIKGPLSVRFAVKGQGYRT
           SEV-VK-KGATDF-DDLKES--KTFT--SKEPI-GP---RF--KG-GYR-
Sequence 2 SEVSVKPKGATDFTDDLKESEPKTFTLDSKEPIEGPIAFRFLAKGGGYRV

Sequence 1 TDDVIPADFKPGSVYKTKEQV
           -D--IPADFK-GSVYKT-EQV
Sequence 2 VDNAIPADFKAGSVYKTTEQV



Alignment 3
Sequence 1:
Sequence 2: Allergen Cyn d 2, Sequence: CAA10346
Sequence identity: 33.61 (40/119)
Sequence 1 ---MASSSSFLLAMAALAALLAVGSCSTLMTWTIGKDSTSTRLVLVASAD
           -----SSSS-LLAMA-LAAL-A---C----T-T--K-S----L-------
Sequence 2 MSMASSSSSGLLAMAVLAALFAGAWCVPKVTFTVEKGSNEKHLAVLVKYE

Sequence 1 ---VSEVAVKDKGATDFSDDLKESPAKTFTYESKEPIKGPLSVRFAVKGQ
           -----EV-----G----------------T--S-EP-KGP---RF-----
Sequence 2 GDTMAEVELREHGSDEWVA-MTKGEGGVWTFDSEEPLKGPFNFRFLTE-K

Sequence 1 GYRTT-DDVIPADFKPGSVYKTKEQV
           G-----DDV-P-----G--Y---E--
Sequence 2 GMKNVFDDVVPEKYTIGATYAPEE--



Alignment 4
Sequence 1:
Sequence 2: Allergen Phl p 2, Sequence: P43214
Sequence identity: 32.77 (39/119)
Sequence 1 ---MASSSSFLLAMAALAALLAVGSCSTLMTWTIGKDSTSTRLVLVASAD
           -----SSSS-LLAMA-LAAL-A---C----T-T--K-S----L-------
Sequence 2 MSMASSSSSSLLAMAVLAALFAGAWCVPKVTFTVEKGSNEKHLAVLVKYE

Sequence 1 ---VSEVAVKDKGATDFSDDLKESPAKTFTYESKEPIKGPLSVRFAVKGQ
           -----EV-----G----------------T--S-EP--GP---RF-----
Sequence 2 GDTMAEVELREHGSDEWVA-MTKGEGGVWTFDSEEPLQGPFNFRFLTE-K

Sequence 1 GYRTT-DDVIPADFKPGSVYKTKEQV
           G-----DDV-P-----G--Y---E--
Sequence 2 GMKNVFDDVVPEKYTIGATYAPEE--



Alignment 5
Sequence 1:
Sequence 2: Allergen Poa p 2, Sequence: CAA10348
Sequence identity: 32.77 (39/119)
Sequence 1 ---MASSSSFLLAMAALAALLAVGSCSTLMTWTIGKDSTSTRLVLVASAD
           -----SSSS-LLAMA-LAAL-A---C----T-T--K-S----L-------
Sequence 2 MSMASSSSSSLLAMAVLAALFAGAWCVPKVTFTVEKGSNEKHLAVLVKYE

Sequence 1 ---VSEVAVKDKGATDFSDDLKESPAKTFTYESKEPIKGPLSVRFAVKGQ
           -----EV-----G----------------T--S-EP--GP---RF-----
Sequence 2 GDTMAEVELREHGSDEWVA-MTKGEGGVWTFDSEEPLQGPFNFRFLTE-K

Sequence 1 GYRTT-DDVIPADFKPGSVYKTKEQV
           G-----DDV-P-----G--Y---E--
Sequence 2 GMKNVFDDVVPEKYTIGATYAPEE--



Alignment 6
Sequence 1:
Sequence 2: Allergen Dac g 2, Sequence: CAA10345
Sequence identity: 32.77 (39/119)
Sequence 1 ---MASSSSFLLAMAALAALLAVGSCSTLMTWTIGKDSTSTRLVLVASAD
           -----SSSS-LLAMA-LAAL-A---C----T-T--K-S----L-------
Sequence 2 MSMASSSSSGLLAMAVLAALFAGAWCVPKVTFTVEKGSNEKHLAVLVKYE

Sequence 1 ---VSEVAVKDKGATDFSDDLKESPAKTFTYESKEPIKGPLSVRFAVKGQ
           -----EV-----G----------------T--S-EP--GP---RF-----
Sequence 2 GDTMAEVELREHGSDEWVA-MTKGEGGVWTFDSEEPLQGPFNFRFLTE-K

Sequence 1 GYRTT-DDVIPADFKPGSVYKTKEQV
           G-----DDV-P-----G--Y---E--
Sequence 2 GMKNVFDDVVPEKYTIGATYAPEE--



Alignment 7
Sequence 1:
Sequence 2: Allergen Cyn d 1.0204, Sequence: AAF80379
Sequence identity: 28.57 (34/119)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKA

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 PFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEH

Sequence 1 ---------------------MASSSSFLLAMAALAALLAVGSCSTLMTW
           -------------------------------M-------------T----
Sequence 2 IAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAF

Sequence 1 TIGKDSTSTRLVLV---ASAD--VSEVAVKDKGATDFSDDLKESPAKTFT
           ---K-S----L-L----A--D-----V--K-KG---F----K-S------
Sequence 2 HVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLP-MKQSWGAIWR

Sequence 1 YESKEPIKGPLSVRFAVKGQGYRTTDDVIPADFKPGSVYKTKEQV
           -----P-KGP---R------G----DDVIP-D-KP--VYK-K-Q-
Sequence 2 MDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQF



Alignment 8
Sequence 1:
Sequence 2: Allergen Cyn d 1.0201, Sequence: AAK96255
Sequence identity: 28.57 (34/119)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKA

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 PFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEH

Sequence 1 ---------------------MASSSSFLLAMAALAALLAVGSCSTLMTW
           -------------------------------M-------------T----
Sequence 2 IAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAF

Sequence 1 TIGKDSTSTRLVLV---ASAD--VSEVAVKDKGATDFSDDLKESPAKTFT
           ---K-S----L-L----A--D-----V--K-KG---F----K-S------
Sequence 2 HVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLP-MKQSWGAIWR

Sequence 1 YESKEPIKGPLSVRFAVKGQGYRTTDDVIPADFKPGSVYKTKEQV
           -----P-KGP---R------G----DDVIP-D-KP--VYK-K-Q-
Sequence 2 IDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQF



Alignment 9
Sequence 1:
Sequence 2: Allergen Cyn d 1, Sequence: O04701
Sequence identity: 28.57 (34/119)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 AIGDKPGPNITATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKP

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 PFDGMTACGNEPIFKDGLGCRACYEIKCKEPVECSGEPVLVKITDKNYEH

Sequence 1 ---------------------MASSSSFLLAMAALAALLAVGSCSTLMTW
           ---------------------------------------------T--T-
Sequence 2 IAAYHFDLSGKAFGAMAKKGQEDKLRKAGELTLQFRRVKCKYPSGTKITF

Sequence 1 TIGKDSTSTRLVLV---ASAD--VSEVAVKDKGATDFSDDLKESPAKTFT
           -I-K-S----L-L----A--D-----V--K------F----K-S------
Sequence 2 HIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSDEFIP-MKSSWGAIWR

Sequence 1 YESKEPIKGPLSVRFAVKGQGYRTTDDVIPADFKPGSVYKTKEQV--
           ---K-P-KGP-S-R----G------DDVIPA--KP--VY--K-Q---
Sequence 2 IDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTSKLQFGA



Alignment 10
Sequence 1:
Sequence 2: Allergen Cyn d 1.0202, Sequence: AAL14077
Sequence identity: 27.73 (33/119)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MLAVVAVVLASMVGGALCAMGDKPGPNITATYGDKWLDAKATFYGSDPRG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 AAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPA

Sequence 1 ---------------------------------------MASSSSFLLAM
           -------------------------------------------------M
Sequence 2 ECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELM

Sequence 1 AALAALLAVGSCSTLMTWTIGKDSTSTRLVLV---ASAD--VSEVAVKDK
           -------------T-------K-S----L-L----A--D-----V--K-K
Sequence 2 LQFRRVKCEYPSDTKIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDIKSK

Sequence 1 GATDFSDDLKESPAKTFTYESKEPIKGPLSVRFAVKGQGYRTTDDVIPAD
           G---F----K-S-----------P-KGP---R------G-----DVIP-D
Sequence 2 GSDEFLP-MKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQEDVIPED

Sequence 1 FKPGSVYKTKEQV
           -KP--VYK-K-Q-
Sequence 2 WKPDTVYKSKIQF



Alignment 11
Sequence 1:
Sequence 2: Allergen Uro m 1.0101, Sequence: A0A4D6FZ45
Sequence identity: 27.73 (33/119)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MLAVVAVVLASMVGGALCAMGDKPGPNITATYGDKWLDAKATFYGSDPRG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 AAPDDHGGACGYKDVDKAPFDSMTGCGNEPIFKDGLGCGSCYEIKCKEPA

Sequence 1 ---------------------------------------MASSSSFLLAM
           -------------------------------------------------M
Sequence 2 ECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELM

Sequence 1 AALAALLAVGSCSTLMTWTIGKDSTSTRLVLV---ASAD--VSEVAVKDK
           -------------T-------K-S----L-L----A--D-----V--K-K
Sequence 2 LQFRRVKCEYPSDTKIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDIKSK

Sequence 1 GATDFSDDLKESPAKTFTYESKEPIKGPLSVRFAVKGQGYRTTDDVIPAD
           G---F----K-S-----------P-KGP---R------G-----DVIP-D
Sequence 2 GSDEFLP-MKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQEDVIPED

Sequence 1 FKPGSVYKTKEQV
           -KP--VYK-K-Q-
Sequence 2 WKPDTVYKSKIQF



Alignment 12
Sequence 1:
Sequence 2: Allergen Cyn d 1.0203, Sequence: AAL14079
Sequence identity: 27.73 (33/119)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MLAVVAVVLASMVGGALCAMGDKPGPNITATYGDKWLDAKATFYGSDPRG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 AAPDDHGGACGYKDVDKAPFDSMTGCGNEPIFKDGLGCGSCYEIKCKEPA

Sequence 1 ---------------------------------------MASSSSFLLAM
           -------------------------------------------------M
Sequence 2 ECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELM

Sequence 1 AALAALLAVGSCSTLMTWTIGKDSTSTRLVLV---ASAD--VSEVAVKDK
           -------------T-------K-S----L-L----A--D-----V--K-K
Sequence 2 LQFRRVKCEYPSDTKIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDIKSK

Sequence 1 GATDFSDDLKESPAKTFTYESKEPIKGPLSVRFAVKGQGYRTTDDVIPAD
           G---F----K-S-----------P-KGP---R------G-----DVIP-D
Sequence 2 GSDEFLP-MKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQEDVIPED

Sequence 1 FKPGSVYKTKEQV
           -KP--VYK-K-Q-
Sequence 2 WKPDTVYKSKIQF



Alignment 13
Sequence 1:
Sequence 2: Allergen Cyn d 15, Sequence: AAP80171
Sequence identity: 29.41 (35/119)
Sequence 1 MASSSSFLLAMAALAALLAVGSCSTLMTWTIGKDSTSTRLVLVASA-DVS
           -------L-----LA-------C-----------S----L----SA----
Sequence 2 ----MATLTFPVLLATMVGHAWCVNII-FHVEESSPKFALSIKDSAKEIT

Sequence 1 EVAVKDKGATDFSDDLKESPAKTFTYESKEPIKGPLSVRFAVKGQGYRTT
           -V-V---GA-D--D----S-----T-----P-KGPL--R----G-G-R--
Sequence 2 QVDVREHGA-DNMDPMTKS-GDSWTID--KPLKGPLNIRLRAEGGGSRVQ

Sequence 1 DDVIPADFKPGSVYKTKEQV-
           DDVIP---K-G--Y-TK----
Sequence 2 DDVIPENWKAGTDYPTKLHFG



Alignment 14
Sequence 1:
Sequence 2: Allergen Cyn d 1, Sequence: AAL14078
Sequence identity: 28.57 (34/119)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MLAAVAVVLASMVGGAWCAMGDKPGPNITATYGDKWLDAKATFYGSDPRG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 AAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLGCGSCYEIKCKEPA

Sequence 1 ---------------------------------------MASSSSFLLAM
           -------------------------------------------------M
Sequence 2 ECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELM

Sequence 1 AALAALLAVGSCSTLMTWTIGKDSTSTRLVLV---ASAD--VSEVAVKDK
           -------------T--T----K-S----L-L----A--D-----V--K-K
Sequence 2 LQFRRVKCEYPSDTKITFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPK

Sequence 1 GATDFSDDLKESPAKTFTYESKEPIKGPLSVRFAVKGQGYRTTDDVIPAD
           G--D-----K-S-----------P-KGP---R------G-----DVIP-D
Sequence 2 G-SDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQEDVIPED

Sequence 1 FKPGSVYKTKEQV
           -KP--VYK-K-Q-
Sequence 2 WKPDTVYKSKIQF



Alignment 15
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: AAF72983
Sequence identity: 29.41 (35/119)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MASSSLLLACVVVAAMVSAVSCGPPKVPPGPNITTSYGDKWLEAKATWYG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 APKGAGPKDNGGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKC

Sequence 1 -------------------------------------------MASSSSF
           --------------------------------------------------
Sequence 2 SKPEACSDKPALIHVTDMNDEPIAAYHFDLSGLAFGAMAKDGKDEELRKA

Sequence 1 LLAMAALAALLAVGSCSTLMTWTIGKDSTSTRLVLV-----ASADVSEVA
           -----------------T--T--I-K-S----L-L---------DV-EV-
Sequence 2 GIIDTQFRRVKCKYPADTKITFHIEKASNPNYLALLVKYVAGDGDVVEVE

Sequence 1 VKDKGATDFSDDLKESPAKTFTYESKEPIKGPLSVRFAVKGQGYRTTDDV
           -K-KG-------LKES-----------P-KGP-SVR----G-------D-
Sequence 2 IKEKGSEEWKA-LKESWGAIWRIDTPKPLKGPFSVRVTTEGGEKIIAEDA

Sequence 1 IPADFKPGSVYKTKEQV-
           IP---K--SVYK---Q--
Sequence 2 IPDGWKADSVYKSNVQAK



Alignment 16
Sequence 1:
Sequence 2: Allergen Zoy m 1.0101, Sequence: QCX36431
Sequence identity: 25.21 (30/119)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MASSSARRQAQLAAVAVLLSAMVGSALCEIGDKPGPNITATYNEEWQDAK

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 ATFYGSNPRGAAPDDDGGACGYKNVDKAPFFGMTGCGNEPIFKDGLGCGS

Sequence 1 -------------------------------------------------M
           --------------------------------------------------
Sequence 2 CFEIKCKEPAECSDKPVLIRITDKNYEHIAAYHFDLSGKAFGSMAKQGQE

Sequence 1 ASSSSFLLAMAALAALLAVGSCSTLMTWTIGKDSTSTRLVLV-----ASA
           -----------------------T--T----K------L-L---------
Sequence 2 DNLRKAGELTLQFRRVKCEYPSKTKITFHVEKGCNDNYLALLVEYAAGDG

Sequence 1 DVSEVAVKDKGATDFSDDLKESPAKTFTYESKEPIKGPLSVRFAVKGQGY
           D---V--K-KG---F----K-S---------K-P-KGP--VR--------
Sequence 2 DIVAVDIKPKGSDEFLP-MKPSWGAIWRIDPKKPLKGPFTVRLTSESGAK

Sequence 1 RTTDDVIPADFKPGSVYKTKEQV
           ----DVIPAD-KP---Y----Q-
Sequence 2 LVQEDVIPADWKPNTAYTSNLQY



Alignment 17
Sequence 1:
Sequence 2: Allergen Lol p 2, Sequence: P14947
Sequence identity: 25.21 (30/119)
Sequence 1 MASSSSFLLAMAALAALLAVGSCSTLMTWTIGKDSTSTRLVLVASADVSE
           ------------------A-----T-------K----------------E
Sequence 2 ------------------AAPVEFTVEKGSDEKNLALSIKYNKEGDSMAE

Sequence 1 VAVKDKGATDFSDDLKESPAKTFTYESKEPIKGPLSVRFAVKGQGYRTT-
           V--K--G-------LK----------S--P-KGP---RF-V---G-R---
Sequence 2 VELKEHGSNEWLA-LKKNGDGVWEIKSDKPLKGPFNFRF-VSEKGMRNVF

Sequence 1 DDVIPADFKPGSVYKTKEQV
           DDV-PADFK-G--YK-----
Sequence 2 DDVVPADFKVGTTYKPE---



Alignment 18
Sequence 1:
Sequence 2: Allergen Uro m 1.0201, Sequence: A0A4D6G2J8
Sequence identity: 23.53 (28/119)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 DGKWLDAKATWYGKPTGAGPDDNGGACGYKDVNKAPFNSMGACGNPPIFK

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 DGLGCGSCYEIKCDKPAECSGEPVIVHITDQNYEPIAAYHFDLAGTAFGA

Sequence 1 -----------MASSSSFLLAMAALAALLAVGSCSTLMTWTIGKDSTSTR
           ------------A-------------------------------------
Sequence 2 MAKKGEEEKLRKAGIIDMQFRRVKCKYPANTKIAFHVEKGCNPNYFALLI

Sequence 1 LVLVASADVSEVAVKDKGATDFSDDLKESPAKTFTYESKEPIKGPLSVRF
           -------D---V--K-KG---F---LK-S--------S--PIKGP--VR-
Sequence 2 KYAAGDGDIVAVDIKEKGSEEFIP-LKHSWGAIWRIDSPKPIKGPIAVRL

Sequence 1 AVKGQGYRTTDDVIPADFKPGSVYKTKEQV
           ---G------DD-IP---K---VY--K-Q-
Sequence 2 TSEGGTTLVQDDAIPEGWKADTVYTSKLQF



Alignment 19
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: AAF72991
Sequence identity: 26.05 (31/119)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MASSCLLLACVVAAAMVSAVSCGPPKVPPGPNITAAYGKQWLEARGTWYG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 KPKGAGPDDNGGACGYKDIDKAPFLGMNSCGNDPIFKDGKGCGSCFEVKC

Sequence 1 -------------------------------------------MASSSSF
           --------------------------------------------------
Sequence 2 SKPEACSDKPVIIHITDMNTEPIAAYHFDLSGHAFGAMAKEGKDEELRKA

Sequence 1 LLAMAALAALLAVGSCSTLMTWTIGKDSTSTRL-VLV----ASADVSEVA
           -----------------T--T----K-S------VLV-------DV--V-
Sequence 2 GIIDMQFRRVRCKYPGETKVTFHVEKGSNPNYFAVLVKYVGGDGDVVKVE

Sequence 1 VKDKGATDFSDDLKESPAKTFTYESKEPIKGPLSVRFAVKGQGYRTTDDV
           -K-KG-------L-ES-----------P-KGP-S-R------------DV
Sequence 2 LKEKGSEEWKP-LNESWGAIWRIDTPKPLKGPFSLRVTTESDQKLVANDV

Sequence 1 IPADFKPGSVYKTKEQV-
           IP---K----YK---QV-
Sequence 2 IPDNWKANALYKSEIQVD



Alignment 20
Sequence 1:
Sequence 2: Allergen Tri a 3, Sequence: CAA90746
Sequence identity: 29.41 (35/119)
Sequence 1 MASSSSFLLAMAALAALLAVGSCSTLMTWTIGKDSTSTRLVLVA-----S
           MAS-S---L--A-LAAL-A-G--------T--K-S----L-L--------
Sequence 2 MASASR-MLTVAVLAALFA-GAMAVKVKLTVQKGSDKKKLALKIDYTRPN

Sequence 1 ADVSEVAVKDKGATDFSDDLKESPAKTFTYESKEPIKGPLSVRFAVKGQG
           ---SEV-----G--------K-------------P--GP---RF--K---
Sequence 2 DSLSEVELRQYGSEEWQPLTKKGDV--WEVSCSKPLVGPFNFRFLSKNGM

Sequence 1 YRTTDDVIPADFKPGSVYKTKEQV
           ----D-V---DFK-G--Y------
Sequence 2 KKVFDEVFSTDFKIGKTYEPEY--



Alignment 21
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: Q40638
Sequence identity: 26.89 (32/119)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MASSSLLLACVVVAAMVSPSPAGHPKVPPGPNITTSYGDKWLEARPPGMV

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 RPRVLAPKDNGGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKC

Sequence 1 ----------------------------------------MASSSSFLLA
           --------------------------------------------------
Sequence 2 SKPEACSDKPALIHVTDMNDEPIAAYHFDLSGLAMAKDGKDEELRKAGII

Sequence 1 MAALAALLAVGSCSTLMTWTIGKDSTSTRLVLV-----ASADVSEVAVKD
           --------------T--T--I-K-S----L-L---------DV-EV--K-
Sequence 2 DTQFRRVKCKYPADTKITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKE

Sequence 1 KGATDFSDDLKESPAKTFTYESKEPIKGPLSVRFAVKGQGYRTTDDVIPA
           KG-------LKES-----------P-KGP-SVR----G-------D-IP-
Sequence 2 KGSEEWKA-LKESWGAIWRIDTPKPLKGPFSVRVTTEGARRSSAEDAIP-

Sequence 1 DFKPGSVYKTKEQV---
           ---PG--------V---
Sequence 2 --DPGRRQRVQVNVQAK



Alignment 22
Sequence 1:
Sequence 2: Allergen Lol p 2, Sequence: CAA51775
Sequence identity: 22.69 (27/119)
Sequence 1 MASSSSFLLAMAALAALLAVGSCSTLMTWTIGKDSTSTRLVLVASAD---
           ---------------------------T---G-D-----L----S-----
Sequence 2 -------------------------EFTVEKGSDEKNLALSIKYSKEGDA

Sequence 1 VSEVAVKDKGATDFSDDLKESPAKTFTYESKEPIKGPLSVRFAVKGQGYR
           --EV--K--G-------LK----------S--P-KGP---RF--------
Sequence 2 MAEVELKEHGSNEWLA-LKKNGDGVWEIKSDKPLKGPFNFRFVSEKGMWN

Sequence 1 TTDDVIPADFKPGSVYKTKEQV
           --DDV-PADFK-G---------
Sequence 2 VFDDVVPADFKVGT--------



Alignment 23
Sequence 1:
Sequence 2: Allergen Phl p 3.0101, Sequence: 2JNZ_A
Sequence identity: 24.37 (29/119)
Sequence 1 MASSSSFLLAMAALAALLAVGSCSTLMTWTIGKDSTSTRLVL----VASA
           ---------------------------T-T--K-S----LVL--------
Sequence 2 ------------RGSHHHHHHGSAVQVTFTVQKGSDPKKLVLDIKYTRPG

Sequence 1 D-VSEVAVKDKGATDFSDDLKESPAKTFTYESKEPIKGPLSVRFAVKGQG
           D---EV-----G--------K----------S--P--GP---RF--KG--
Sequence 2 DSLAEVELRQHGSEEWEPLTKKG--NVWEVKSSKPLVGPFNFRFMSKGGM

Sequence 1 YRTTDDVIPADFKPGSVYKTKEQV
           ----D-VIP--F--G--YK--E--
Sequence 2 RNVFDEVIPTAFSIGKTYKPEE--



Alignment 24
Sequence 1:
Sequence 2: Allergen Phl p 1.0101, Sequence: CAA81613
Sequence identity: 26.05 (31/119)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWYG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 KPTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKC

Sequence 1 -------------------------------------------MASSSSF
           ------------------------------------------------S-
Sequence 2 TKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKLRSA

Sequence 1 LLAMAALAALLAVGSCSTLMTWTIGKDSTSTRLVLV-----ASADVSEVA
           -----------------T--T----K-S----L-L---------DV--V-
Sequence 2 GEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVAVD

Sequence 1 VKDKGATDFSDDLKESPAKTFTYESKEPIKGPLSVRFAVKGQGYRTTDDV
           -K-KG-------LKES----------E--KGP--VR----G-------DV
Sequence 2 IKEKGKDKWIA-LKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAKDV

Sequence 1 IPADFKPGSVYKTKEQV
           IP---K----Y--K---
Sequence 2 IPEGWKADTAYESK---



Alignment 25
Sequence 1:
Sequence 2: Allergen Hol l 1, Sequence: CAA10140
Sequence identity: 24.37 (29/119)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MASSSLVLLVVALFAVFLGTAHGIAKVPPGPNITATYGDKWLDAKSTWYG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 KPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKC

Sequence 1 -------------------------------------------MASSSSF
           ------------------------------------------------S-
Sequence 2 TKPESCSGEPIVVHITDDNEEPIAAYHLDLSGKAFGAMAKKGEEQKLRSA

Sequence 1 LLAMAALAALLAVGSCSTLMTWTIGKDSTSTRLVLV-----ASADVSEVA
           -----------------T--T----K-S----L-L---------DV--V-
Sequence 2 GELELKFRRVKCEYPKGTKVTFHVEKGSNPNYLALLVKYVDGDGDVVAVD

Sequence 1 VKDKGATDFSDDLKESPAKTFTYESKEPIKGPLSVRFAVKGQGYRTTDDV
           -K-KG-------LKES--------------GP--VR----G-------DV
Sequence 2 IKEKGKDKWIE-LKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKVEAEDV

Sequence 1 IPADFKPGSVYKTKEQV
           IP---K----Y--K---
Sequence 2 IPEGWKADTAYESK---



Alignment 26
Sequence 1:
Sequence 2: Allergen Phl p 1, Sequence: P43213
Sequence identity: 24.37 (29/119)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MASSSSVLLVVVLFAVFLGSAYGIPKVPPGPNITATYGDKWLDAKSTWYG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 KPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKC

Sequence 1 -------------------------------------------MASSSSF
           ------------------------------------------------S-
Sequence 2 TKPEACSGEPVVVHITDDNEEPIAPYHFDLSGHAFGAMAKKGDEQKLRSA

Sequence 1 LLAMAALAALLAVGSCSTLMTWTIGKDSTSTRLVLV-----ASADVSEVA
           -----------------T--T----K-S----L-L---------DV--V-
Sequence 2 GELELQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKYVNGDGDVVAVD

Sequence 1 VKDKGATDFSDDLKESPAKTFTYESKEPIKGPLSVRFAVKGQGYRTTDDV
           -K-KG-------LKES--------------GP--VR----G-------DV
Sequence 2 IKEKGKDKWIE-LKESWGAIWRIDTPDKLTGPFTVRYTTEGGTKTEAEDV

Sequence 1 IPADFKPGSVYKTKEQV
           IP---K----Y--K---
Sequence 2 IPEGWKADTSYESK---



Alignment 27
Sequence 1:
Sequence 2: Allergen Dac g 3, Sequence: P93124
Sequence identity: 23.53 (28/119)
Sequence 1 MASSSSFLLAMAALAALLAVGSCSTLMTWTIGKDSTSTRLVL----VASA
           ---------------------------T----K-S----LVL--------
Sequence 2 ------------------------VKVTFKVEKGSDPKKLVLDIKYTRPG

Sequence 1 D-VSEVAVKDKGATDFSDDLKESPAKTFTYESKEPIKGPLSVRFAVKGQG
           D---EV-----G--------K----------S--P--GP---RF--KG--
Sequence 2 DTLAEVELRQHGSEEWEPLTKKG--NLWEVKSSKPLTGPFNFRFMSKGGM

Sequence 1 YRTTDDVIPADFKPGSVYKTKEQV
           ----D-VIP--FK-G--Y---E--
Sequence 2 RNVFDEVIPTAFKIGTTYTPEE--



Alignment 28
Sequence 1:
Sequence 2: Allergen Poa p a, Sequence: CAA10520
Sequence identity: 24.37 (29/119)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MASSSSVLLVVALFAVFLGTAHGIAKVPPGPNITATYGDKWLDAKSTWYG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 KPTGAGPKDNGGACGYKDVDKAPFSGMTGCGNTPIFKSGRGCGSCFEIKC

Sequence 1 -------------------------------------------MASSSSF
           ------------------------------------------------S-
Sequence 2 TKPESCSGEPVLVHITDDNEEPIAAYHFDLSGKAFGAMAKKGEEQKLRSA

Sequence 1 LLAMAALAALLAVGSCSTLMTWTIGKDSTSTRLVLV-----ASADVSEVA
           -----------------T--T----K-S----L-L---------DV--V-
Sequence 2 GELELKFRRVKCEYPEGTKVTFHVEKGSNPNYLALLVKYVTGDGDVVAVD

Sequence 1 VKDKGATDFSDDLKESPAKTFTYESKEPIKGPLSVRFAVKGQGYRTTDDV
           -K-KG-------LKES--------------GP--VR----G-------DV
Sequence 2 IKEKGKDKWIE-LKESWGSIWRVDTPDKLTGPFTVRYTTEGGTKGEAEDV

Sequence 1 IPADFKPGSVYKTKEQV
           IP---K----Y--K---
Sequence 2 IPEGWKADTAYASK---



Alignment 29
Sequence 1:
Sequence 2: Allergen Sor h 1.0101, Sequence: ABC58726
Sequence identity: 24.37 (29/119)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 PPKVAKGKNITETYGSDWLERKATWYGKPTGAGPDDNGGACGYKDVNKAP

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 FNSMGACGNLPIFKDGLCGSCFEIKCDKPKPAECSGEAVVVHITDMNYEQ

Sequence 1 -------------------MASSSSFLLAMAALAALLAVGSCSTLMTWTI
           ----------------------------------------------T---
Sequence 2 IAAYHFDLAGHAFGAMAKKGQEEKLAKAGIIDMKFRRVKCKYGEKVTFHV

Sequence 1 GKDSTSTRLVLVA-----SADVSEVAVKDKGATDFSDDLKESPAKTFTYE
           -K-S----L-L---------D---V--K-KG--D----LK-S--------
Sequence 2 EKGSNPNYLALLVKYVDGDGDIVGVDIKEKGG-DAYQPLKHSWGAIWRKD

Sequence 1 SKEPIKGPLSVRFAVKGQGYRTTDDVIPADFKPGSVYKTKEQV
           S--PIK-P--V-----G------DDVIP---K----Y--K---
Sequence 2 SPDPIKFPVTVQITTEGGTKTAYDDVIPEGWKADTTYTAK---



Alignment 30
Sequence 1:
Sequence 2: Allergen Hol l 1.0102, Sequence: CAA93121
Sequence identity: 24.37 (29/119)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 VFLGSAHGIAKVPPGPNITATYGDEWLDAKSTWYGKPTGAGPKDNGGACG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 YKDVDKPPFSGMTGCGNTPIFKDGRGCGSCFEIKCSKPESCSGEPVTVHI

Sequence 1 ----------------------------MASSSSFLLAMAALAALLAVGS
           ---------------------------------S----------------
Sequence 2 TDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELKFRRVKCKYP

Sequence 1 CSTLMTWTIGKDSTSTRLVLVAS-----ADVSEVAVKDKGATDFSDDLKE
           --T--T----K-S----L-L---------DV--V--K-KG-------LKE
Sequence 2 DGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVAVDIKEKGKDKWIE-LKE

Sequence 1 SPAKTFTYESKEPIKGPLSVRFAVKGQGYRTTDDVIPADFKPGSVYKTKE
           S--------------GP--VR----G-------DVIP---K----Y--K-
Sequence 2 SWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAYEAK-

Sequence 1 QV
           --
Sequence 2 --



Alignment 31
Sequence 1:
Sequence 2: Allergen Hol l 1, Sequence: P43216
Sequence identity: 24.37 (29/119)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MASSSRSVLLLVAALFAVFLGSAHGIAKVPPGPNITATYGDEWLDAKSTW

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 YGKPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKDGRGCGSCFEI

Sequence 1 ---------------------------------------------MASSS
           --------------------------------------------------
Sequence 2 KCTKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKLR

Sequence 1 SFLLAMAALAALLAVGSCSTLMTWTIGKDSTSTRLVLVAS-----ADVSE
           S------------------T--T----K-S----L-L---------DV--
Sequence 2 SAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVA

Sequence 1 VAVKDKGATDFSDDLKESPAKTFTYESKEPIKGPLSVRFAVKGQGYRTTD
           V--K-KG-------LKES--------------GP--VR----G-------
Sequence 2 VDIKEKGKDKWIE-LKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAE

Sequence 1 DVIPADFKPGSVYKTKEQV
           DVIP---K----Y--K---
Sequence 2 DVIPEGWKADTAYEAK---



Alignment 32
Sequence 1:
Sequence 2: Allergen Lol p 1.0101, Sequence: AAA63279
Sequence identity: 25.21 (30/119)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 KPTGAGPKDNGGACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKC

Sequence 1 -------------------------------------------MASSSSF
           ------------------------------------------------S-
Sequence 2 TKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQNVRSA

Sequence 1 LLAMAALAALLAVGSCSTLMTWTIGKDSTSTRL-VLV----ASADVSEVA
           -----------------T--T----K-S----L--LV-------DV--V-
Sequence 2 GELELQFRRVKCKYPDDTKPTFHVEKASNPNYLAILVKYVDGDGDVVAVD

Sequence 1 VKDKGATDFSDDLKESPAKTFTYESKEPIKGPLSVRFAVKGQGYRTTDDV
           -K-KG-------LKES--------------GP--VR----G-------DV
Sequence 2 IKEKGKDKWTE-LKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEFEDV

Sequence 1 IPADFKPGSVYKTKEQV
           IP---K----Y--K---
Sequence 2 IPEGWKADTSYSAK---



Alignment 33
Sequence 1:
Sequence 2: Allergen Lol p 1.0102, Sequence: AAA63278
Sequence identity: 25.21 (30/119)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 ALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 GACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAV

Sequence 1 --------------------------------MASSSSFLLAMAALAALL
           -------------------------------------S------------
Sequence 2 TVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVK

Sequence 1 AVGSCSTLMTWTIGKDSTSTRL-VLV----ASADVSEVAVKDKGATDFSD
           ------T--T----K-S----L--LV-------DV--V--K-KG------
Sequence 2 CKYPDDTKPTFHVEKGSNPNYLAILVKYVDGDGDVVAVDIKEKGKDKWIE

Sequence 1 DLKESPAKTFTYESKEPIKGPLSVRFAVKGQGYRTTDDVIPADFKPGSVY
           -LKES--------------GP--VR----G-------DVIP---K----Y
Sequence 2 -LKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEVEDVIPEGWKADTSY

Sequence 1 KTKEQV
           --K---
Sequence 2 SAK---



Alignment 34
Sequence 1:
Sequence 2: Allergen Lol p 1.0103, Sequence: CAB63699
Sequence identity: 25.21 (30/119)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 KPTGAGPKDNGGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKC

Sequence 1 -------------------------------------------MASSSSF
           ------------------------------------------------S-
Sequence 2 TKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKLRSA

Sequence 1 LLAMAALAALLAVGSCSTLMTWTIGKDSTSTRL-VLV----ASADVSEVA
           -----------------T--T----K-S----L--LV-------DV--V-
Sequence 2 GELELQFRRVKCKYPDGTKPTFHVEKASNPNYLAILVKYVDGDGDVVAVD

Sequence 1 VKDKGATDFSDDLKESPAKTFTYESKEPIKGPLSVRFAVKGQGYRTTDDV
           -K-KG-------LKES--------------GP--VR----G-------DV
Sequence 2 IKEKGKDKWIE-LKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEVEDV

Sequence 1 IPADFKPGSVYKTKEQV
           IP---K----Y--K---
Sequence 2 IPEGWKADTSYSAK---



Alignment 35
Sequence 1:
Sequence 2: Allergen Lol p 1, Sequence: P14946
Sequence identity: 25.21 (30/119)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 KPTGAGPKDNGGACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKC

Sequence 1 -------------------------------------------MASSSSF
           ------------------------------------------------S-
Sequence 2 TKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQNVRSA

Sequence 1 LLAMAALAALLAVGSCSTLMTWTIGKDSTSTRL-VLV----ASADVSEVA
           -----------------T--T----K-S----L--LV-------DV--V-
Sequence 2 GELELQFRRVKCKYPDDTKPTFHVEKASNPNYLAILVKYVDGDGDVVAVD

Sequence 1 VKDKGATDFSDDLKESPAKTFTYESKEPIKGPLSVRFAVKGQGYRTTDDV
           -K-KG-------LKES--------------GP--VR----G-------DV
Sequence 2 IKEKGKDKWIE-LKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEFEDV

Sequence 1 IPADFKPGSVYKTKEQV
           IP---K----Y--K---
Sequence 2 IPEGWKADTSYSAK---



Alignment 36
Sequence 1:
Sequence 2: Allergen Zea m 1, Sequence: Q07154
Sequence identity: 15.13 (18/119)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVFITDMNYEPIAPY

Sequence 1 ----------------------MASSSSFLLAMAALAALLAVGSCSTLMT
           --------------------------------------------------
Sequence 2 HFDLSGKAFGSLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEK

Sequence 1 WTIGKDSTSTRLVLVASADVSEVAVKDKGATDFSDDLKESPAKTFTYESK
           ------------------D-------DK---------K-S----------
Sequence 2 GCNPNYVAVLVKFVADDGDIVLMEIQDKLSAEWKP-MKLSWGAIWRMDTA

Sequence 1 EPIKGPLSVRFAVKGQGYRTTDDVIPADFKPGSVYKTKEQV-
           ---KGP-S-R------------D-IPA---P--VY----Q--
Sequence 2 KALKGPFSIRLTSESGKKVIAKDIIPANWRPDAVYTSNVQFY



Alignment 37
Sequence 1:
Sequence 2: Allergen Zea m 1, Sequence: P58738
Sequence identity: 15.97 (19/119)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MGSLVNNIMVVGAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLTARATW

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 YGQPNGAGAPDNGGACGIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEV

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 RCKEKPECSGNPVTVYITDMNYEPIAPYHFDLSGKAFGSLAKPGLNDKIR

Sequence 1 MASSSSFLLAMAALAALLAVGSCSTLMTWTIGKDSTSTRLVLVASADVSE
           ----------------------------------------------D---
Sequence 2 HCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYLAVLVKYVADDGDIVL

Sequence 1 VAVKDKGATDFSDDLKESPAKTFTYESKEPIKGPLSVRFAVKGQGYRTTD
           ----DK---------K-S-------------KGP-S-R------------
Sequence 2 MEIQDKLSAEWKP-MKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAK

Sequence 1 DVIPADFKPGSVYKTKEQV-
           DVIPA---P--VY----Q--
Sequence 2 DVIPANWRPDAVYTSNVQFY



Alignment 38
Sequence 1:
Sequence 2: Allergen Lol p 3, Sequence: P14948
Sequence identity: 22.69 (27/119)
Sequence 1 MASSSSFLLAMAALAALLAVGSCSTLMTWTIGKDSTSTRLVL----VASA
           ------------------------T----T--K-S----LVL--------
Sequence 2 ------------------------TKVDLTVEKGSDAKTLVLNIKYTRPG

Sequence 1 D-VSEVAVKDKGATDFSDDLKESPAKTFTYESKEPIKGPLSVRFAVKGQG
           D---EV-----G--------K----------S--P--GP---RF--KG--
Sequence 2 DTLAEVELRQHGSEEWEPMTKKG--NLWEVKSAKPLTGPMNFRFLSKGGM

Sequence 1 YRTTDDVIPADFKPGSVYKTKEQV
           ----D-VIP--F--G--Y------
Sequence 2 KNVFDEVIPTAFTVGKTYTPEYN-



Alignment 39
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: AAF72988
Sequence identity: 15.97 (19/119)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MAGRSRRRSFWSVGVAAALLCLLAAHGCSAKHHKPKPTPGGISGNASSSS

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 SNSSTPSIPPPVAPTPTAPTPPIPSPGTGSSNGSSGGGGGGWLNARATWY

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 GAPNGAGPDDNGGACGFKNVNLPPFSAMTSCGNEPLFKDGKGCGSCYQIR

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 CVGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMAKDNRNDELRH

Sequence 1 -------MASSSSFLLAMAALAALLAVGSCSTLMTWTIGKDSTSTRLVLV
           --------------------------------------------------
Sequence 2 AGIIDIQFRRVPCQYPGLTVTFHVEQGSNPVYMAILVEYENGDGDVVQVD

Sequence 1 ASADVSEVAVKDKGATDFSDDLKESPAKTFTYESKEPIKGPLSVRFAVKG
           -----------D---T-------ES-----------P--GP-S-R-----
Sequence 2 LMESRYSTGGVDGTPTGVWTPMRESWGSIWRLDTNHPLQGPFSLRITNES

Sequence 1 QGYRTTDDVIPADFKPGSVYKTKEQV-
           ------D-VIPAD--P--VY----Q--
Sequence 2 GKTLIADQVIPADWQPNTVYSSIVQFD



Alignment 40
Sequence 1:
Sequence 2: Allergen Pha a 1, Sequence: Q41260
Sequence identity: 22.69 (27/119)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MMKMVCSSSSSSLLVVAALLAVFVGSAQGIAKVPPGPNITAEYGDKWLDA

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 KSTWYGKPTGAGPKDNGGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGS

Sequence 1 -------------------------------------------------M
           --------------------------------------------------
Sequence 2 CFELKCSKPESCSGEPITVHITDDNEEPIAPYHFDLSGHAFGSMAKKGEE

Sequence 1 ASSSSFLLAMAALAALLAVGSCSTLMTWTIGKDSTSTRLVLV-----ASA
           -----------------------T--T----K-S----L-L---------
Sequence 2 ENVRGAGELELQFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYVDGDG

Sequence 1 DVSEVAVKDKGATDFSDDLKESPAKTFTYESKEPIKGPLSVRFAVKGQGY
           DV--V--K-KG-------LKES--------------GP--VR----G---
Sequence 2 DVVAVDIKEKGKDKWIE-LKESWGAIWRIDTPDKLTGPFTVRYTTEGGTK

Sequence 1 RTTDDVIPADFKPGSVYKTKEQV
           ----DVIP---K-------K---
Sequence 2 AEFEDVIPEGWKADTHDASK---



Alignment 41
Sequence 1:
Sequence 2: Allergen Gly m 2, Sequence: AAA50175
Sequence identity: 13.45 (16/119)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MALTLQRALSELLTLIAILSIFLVIPSFCFNPKKLYNASYYSPSSSDWSP

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 AVATWYGPANGDGSEGGACGYGNAVGQPPFSSLISAGSPLIYDSGKGCGS

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 CYEVKCTGNSACSGNPVKVVITDECAGCGSDAQYHFDLSGNAFGAMAISG

Sequence 1 -----MASSSSFLLAMAALAALLAVGSCSTLMTWTIGKDSTSTRLVLVAS
           --------------------------------------------------
Sequence 2 QDENLRNAGKINIQHRRIECNYPGRSIAFHVDSGSNQEYFATLVEYEDGD

Sequence 1 ADVSEVAVKDKGATDFSDDLKESPAKTFTYESKEPIKGPLSVRFAVKGQG
           -D---V--K--------D----S-----------P---P-S--------G
Sequence 2 GDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPLRAPFSIKLTTLESG

Sequence 1 YR-TTDDVIPADFKPGSVYKTKEQV--
           -------VIPA---PG--Y--------
Sequence 2 QTIVANNVIPAGWTPGQTYRSIVNFAT


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.