The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Tri tu 14.0101

Sequence CAH69206

Full FASTA alignment

Sequence name:
Query sequence:
MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGNGASP
SAACCSGVRSLASSARSTADKQAACKCIKSAAAGLNAGKAAGIPTKCGVS
VPYAISSSVDCSKIR

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Tri tu 14.0101CAH69206Go!115136.22.1e-34
2Zea m 14.0101P19656-1Go!12099.72.2e-23
3Zea m 14.0102P19656-2Go!12899.03.8e-23
4Pun g 1.0201A0A059SSZ0Go!12083.61.6e-18
5Pun g 1.0301A0A059ST23Go!12081.18.6e-18
6Fra a 3.0201Q4PLU0Go!11780.81.1e-17
7Pun g 1.0101A0A059STC4Go!12080.11.8e-17
8Fra a 3.0101Q8VX12Go!11779.92.0e-17
9Mal d 3Q9M5X7Go!11579.52.5e-17
10Rub i 3.0101Q0Z8V0Go!11779.42.9e-17
11Fra a 3.0202Q4PLT6Go!11778.74.7e-17
12Fra a 3.0102Q4PLT9Go!11778.35.9e-17
13Ara h 9.0101ABX56711Go!11677.41.1e-16
14Pru av 3Q9M5X8Go!11777.21.2e-16
15Hev b 12AAL25839Go!11676.22.5e-16
16Mor n 3.0101P85894Go!9175.82.5e-16
17Pis s 3.0101A0A161AT60Go!12075.34.7e-16
18Pyr c 3Q9M5X6Go!11575.05.9e-16
19Hor v 1AAA32970Go!11774.11.1e-15
20Ara h 9.0201ABX75045Go!9273.61.2e-15
21Pru du 3.0101ACN11576Go!12374.01.3e-15
22Pha v 3.0201ADC80503Go!11873.81.4e-15
23Len c 3.0101A0AT29Go!11873.81.4e-15
24Hor v 1CAA42832Go!13473.32.1e-15
25Pru p 3CAB96876Go!9172.52.6e-15
26Can s 3.0101W0U0V5Go!9172.32.9e-15
27Pru p 3P81402Go!9172.23.3e-15
28Pru d 3P82534Go!9170.41.1e-14
29Pla or 3.0101ABY21307Go!11870.81.1e-14
30Pla a 3.0101CAL07989Go!11870.11.8e-14
31Api g 2ACV04796Go!11870.11.8e-14
32Pru ar 3P81651Go!9169.52.0e-14
33Pha v 3.0101ADC80502Go!11569.23.2e-14
34Cor a 8AAK28533Go!11568.74.7e-14
35Sola l 3.0101P93224Go!11468.55.2e-14
36Lyc e 3AAB42069Go!11468.55.2e-14
37Lup an 3.0101XP_019446786Go!11668.36.0e-14
38Tri a 14.010119846220Go!9066.71.4e-13
39Sola l 7.0101NP_001316123Go!11565.73.7e-13
40Ara h 17.0101A0A510A9S3Go!9365.43.7e-13
41Art si 3.0102ANC85027Go!11663.91.2e-12
42Art ar 3.0102ANC85020Go!11663.91.2e-12
43Art v 3.0202ACE07187Go!11663.91.2e-12
44Art gm 3.0102ANC85023Go!11763.91.2e-12
45Art gm 3.0101ANC85022Go!11763.61.6e-12
46Art an 3.0102ANC85018Go!11762.92.6e-12
47Art si 3.0101ANC85026Go!11662.43.7e-12
48Sin a 3.0101ABU95411Go!9262.03.7e-12
49Hel a 3.0101P82007Go!11661.76.0e-12
50Art ca 3.0102QIN55516Go!11761.76.0e-12
51Art v 3.0201EU564845Go!11461.56.7e-12
52Art la 3.0102ANC85025Go!11561.56.7e-12
53Art la 3.0101ANC85024Go!11661.56.8e-12
54Art ar 3.0101ANC85019Go!11661.56.8e-12
55Art an 3.0101ANC85017Go!11761.56.8e-12
56Art ca 3.0101ANC85021Go!11761.56.8e-12
57Art v 3.0301EU564847Go!11761.18.7e-12
58Par j 2O04403Go!13354.11.3e-09
59Par j 2P55958Go!13351.86.5e-09
60Amb a 6O04004Go!11848.74.8e-08
61Par j 1Q40905Go!13848.09.5e-08
62Par j 1O04404Go!17645.56.6e-07
63Par j 1P43217Go!13942.93.2e-06
64Par j 1.0103CAI94601Go!13942.54.1e-06
65Par j 1.0101CAA54587Go!13339.43.6e-05
66Vit v 1P80274Go!3733.75.1e-04
67Cas s 810998016Go!3631.71.9e-03
68Art v 3.0101P0C088Go!3730.93.5e-03
69Sola l 6.0101A0A3Q7F7X3Go!9431.46.3e-03

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Tri tu 14.0101, Sequence: CAH69206
Sequence identity: 100.00 (115/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGNGASP
           MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGNGASP
Sequence 2 MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGNGASP

Sequence 1 SAACCSGVRSLASSARSTADKQAACKCIKSAAAGLNAGKAAGIPTKCGVS
           SAACCSGVRSLASSARSTADKQAACKCIKSAAAGLNAGKAAGIPTKCGVS
Sequence 2 SAACCSGVRSLASSARSTADKQAACKCIKSAAAGLNAGKAAGIPTKCGVS

Sequence 1 VPYAISSSVDCSKIR
           VPYAISSSVDCSKIR
Sequence 2 VPYAISSSVDCSKIR



Alignment 2
Sequence 1:
Sequence 2: Allergen Zea m 14.0101, Sequence: P19656-1
Sequence identity: 66.96 (77/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLA--VTEAAVSCGQVSSALSPCISYARGNGA
           MAR-----VV--AVVA--LLA----EAA-SCGQV-SA--PCISYARG-G-
Sequence 2 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS

Sequence 1 SPSAACCSGVRSLASSARSTADKQAACKCIKSAAAG---LNAGKAAGIPT
           -PSA-CCSGVRSL---AR-TAD--AAC-C-K-AAAG---LNAG-AA-IP-
Sequence 2 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS

Sequence 1 KCGVSVPYAISSSVDCSKIR
           KCGVS-PY-IS-S-DCS---
Sequence 2 KCGVSIPYTISTSTDCSRVN



Alignment 3
Sequence 1:
Sequence 2: Allergen Zea m 14.0102, Sequence: P19656-2
Sequence identity: 66.96 (77/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLA--VTEAAVSCGQVSSALSPCISYARGNGA
           MAR-----VV--AVVA--LLA----EAA-SCGQV-SA--PCISYARG-G-
Sequence 2 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS

Sequence 1 SPSAACCSGVRSLASSARSTADKQAACKCIKSAAA---GLNAGKAAGIPT
           -PSA-CCSGVRSL---AR-TAD--AAC-C-K-AAA---GLNAG-AA-IP-
Sequence 2 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS

Sequence 1 KCGVSVPYAISSSVDCSKIR--------
           KCGVS-PY-IS-S-DCS-----------
Sequence 2 KCGVSIPYTISTSTDCSRYSRRMHASAD



Alignment 4
Sequence 1:
Sequence 2: Allergen Pun g 1.0201, Sequence: A0A059SSZ0
Sequence identity: 53.91 (62/115)
Sequence 1 -----MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARG
           ----------V----L--VVAA----V-E-AV-CGQV-S-L-PCI-YARG
Sequence 2 MASKRFLNNLVPALFLCMVVAA---SVVESAVTCGQVTSSLTPCIPYARG

Sequence 1 NGASPSAACCSGVRSLASSARSTADKQAACKCIKSAA---AGLNAGKAAG
           --A-PSAACCSGVRSL---A--T-D-Q-AC-C-K--A----G-N-G----
Sequence 2 VVAAPSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGA

Sequence 1 IPTKCGVSVPYAISSSVDCSKIR
           -P-KCGVS-PY-IS-S-DCS---
Sequence 2 LPGKCGVSIPYKISPSTDCSRVK



Alignment 5
Sequence 1:
Sequence 2: Allergen Pun g 1.0301, Sequence: A0A059ST23
Sequence identity: 53.04 (61/115)
Sequence 1 MARSAVAQVV-LVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGNGAS
           MA-S--------V-V--A----V-EA---CGQVSS-L--CI-YARGNGA-
Sequence 2 MASSGFLRLAGFVLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAG

Sequence 1 P-SAACCSGVRSLASSARSTADKQAACKCIKSAAA---GLNAGKAAGIPT
           P---ACC-G-RSL-S-A--T-D-QAAC-C-KS-A----G-N-G--AG-P-
Sequence 2 PVPQACCNGIRSLNSAAKTTPDRQAACRCLKSLASSISGINYGLVAGAPG

Sequence 1 KCGVSVPYAISSSVDCSKIR
           KCGVS-PY-I--S--C----
Sequence 2 KCGVSIPYKIAPSTNCDNVK



Alignment 6
Sequence 1:
Sequence 2: Allergen Fra a 3.0201, Sequence: Q4PLU0
Sequence identity: 49.57 (57/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGNGASP
           MA-S------LVA------------A--CGQV-S--SPC--Y----GA-P
Sequence 2 MASSTAMKLSLVALLCIVVALPIAQAITCGQVASSISPCVNYVKSGGAVP

Sequence 1 SAACCSGVRSLASSARSTADKQAACKCIKSAAA---GLNAGKAAGIPTKC
           -AACC-G-RSL-S-A--TAD-QA-C-C-K-A-----GLN---AAG-P-KC
Sequence 2 -AACCNGIRSLNSAAKTTADRQATCNCLKQASGAIKGLNPSLAAGLPGKC

Sequence 1 GVSVPYAISSSVDCSKIR
           GVSVPY-IS-S--C----
Sequence 2 GVSVPYKISTSTNCAAVK



Alignment 7
Sequence 1:
Sequence 2: Allergen Pun g 1.0101, Sequence: A0A059STC4
Sequence identity: 50.43 (58/115)
Sequence 1 ----MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGN
           ------------V--VA-VAA-----TEAAV-CGQV-S-L-PCI-YAR--
Sequence 2 MTGSGLFKLACAVFAVALVAAPI--ATEAAVTCGQVASSLAPCIPYARSA

Sequence 1 GASPSAACCSGVRSLASSARSTADKQAACKCIKSAA---AGLNAGKAAGI
           G-----ACCSG---L---AR-T-D-QA-CKC-KSA-----G-N-G--A--
Sequence 2 GGAVPPACCSGIKTLDGMARTTPDRQATCKCLKSASTSISGINYGLVASL

Sequence 1 PTKCGVSVPYAISSSVDCSKIR
           P-KCGV--PY-IS-S-DC----
Sequence 2 PAKCGVNIPYKISPSTDCARVK



Alignment 8
Sequence 1:
Sequence 2: Allergen Fra a 3.0101, Sequence: Q8VX12
Sequence identity: 49.57 (57/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGNGASP
           MA-S------LVA------------A--CGQV-S--SPC--Y----GA-P
Sequence 2 MASSTAMKLSLVALLCIVVALPIAQAITCGQVASNISPCLTYVKSGGAVP

Sequence 1 SAACCSGVRSLASSARSTADKQAACKCIKSAAAG---LNAGKAAGIPTKC
           -AACCSG-R-L---A--TAD-QAAC-C-K-AA-G---LN---AAG-P-KC
Sequence 2 -AACCSGIRNLNGMAKTTADRQAACNCLKQAAGGIKGLNPNLAAGLPGKC

Sequence 1 GVSVPYAISSSVDCSKIR
           GVSVPY-IS----C----
Sequence 2 GVSVPYKISTTTNCAAVK



Alignment 9
Sequence 1:
Sequence 2: Allergen Mal d 3, Sequence: Q9M5X7
Sequence identity: 51.30 (59/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAVTEA-AVSCGQVSSALSPCISYARGNGAS
           MA-SAV------A-V-A---AV--A-A--CGQV-S-L-PCI-Y-R--GA-
Sequence 2 MASSAVTKL---ALVVALCMAVSVAHAITCGQVTSSLAPCIGYVRSGGAV

Sequence 1 PSAACCSGVRSLASSARSTADKQAACKCIKSAA---AGLNAGKAAGIPTK
           P-A-CC-G-R-----AR-TAD-Q-AC-C-K--A----G-N---AAG-P-K
Sequence 2 PPA-CCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGK

Sequence 1 CGVSVPYAISSSVDCSKIR
           CGV-VPY-IS-S--C----
Sequence 2 CGVNVPYKISTSTNCATVK



Alignment 10
Sequence 1:
Sequence 2: Allergen Rub i 3.0101, Sequence: Q0Z8V0
Sequence identity: 49.57 (57/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGNGASP
           MA-SAV----LVA------------A--CGQV-----PC--Y----GA-P
Sequence 2 MACSAVMKLALVALLCIVVAVPVAQAITCGQVTQNVAPCFNYVKNGGAVP

Sequence 1 SAACCSGVRSLASSARSTADKQAACKCIKSAAA---GLNAGKAAGIPTKC
           -AACC-GVR-L-S-A--TAD-Q--C-C-K-AA----GLN---AAG-P-KC
Sequence 2 -AACCNGVRNLNSQAKTTADRQQTCNCLKNAAGSIPGLNPSLAAGLPGKC

Sequence 1 GVSVPYAISSSVDCSKIR
           GVSVPY-IS-S--C----
Sequence 2 GVSVPYKISTSTNCATVK



Alignment 11
Sequence 1:
Sequence 2: Allergen Fra a 3.0202, Sequence: Q4PLT6
Sequence identity: 47.83 (55/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGNGASP
           MA-S------LVA------------A--CGQV-S--SPC--Y----GA-P
Sequence 2 MAISTAMKLSLVALLCIVVALPIAQAITCGQVASSISPCVNYVKSGGAVP

Sequence 1 SAACCSGVRSLASSARSTADKQAACKCIKSAAA---GLNAGKAAGIPTKC
           -AACC-G-RSL-S-A--TAD-Q--C-C-K-A-----GLN---AAG-P-KC
Sequence 2 -AACCNGIRSLNSAAKTTADRQTTCNCLKQASGAIKGLNPNLAAGLPGKC

Sequence 1 GVSVPYAISSSVDCSKIR
           GV-VPY-IS-S--C----
Sequence 2 GVNVPYKISTSTNCAAVK



Alignment 12
Sequence 1:
Sequence 2: Allergen Fra a 3.0102, Sequence: Q4PLT9
Sequence identity: 47.83 (55/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGNGASP
           MA-S------LVA------------A--CGQV-S--SPC--Y----GA-P
Sequence 2 MASSTAMKLSLVALLCIVVALPIAQAITCGQVASNISPCVTYVKSGGAVP

Sequence 1 SAACCSGVRSLASSARSTADKQAACKCIKSAAAG---LNAGKAAGIPTKC
           -A-CCSG-R-L---A--TAD-QA-C-C-K-AA-G---LN---AAG-P-KC
Sequence 2 -APCCSGIRNLNGMAKTTADRQATCNCLKQAAGGIKGLNPNLAAGLPGKC

Sequence 1 GVSVPYAISSSVDCSKIR
           GVSVPY-IS----C----
Sequence 2 GVSVPYKISTTTNCAAVK



Alignment 13
Sequence 1:
Sequence 2: Allergen Ara h 9.0101, Sequence: ABX56711
Sequence identity: 53.91 (62/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGNGASP
           MA----A-V-LV----AM--A----A-SCGQV-SAL-PCI------GA-P
Sequence 2 MASLKFAFVMLVCM--AMVGAPMVNAISCGQVNSALAPCIPFLTKGGAPP

Sequence 1 SAACCSGVRSLASSARSTADKQAACKCIKSAAA---GLNAGKAAGIPTKC
           -A-CCSGVR-L----R-TAD-QAAC-C-K-AA----GLN-G-AA--P--C
Sequence 2 PA-CCSGVRGLLGALRTTADRQAACNCLKAAAGSLRGLNQGNAAALPGRC

Sequence 1 GVSVPYAISSSVDCSKIR-
           GVS-PY-IS-S--C--I--
Sequence 2 GVSIPYKISTSTNCATIKF



Alignment 14
Sequence 1:
Sequence 2: Allergen Pru av 3, Sequence: Q9M5X8
Sequence identity: 51.30 (59/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAVTEA-AVSCGQVSSALSPCISYARGNGAS
           MA-SA-----LV-V---M---V--A-A--CGQVSS-L-PCI-Y-RG-GA-
Sequence 2 MACSAMTKLALV-VALCMVVSVPIAQALTCGQVSSNLAPCIAYVRGGGAV

Sequence 1 PSAACCSGVRSLASSARSTADKQAACKCIKSAAA---GLNAGKAAGIPTK
           P-A-CC-G-R-----A--TAD-Q-AC-C-K---A---G-NA--AA--P-K
Sequence 2 PPA-CCNGIRNINNLAKTTADRQTACNCLKQLSASVPGVNANNAAALPGK

Sequence 1 CGVSVPYAISSSVDCSKIR
           CGV-VPY-IS-S--C----
Sequence 2 CGVNVPYKISPSTNCATVK



Alignment 15
Sequence 1:
Sequence 2: Allergen Hev b 12, Sequence: AAL25839
Sequence identity: 47.83 (55/115)
Sequence 1 -MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGNGAS
           --A---V---VL---VAA---A----A--CGQV-SAL-PC-SY----G--
Sequence 2 MAALKMVSFLVLCMLVAAPMTA---QAITCGQVQSALVPCLSYLKTTGPT

Sequence 1 PSAACCSGVRSLASSARSTADKQAACKCIKSAAA---GLNAGKAAGIPTK
           P-A-CC-GVR-----A--TAD---AC-C-KSAA----GLN----AG-P-K
Sequence 2 PPATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGK

Sequence 1 CGVSVPYAISSSVDCSKIR
           CGV--PY-IS-S--C----
Sequence 2 CGVNIPYKISLSTNCATVK



Alignment 16
Sequence 1:
Sequence 2: Allergen Mor n 3.0101, Sequence: P85894
Sequence identity: 46.96 (54/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGNGASP
           ----------------------------CGQVSS-L-PCI-Y-R--G--P
Sequence 2 --------------------------ITCGQVSSSLAPCINYLRAGGVVP

Sequence 1 SAACCSGVRSLASSARSTADKQAACKCIKSA---AAGLNAGKAAGIPTKC
           -A-CC-GVRSL---A--TAD-QAAC-C-KSA-----GLN---AAG-P-KC
Sequence 2 -ANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKC

Sequence 1 GVSVPYAISSSVDCSKIR
           GVSVPY-IS-S-DC----
Sequence 2 GVSVPYKISPSTDCKSVK



Alignment 17
Sequence 1:
Sequence 2: Allergen Pis s 3.0101, Sequence: A0A161AT60
Sequence identity: 51.30 (59/115)
Sequence 1 MARSA----VAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARG-
           MARS-----VA-V----V-A-M-----EAA-SCG-VS----PC--Y----
Sequence 2 MARSMKLACVALVICMVVIAPM----AEAALSCGTVSADMAPCVTYLQAP

Sequence 1 NGASPSAACCSGVRSLASSARSTADKQAACKCIKSAAAG---LNAGKAAG
           N-ASP---CC-GV--L---A--T-D-QAAC-C-KSAA-----LN---AA-
Sequence 2 NNASPPPPCCAGVKKLLAAATTTPDRQAACNCLKSAAGSIPKLNTNNAAA

Sequence 1 IPTKCGVSVPYAISSSVDCSKIR-
           -P-KCGVS-PY-IS-S--C---R-
Sequence 2 LPGKCGVSIPYKISTSTNCNTVRF



Alignment 18
Sequence 1:
Sequence 2: Allergen Pyr c 3, Sequence: Q9M5X6
Sequence identity: 47.83 (55/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAVTEA-AVSCGQVSSALSPCISYARGNGAS
           MA-SAV------A-V-A---AV--A-A--C-QVS--L-PCI-Y-R--GA-
Sequence 2 MASSAVIKL---ALVVALCMAVSVAHAITCSQVSANLAPCINYVRSGGAV

Sequence 1 PSAACCSGVRSLASSARSTADKQAACKCIKSAA---AGLNAGKAAGIPTK
           P-A-CC-G-------A--T-D-QAAC-C-K--A----G-N-G-A---P-K
Sequence 2 PPA-CCNGIKTINGLAKTTPDRQAACNCLKNLAGSVSGVNPGNAESLPGK

Sequence 1 CGVSVPYAISSSVDCSKIR
           CGV-VPY-IS-S--C----
Sequence 2 CGVNVPYKISTSTNCATVK



Alignment 19
Sequence 1:
Sequence 2: Allergen Hor v 1, Sequence: AAA32970
Sequence identity: 48.70 (56/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAVTEAAV--SCGQVSSALSPCISYARGNGA
           MAR--V------A----ML-A---AAV---CGQV-S---PC--Y--G-G-
Sequence 2 MARAQV--LLMAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYVQG-GP

Sequence 1 SPSAACCSGVRSLASSARSTADKQAACKCIKSAAAG---LNAGKAAGIPT
           -PS--CC-GVR-L---A-S--D-Q--C-C-K--A-G---LN---AA-IP-
Sequence 2 GPSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPS

Sequence 1 KCGVSVPYAISSSVDCSKIR
           KC-V-VPY-IS---DCS-I-
Sequence 2 KCNVNVPYTISPDIDCSRIY



Alignment 20
Sequence 1:
Sequence 2: Allergen Ara h 9.0201, Sequence: ABX75045
Sequence identity: 44.35 (51/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGNGASP
           ---------------------------SCGQV-SAL-PCI------G--P
Sequence 2 --------------------------LSCGQVNSALAPCITFLTKGGV-P

Sequence 1 SAACCSGVRSLASSARSTADKQAACKCIKSAAA---GLNAGKAAGIPTKC
           S--CCSGVR-L---A--TAD-QAAC-C-K-AA----GLN-G-AA--P--C
Sequence 2 SGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHGLNQGNAAALPGRC

Sequence 1 GVSVPYAISSSVDCSKIR-
           GVS-PY-IS-S--C--I--
Sequence 2 GVSIPYKISTSTNCATIKF



Alignment 21
Sequence 1:
Sequence 2: Allergen Pru du 3.0101, Sequence: ACN11576
Sequence identity: 52.17 (60/115)
Sequence 1 --MARSAVAQVVLVAVVAAMLLAVTEA--AVSCGQVSSALSPCISYARGN
           ----------V-LVAV---M------A--AVSCGQV---L-PCI-Y----
Sequence 2 MASSGQLLKLVCLVAVMCCMAVGGPKAMAAVSCGQVVNNLTPCINYVANG

Sequence 1 GA-SPSAACCSGVRSLASSARSTADKQAACKCIKSAAAGL-----NAGKA
           GA--PS--CC-GVRSL-S-A--TAD-Q--C-C-K-A--G------NAG-A
Sequence 2 GALNPS--CCTGVRSLYSLAQTTADRQSICNCLKQAVNGIPYTNANAGLA

Sequence 1 AGIPTKCGVSVPYAISSSVDCSKIR
           AG-P-KCGV--PY-IS-S-DC--I-
Sequence 2 AGLPGKCGVNIPYKISPSTDCKTIK



Alignment 22
Sequence 1:
Sequence 2: Allergen Pha v 3.0201, Sequence: ADC80503
Sequence identity: 48.70 (56/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGNGASP
           MA----A-VV-V------------AA-SCGQV-S-L--CI------G--P
Sequence 2 MATLNSACVVAVLCLVVLTAPTAHAAISCGQVTSSLASCIPFLTKGGPVP

Sequence 1 SAACCSGVRSLASSARSTADKQAACKCIKSAAA---GLNAGKAAGIPTKC
           -A-CCSGVRSL---A--T-D-QA-C-C-KSAA----G-NA--A---P-KC
Sequence 2 -ASCCSGVRSLNAAAKTTPDRQAVCNCLKSAAGAIPGFNANNAGILPGKC

Sequence 1 GVSVPYAISSSVDCSKIR-
           GVS-PY-IS-S--C--I--
Sequence 2 GVSIPYKISTSTNCATIKF



Alignment 23
Sequence 1:
Sequence 2: Allergen Len c 3.0101, Sequence: A0AT29
Sequence identity: 44.35 (51/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGNGASP
           MAR------V-------------E-A-SCG-V-S-LSPC--Y--G-G--P
Sequence 2 MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTG-GPGP

Sequence 1 SAACCSGVRSLASSARSTADKQAACKCIKSAAAG---LNAGKAAGIPTKC
           S--CC-GV--L---A--T-D-QAAC-C-KSAA-----LN---AA--P-KC
Sequence 2 SPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKC

Sequence 1 GVSVPYAISSSVDCSKIR-
           GV--PY-IS----C-----
Sequence 2 GVNIPYKISTTTNCNTVKF



Alignment 24
Sequence 1:
Sequence 2: Allergen Hor v 1, Sequence: CAA42832
Sequence identity: 47.83 (55/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAVTEAAVS--CGQVSSALSPCISYARGNGA
           MAR--V------A----ML-A---AAV---CGQV-S---PC--Y--G-G-
Sequence 2 MARAQV--LLMAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYVQG-GP

Sequence 1 SPSAACCSGVRSLASSARSTADKQAACKCIKSAAAG---LNAGKAAGIPT
           -PS--CC-GVR-L---A-S--D-Q--C-C-K--A-G---LN---AA-IP-
Sequence 2 GPSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPS

Sequence 1 KCGVSVPYAISSSVDCSKIR-----------------
           KC-V-VPY-IS---DCS--------------------
Sequence 2 KCNVNVPYTISPDIDCSRFTERRSVKLVLSSSIHVEL



Alignment 25
Sequence 1:
Sequence 2: Allergen Pru p 3, Sequence: CAB96876
Sequence identity: 41.74 (48/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGNGASP
           ----------------------------CGQVSS-L-PCI-Y-RG-GA-P
Sequence 2 --------------------------ITCGQVSSSLAPCIPYVRGGGAVP

Sequence 1 SAACCSGVRSLASSARSTADKQAACKCIKSAAA---GLNAGKAAGIPTKC
           -A-CC-G-R-----AR-T-D-QAAC-C-K---A---G-N---AA--P-KC
Sequence 2 PA-CCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKC

Sequence 1 GVSVPYAISSSVDCSKIR
           GVS-PY-IS-S--C----
Sequence 2 GVSIPYKISASTNCATVK



Alignment 26
Sequence 1:
Sequence 2: Allergen Can s 3.0101, Sequence: W0U0V5
Sequence identity: 41.74 (48/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGNGASP
           ----------------------------CGQV-S-L-PC-SY----GA-P
Sequence 2 --------------------------ITCGQVASSLAPCLSYLKVGGAVP

Sequence 1 SAACCSGVRSLASSARSTADKQAACKCIKSAAA---GLNAGKAAGIPTKC
           ---CC----SL---A---AD-QAACKC-KSAA----G-N---A-G-P-KC
Sequence 2 DG-CCNDIKSLSGAAKTPADRQAACKCLKSAASSIKGVNFNLASGLPGKC

Sequence 1 GVSVPYAISSSVDCSKIR
           GVS-PY-IS-S-DCS---
Sequence 2 GVSIPYKISPSTDCSSVK



Alignment 27
Sequence 1:
Sequence 2: Allergen Pru p 3, Sequence: P81402
Sequence identity: 41.74 (48/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGNGASP
           ----------------------------CGQVSSAL-PCI-Y-RG-GA-P
Sequence 2 --------------------------ITCGQVSSALAPCIPYVRGGGAVP

Sequence 1 SAACCSGVRSLASSARSTADKQAACKCIKSAAA---GLNAGKAAGIPTKC
           -A-CC-G-R-----AR-T-D-QAAC-C-K---A---G-N---AA--P-KC
Sequence 2 PA-CCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKC

Sequence 1 GVSVPYAISSSVDCSKIR
           GV--PY-IS-S--C----
Sequence 2 GVHIPYKISASTNCATVK



Alignment 28
Sequence 1:
Sequence 2: Allergen Pru d 3, Sequence: P82534
Sequence identity: 40.00 (46/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGNGASP
           ----------------------------CGQVSS-L-PCI-Y--G-GA-P
Sequence 2 --------------------------ITCGQVSSNLAPCINYVKGGGAVP

Sequence 1 SAACCSGVRSLASSARSTADKQAACKCIKSAAA---GLNAGKAAGIPTKC
           -A-CC-G-R-----AR-TAD--AAC-C-K-------G-N---AA--P-KC
Sequence 2 PA-CCNGIRNVNNLARTTADRRAACNCLKQLSGSIPGVNPNNAAALPGKC

Sequence 1 GVSVPYAISSSVDCSKIR
           GV-VPY-IS-S--C----
Sequence 2 GVNVPYKISASTNCATVK



Alignment 29
Sequence 1:
Sequence 2: Allergen Pla or 3.0101, Sequence: ABY21307
Sequence identity: 45.22 (52/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAV--TEAAVSCGQVSSALSPCISYARGNGA
           MA-S-VA--------A-M-------EAA--CG-V---L-PC--Y-R--GA
Sequence 2 MAFSRVAKLACL-LLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGA

Sequence 1 SPSAACCSGVRSLASSARSTADKQAACKCIKSAA---AGLNAGKAAGIPT
           ----ACC-GV--L---A--T-D-QAAC-C-K-A-----G---G-AA----
Sequence 2 V-APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAG

Sequence 1 KCGVSVPYAISSSVDCSKIR
           KCGV--PY-IS---DCSK--
Sequence 2 KCGVNLPYKISPTIDCSKVK



Alignment 30
Sequence 1:
Sequence 2: Allergen Pla a 3.0101, Sequence: CAL07989
Sequence identity: 44.35 (51/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAV--TEAAVSCGQVSSALSPCISYARGNGA
           MA-S-VA--------A-M-------EAA--CG-V---L-PC----R--GA
Sequence 2 MAFSRVAKLACL-LLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGA

Sequence 1 SPSAACCSGVRSLASSARSTADKQAACKCIKSAA---AGLNAGKAAGIPT
           ----ACC-GV--L---A--T-D-QAAC-C-K-A-----G---G-AA----
Sequence 2 V-APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAG

Sequence 1 KCGVSVPYAISSSVDCSKIR
           KCGV--PY-IS---DCSK--
Sequence 2 KCGVNLPYKISPTIDCSKVK



Alignment 31
Sequence 1:
Sequence 2: Allergen Api g 2, Sequence: ACV04796
Sequence identity: 43.48 (50/115)
Sequence 1 --MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGNGA
           ------A-A--V---VV-----AV-E----CGQV---L--C--Y--G-G-
Sequence 2 MGVSKVAIAVAVMLMVVVINHPAVVEG-LTCGQVTGKLGGCLGYLKGGGY

Sequence 1 SPSAACCSGVRSLASSARSTADKQAACKCIKSAAA---GLNAGKAAGIPT
           -PS-ACC-GV--L-S-A---AD---AC-C-K--A----G-N-G-A---P-
Sequence 2 -PSPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPG

Sequence 1 KCGVSVPYAISSSVDCSKIR
           KCG---PY-IS-S-DCS---
Sequence 2 KCGIRIPYPISPSTDCSRVN



Alignment 32
Sequence 1:
Sequence 2: Allergen Pru ar 3, Sequence: P81651
Sequence identity: 38.26 (44/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGNGASP
           ----------------------------CGQVSS-L-PCI-Y-RG-GA-P
Sequence 2 --------------------------ITCGQVSSSLAPCIGYVRGGGAVP

Sequence 1 SAACCSGVRSLASSARSTADKQAACKCIKS---AAAGLNAGKAAGIPTKC
           -A-CC-G-R-----AR-T-D---AC-C-K-------G-N---AA--P-KC
Sequence 2 PA-CCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAAALPGKC

Sequence 1 GVSVPYAISSSVDCSKIR
           GV--PY-IS-S--C----
Sequence 2 GVNIPYKISASTNCATVK



Alignment 33
Sequence 1:
Sequence 2: Allergen Pha v 3.0101, Sequence: ADC80502
Sequence identity: 45.22 (52/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGNGASP
           MA----A-VV----V-----A-T-----CGQV-S-L-PC-------G--P
Sequence 2 MASVKFACVVVLCMV--VVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVP

Sequence 1 SAACCSGVRSLASSARSTADKQAACKCIKSAAA---GLNAGKAAGIPTKC
           -A-CC-GVR----SARSTAD----C-C-K-AA----GLN---A---P-KC
Sequence 2 -AGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKC

Sequence 1 GVSVPYAISSSVDCSKIR
           GV--PY-IS-S--C--I-
Sequence 2 GVNIPYKISTSTNCASIN



Alignment 34
Sequence 1:
Sequence 2: Allergen Cor a 8, Sequence: AAK28533
Sequence identity: 41.74 (48/115)
Sequence 1 -MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGNGAS
           ------V--V-L---VAA----V--A---C-Q----L-PC--Y----G--
Sequence 2 MGSLKLVCAVLLCMMVAA---PVARASLTCPQIKGNLTPCVLYLKNGGVL

Sequence 1 PSAACCSGVRSLASSARSTADKQAACKCIKSAA---AGLNAGKAAGIPTK
           P---CC-GVR------R-T-D-Q-AC-C-K--A---AGLN---AAG-P-K
Sequence 2 PPS-CCKGVRAVNDASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGK

Sequence 1 CGVSVPYAISSSVDCSKIR
           CGV--PY-IS-S--C----
Sequence 2 CGVNIPYKISPSTNCNNVK



Alignment 35
Sequence 1:
Sequence 2: Allergen Sola l 3.0101, Sequence: P93224
Sequence identity: 41.74 (48/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAVTEA-AVSCGQVSSALSPCISYARGNGAS
           -------------VV--M------A---SCG-V-S-L-PC--Y--G-G--
Sequence 2 ---MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRG--

Sequence 1 PSAACCSGVRSLASSARSTADKQAACKCIKSAA---AGLNAGKAAGIPTK
           P---CC-GV--L---A----D---AC-C-KSAA----G---GKAAG-P--
Sequence 2 PLGGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGV

Sequence 1 CGVSVPYAISSSVDCSKIR
           CGV--PY-IS-S-DCS---
Sequence 2 CGVNIPYKISPSTDCSTVQ



Alignment 36
Sequence 1:
Sequence 2: Allergen Lyc e 3, Sequence: AAB42069
Sequence identity: 41.74 (48/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAVTEA-AVSCGQVSSALSPCISYARGNGAS
           -------------VV--M------A---SCG-V-S-L-PC--Y--G-G--
Sequence 2 ---MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRG--

Sequence 1 PSAACCSGVRSLASSARSTADKQAACKCIKSAA---AGLNAGKAAGIPTK
           P---CC-GV--L---A----D---AC-C-KSAA----G---GKAAG-P--
Sequence 2 PLGGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGV

Sequence 1 CGVSVPYAISSSVDCSKIR
           CGV--PY-IS-S-DCS---
Sequence 2 CGVNIPYKISPSTDCSTVQ



Alignment 37
Sequence 1:
Sequence 2: Allergen Lup an 3.0101, Sequence: XP_019446786
Sequence identity: 41.74 (48/115)
Sequence 1 ---MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGNG
           -------A-A------VV-A-L------A--CGQV---L--C--Y-R--G
Sequence 2 MAGIVKLACAVLICMVVVSAPLTK----AITCGQVTANLAQCLNYLRSGG

Sequence 1 ASPSAACCSGVRSLASSARSTADKQAACKCIKSAAA---GLNAGKAAGIP
           A-P-A-CC-G-------A--T-D---AC-C-K-AAA---GLN---A---P
Sequence 2 AVP-APCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLP

Sequence 1 TKCGVSVPYAISSSVDCSKIR
           -KCGV--PY-IS-S--C--I-
Sequence 2 GKCGVNIPYKISTSTNCASIK



Alignment 38
Sequence 1:
Sequence 2: Allergen Tri a 14.0101, Sequence: 19846220
Sequence identity: 38.26 (44/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGNGASP
           ----------------------------CG-V-S---PC-SY--G-G--P
Sequence 2 --------------------------IDCGHVDSLVRPCLSYVQG-GPGP

Sequence 1 SAACCSGVRSLASSARSTADKQAACKCIKSAAAG---LNAGKAAGIPTKC
           S--CC-GV--L---ARS--D-Q-AC-C-K--A-G---LN---A--IP-KC
Sequence 2 SGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKC

Sequence 1 GVSVPYAISSSVDCSKIR
           GV--PY-IS---DCS---
Sequence 2 GVNLPYTISLNIDCSRV-



Alignment 39
Sequence 1:
Sequence 2: Allergen Sola l 7.0101, Sequence: NP_001316123
Sequence identity: 40.00 (46/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGNGASP
           ----A-A--VLV------L--V---A--CGQV---L-PC-------G--P
Sequence 2 --MKAIAILVLVVLAVFQLAMVARGAITCGQVDANLAPCVPFLT-QGGEP

Sequence 1 SAACCSGVRSLASSARSTADKQAACKCIKSAA---AGLNAGKAAGIPTKC
           -AACCSGVR-L-----S--D---AC-C-K-AA-----L----A---P-KC
Sequence 2 GAACCSGVRTLNGNTQSSDDRRTACNCVKAAANRYPNLKDDAAQSLPSKC

Sequence 1 GVSVPYAISSSVDCSKIR
           G-S----IS--V-C--I-
Sequence 2 GISLTVPISRTVNCDTIS



Alignment 40
Sequence 1:
Sequence 2: Allergen Ara h 17.0101, Sequence: A0A510A9S3
Sequence identity: 36.52 (42/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGNGASP
           -------------------------A--C--V-----PC--Y----G---
Sequence 2 -------------------------AIQCSFVTKSIAPCFGYLK-SGGTV

Sequence 1 SAACCSGVRSLASSARSTADKQAACKCIKSAAAGL----NAGKAAGIPTK
           S--CCSG-------A--T-D-QA-C-C-KSAAA-L----N---AA--P-K
Sequence 2 SGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLPGK

Sequence 1 CGVSVPYAISSSVDCSKIR
           CGVS-PY-IS-S--CS-I-
Sequence 2 CGVSIPYKISTSINCSSIK



Alignment 41
Sequence 1:
Sequence 2: Allergen Art si 3.0102, Sequence: ANC85027
Sequence identity: 37.39 (43/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAVTEA-AVSCGQVSSALSPCISYARGNGAS
           ------------A-V--M-L----A-A--C--VS----PC--Y----G--
Sequence 2 --MAMKMMKFFCAMVVCMVLSSSYAEALTCSDVSNKITPCLNYLKQGGEV

Sequence 1 PSAACCSGVRSLASSARSTADKQAACKCIKSA---AAGLNAGKAAGIPTK
           P-A-CC-GV--L---A--T-D-Q-AC-C-K--------L----AA--P-K
Sequence 2 P-ADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSK

Sequence 1 CGVSVPYAISSSVDCSKIR
           CGV--PY-IS---DC-K--
Sequence 2 CGVNIPYKISLETDCNKVK



Alignment 42
Sequence 1:
Sequence 2: Allergen Art ar 3.0102, Sequence: ANC85020
Sequence identity: 37.39 (43/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAVTEA-AVSCGQVSSALSPCISYARGNGAS
           ------------A-V--M-L----A-A--C--VS----PC--Y----G--
Sequence 2 --MAMKMMKFFCAMVVCMVLSSSYAEALTCSDVSNKITPCLNYLKQGGEV

Sequence 1 PSAACCSGVRSLASSARSTADKQAACKCIKSA---AAGLNAGKAAGIPTK
           P-A-CC-GV--L---A--T-D-Q-AC-C-K--------L----AA--P-K
Sequence 2 P-ADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSK

Sequence 1 CGVSVPYAISSSVDCSKIR
           CGV--PY-IS---DC-K--
Sequence 2 CGVNIPYKISLETDCNKVK



Alignment 43
Sequence 1:
Sequence 2: Allergen Art v 3.0202, Sequence: ACE07187
Sequence identity: 37.39 (43/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAVTEA-AVSCGQVSSALSPCISYARGNGAS
           ------------A-V--M-L----A-A--C--VS----PC--Y----G--
Sequence 2 --MAMKMMKFFCAMVVCMVLSSSYAEALTCSDVSNKITPCLNYLKQGGEV

Sequence 1 PSAACCSGVRSLASSARSTADKQAACKCIKSA---AAGLNAGKAAGIPTK
           P-A-CC-GV--L---A--T-D-Q-AC-C-K--------L----AA--P-K
Sequence 2 P-ADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSK

Sequence 1 CGVSVPYAISSSVDCSKIR
           CGV--PY-IS---DC-K--
Sequence 2 CGVNIPYKISLETDCNKVK



Alignment 44
Sequence 1:
Sequence 2: Allergen Art gm 3.0102, Sequence: ANC85023
Sequence identity: 37.39 (43/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAVT--EAAVSCGQVSSALSPCISYARGNGA
           ---------V----V--M-------EAA--C--VS---SPC-S-----G-
Sequence 2 --MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKISPCLSFLKQGGE

Sequence 1 SPSAACCSGVRSLASSARSTADKQAACKCIKS---AAAGLNAGKAAGIPT
           -P-A-CC-GV--L---A--T-D-Q-AC-C-K--------L----A---P-
Sequence 2 VP-ADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDNAVVLPS

Sequence 1 KCGVSVPYAISSSVDCSKIR
           KCGV--PY-IS---DC-K--
Sequence 2 KCGVNIPYKISLETDCNKVK



Alignment 45
Sequence 1:
Sequence 2: Allergen Art gm 3.0101, Sequence: ANC85022
Sequence identity: 37.39 (43/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAVT--EAAVSCGQVSSALSPCISYARGNGA
           ---------V----V--M-------EAA--C--VS---SPC-S-----G-
Sequence 2 --MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKISPCTSFLKQGGE

Sequence 1 SPSAACCSGVRSLASSARSTADKQAACKCIKS---AAAGLNAGKAAGIPT
           -P-A-CC-GV--L---A--T-D-Q-AC-C-K-------------AA--P-
Sequence 2 VP-ADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDFKSDNAAVLPS

Sequence 1 KCGVSVPYAISSSVDCSKIR
           KCGV--PY-IS---DC-K--
Sequence 2 KCGVNIPYKISLETDCNKVK



Alignment 46
Sequence 1:
Sequence 2: Allergen Art an 3.0102, Sequence: ANC85018
Sequence identity: 38.26 (44/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGNGASP
           MA-----------V---------EAA--C--V----SPC-S-----G--P
Sequence 2 MAMKMMKVFCVMVVCMVVTSSYAEAALTCNDVTKKISPCTSFLEKGGEVP

Sequence 1 SAACCSGVRSLASSARSTADKQAACKCIKSAAAGLNAGK---AAGIPTKC
           ---CC-GV--L---A--T-D-QAAC-C-K------N--K---AA--P-KC
Sequence 2 -VDCCTGVKGLNDAAKTTPDRQAACNCLKTSFKSSNNFKEENAAVLPSKC

Sequence 1 GVSVPYAISSSVDCSKIR
           GV--PY-IS---DC-K--
Sequence 2 GVNIPYKISLETDCNKVK



Alignment 47
Sequence 1:
Sequence 2: Allergen Art si 3.0101, Sequence: ANC85026
Sequence identity: 35.65 (41/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAVTEA-AVSCGQVSSALSPCISYARGNGAS
           ---------V----V--M------A-A--C--VS---SPC--Y----G--
Sequence 2 --MAMKMMKVFCVMVVCMVVSSSYAEALTCSDVSNKISPCLNYLKQGGEV

Sequence 1 PSAACCSGVRSLASSARSTADKQAACKCIKSA---AAGLNAGKAAGIPTK
           P-A-CC-GV--L---A--T-D-Q-AC-C-K--------L----A---P-K
Sequence 2 P-ANCCAGVKGLNDAAKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSK

Sequence 1 CGVSVPYAISSSVDCSKIR
           CGV--PY--S---DC-K--
Sequence 2 CGVTIPYKLSMETDCNKVK



Alignment 48
Sequence 1:
Sequence 2: Allergen Sin a 3.0101, Sequence: ABU95411
Sequence identity: 37.39 (43/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGNGASP
           -------------------------A-SCG-V-S-L--CI-Y---N---P
Sequence 2 -------------------------ALSCGTVNSNLAACIGYLTQNAPLP

Sequence 1 SAACCSGVRSLASSARSTADKQAACKCIKSAAA---GLNAGKAAGIPTKC
           ---CC-GV--L---AR-T-D-Q-AC-C---AA-----LNA--AA--P--C
Sequence 2 KG-CCTGVTNLNNMARTTPDRQQACRCLVGAANSFPSLNAARAAALPKAC

Sequence 1 GVSVPYAISSSVDCSKIR
           GV--PY-IS-S--C---R
Sequence 2 GVNIPYKISKSTNCNSVR



Alignment 49
Sequence 1:
Sequence 2: Allergen Hel a 3.0101, Sequence: P82007
Sequence identity: 35.65 (41/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGNGASP
           M---------L---V-A-L------A--C--V---L-PC--Y-R--G--P
Sequence 2 MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLR-SGGKP

Sequence 1 SAACCSGVRSLASSARSTADKQAACKCIKSAAAGLNA--GKAAGIPTKCG
           --ACC-G---L----R--AD---ACKC-K-AA--L------A---P-KCG
Sequence 2 TPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLKVRPDMASSLPGKCG

Sequence 1 VSVPYAISSSVDCSKIR
           -S----I---V-C--I-
Sequence 2 ISTSIPINPNVNCNTIP



Alignment 50
Sequence 1:
Sequence 2: Allergen Art ca 3.0102, Sequence: QIN55516
Sequence identity: 35.65 (41/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGNGASP
           MA-----------V----L----EAA--C--VS----PC-S-----G--P
Sequence 2 MAMKMMKVFCVMIVCMVVLSSYAEAALTCSDVSNKITPCLSFLKQGGEVP

Sequence 1 SAACCSGVRSLASSARSTADKQAACKCIKS---AAAGLNAGKAAGIPTKC
           -A-CC-GV--L---A----D-Q-AC-C-K--------L----A---P-KC
Sequence 2 -ADCCTGVKGLNDAAKTGPDRQKACNCLKTTFKSNKDLKSDNAVVLPSKC

Sequence 1 GVSVPYAISSSVDCSKIR
           GV--PY-IS---DC----
Sequence 2 GVNIPYKISLETDCNTVK



Alignment 51
Sequence 1:
Sequence 2: Allergen Art v 3.0201, Sequence: EU564845
Sequence identity: 36.52 (42/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAVTEA-AVSCGQVSSALSPCISYARGNGAS
           ------------A-V--M------A-A--C--VS---S-C-SY----G--
Sequence 2 ----MKMMKFFCAMVVCMVVSSSYAEALKCSDVSNKISACLSYLKQGGEV

Sequence 1 PSAACCSGVRSLASSARSTADKQAACKCIKS---AAAGLNAGKAAGIPTK
           P-A-CC-GV--L---A--T-D-Q-AC-C-K-------------AA--P-K
Sequence 2 P-ADCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSK

Sequence 1 CGVSVPYAISSSVDCSKIR
           CGV--PY-IS---DC-K--
Sequence 2 CGVNIPYKISLETDCNKVK



Alignment 52
Sequence 1:
Sequence 2: Allergen Art la 3.0102, Sequence: ANC85025
Sequence identity: 35.65 (41/115)
Sequence 1 MARSAVAQVVLVAVVAAMLL--AVTEAAVSCGQVSSALSPCISYARGNGA
           ---------V----V--M-------EAA--C--VS---SPC-SY----G-
Sequence 2 ----MKMMKVFCVMVVCMVVKSSYAEAALTCSDVSTKISPCLSYLKKGGE

Sequence 1 SPSAACCSGVRSLASSARSTADKQAACKCIKS---AAAGLNAGKAAGIPT
           -P-A-CC-GV--L------T-D-Q-AC-C-K--------L----A---P-
Sequence 2 VP-ADCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPS

Sequence 1 KCGVSVPYAISSSVDCSKIR
           KCG---PY--S---DC-K--
Sequence 2 KCGLNLPYKLSLETDCNKVK



Alignment 53
Sequence 1:
Sequence 2: Allergen Art la 3.0101, Sequence: ANC85024
Sequence identity: 36.52 (42/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAVTEA-AVSCGQVSSALSPCISYARGNGAS
           ------------A-V--M------A-A--C--VS---S-C-SY----G--
Sequence 2 --MAMKMMKFFCAMVVCMVVSSSYAEALKCSDVSNKISACLSYLKQGGEV

Sequence 1 PSAACCSGVRSLASSARSTADKQAACKCIKS---AAAGLNAGKAAGIPTK
           P-A-CC-GV--L---A--T-D-Q-AC-C-K-------------AA--P-K
Sequence 2 P-ADCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSK

Sequence 1 CGVSVPYAISSSVDCSKIR
           CGV--PY-IS---DC-K--
Sequence 2 CGVNIPYKISLETDCNKVK



Alignment 54
Sequence 1:
Sequence 2: Allergen Art ar 3.0101, Sequence: ANC85019
Sequence identity: 36.52 (42/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAVTEA-AVSCGQVSSALSPCISYARGNGAS
           ------------A-V--M------A-A--C--VS---S-C-SY----G--
Sequence 2 --MAMKMMKFFCAMVVCMVVSSSYAEALKCSDVSNKISACLSYLKQGGEV

Sequence 1 PSAACCSGVRSLASSARSTADKQAACKCIKS---AAAGLNAGKAAGIPTK
           P-A-CC-GV--L---A--T-D-Q-AC-C-K-------------AA--P-K
Sequence 2 P-ADCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSK

Sequence 1 CGVSVPYAISSSVDCSKIR
           CGV--PY-IS---DC-K--
Sequence 2 CGVNIPYKISLETDCNKVK



Alignment 55
Sequence 1:
Sequence 2: Allergen Art an 3.0101, Sequence: ANC85017
Sequence identity: 36.52 (42/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAVT--EAAVSCGQVSSALSPCISYARGNGA
           ---------V----V--M-------EAA--C--VS----PC-S-----G-
Sequence 2 --MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKILPCTSFLK-QGG

Sequence 1 SPSAACCSGVRSLASSARSTADKQAACKCIKS---AAAGLNAGKAAGIPT
           --SA-CC-GV--L---A--T-D-QAAC-C-K-------------A---P-
Sequence 2 EVSADCCTGVKGLNDAAKTTPDRQAACNCLKTTFKSNKDFKSDNAVVLPS

Sequence 1 KCGVSVPYAISSSVDCSKIR
           KCGV--PY-IS---DC-K--
Sequence 2 KCGVNIPYKISLETDCNKVK



Alignment 56
Sequence 1:
Sequence 2: Allergen Art ca 3.0101, Sequence: ANC85021
Sequence identity: 36.52 (42/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAVT--EAAVSCGQVSSALSPCISYARGNGA
           ---------V----V--M-------EAA--C--VS----PC-S-----G-
Sequence 2 --MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKILPCTSFLK-QGG

Sequence 1 SPSAACCSGVRSLASSARSTADKQAACKCIKS---AAAGLNAGKAAGIPT
           --SA-CC-GV--L---A--T-D-QAAC-C-K-------------A---P-
Sequence 2 EVSADCCTGVKGLNDAAKTTPDRQAACNCLKTTFKSNKDFKSDNAVVLPS

Sequence 1 KCGVSVPYAISSSVDCSKIR
           KCGV--PY-IS---DC-K--
Sequence 2 KCGVNIPYKISLETDCNKVK



Alignment 57
Sequence 1:
Sequence 2: Allergen Art v 3.0301, Sequence: EU564847
Sequence identity: 34.78 (40/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAVT--EAAVSCGQVSSALSPCISYARGNGA
           ---------V----V--M-------E-A--C--VS---SPC-SY----G-
Sequence 2 --MAIKMMKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGE

Sequence 1 SPSAACCSGVRSLASSARSTADKQAACKCIKS---AAAGLNAGKAAGIPT
           -P-A-CC-GV--L------T-D-Q-AC-C-K--------L----A---P-
Sequence 2 VP-ADCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPS

Sequence 1 KCGVSVPYAISSSVDCSKIR
           KCG---PY--S---DC-K--
Sequence 2 KCGLNLPYKLSLETDCNKVK



Alignment 58
Sequence 1:
Sequence 2: Allergen Par j 2, Sequence: O04403
Sequence identity: 36.52 (42/115)
Sequence 1 -MARSAVAQVVLVAVVAAMLLAVTEAAVS-----CGQVSSALSPCISYAR
           ----S--A-VV--A--A----A----A-------CG-V-----PC-----
Sequence 2 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK

Sequence 1 GNGASPSAACCSGVRSLASSARSTADKQAACKCIKSAAAGLNAGK---AA
           G----PS--CCSG---L------T--K--ACKCI--A--G----K----A
Sequence 2 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA

Sequence 1 GIPTKCGVSVPYA-ISSSVDCSKIR--------
           --P-KCG-------I----DCSKI---------
Sequence 2 EVPKKCGITTTLPPITADFDCSKIESTIFRGYY



Alignment 59
Sequence 1:
Sequence 2: Allergen Par j 2, Sequence: P55958
Sequence identity: 34.78 (40/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAVTEAAV------SCGQVSSALSPCISYAR
           M-----A--V--A---A-------A---------CG-V-----PC-----
Sequence 2 MRTVSMAALVVIAAALAWTSSAEPAPAPAPGEEACGKVVQDIMPCLHFVK

Sequence 1 GNGASPSAACCSGVRSLASSARSTADKQAACKCIKSAAAGLNAGK---AA
           G----PS--CCSG---L------T--K--ACKCI--A--G----K----A
Sequence 2 GEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVA

Sequence 1 GIPTKCGV--SVPYAISSSVDCSKIR--------
           --P-KC------P--I----DCSKI---------
Sequence 2 EVPKKCDIKTTLP-PITADFDCSKIQSTIFRGYY



Alignment 60
Sequence 1:
Sequence 2: Allergen Amb a 6, Sequence: O04004
Sequence identity: 32.17 (37/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLA-----VTEAAVSCGQVSSALSPCISYARG
           ----------L--V----LL---------A---C--V---L-PC-----G
Sequence 2 ----MDCIRILWSVAVGLLLVSWRPTMFAASPTCDTVQNILAPCAGFLTG

Sequence 1 NGASPSAACCSGVRSLASSARSTADKQAACKCIK--SAAAGLNAGKAAGI
           ----PS-ACC-GV--L--S----AD--A-C-CIK----------------
Sequence 2 Q--EPSKACCTGVNNLNNSRKTKADRVAVCNCIKELTKSIAYDPKRMPLL

Sequence 1 PTKCGVSVPY-AISSSVDCSKIR-
           -TKCGV-----A-----DCSK---
Sequence 2 STKCGVKPDFPAVDKNLDCSKLPV



Alignment 61
Sequence 1:
Sequence 2: Allergen Par j 1, Sequence: Q40905
Sequence identity: 34.78 (40/115)
Sequence 1 -MARSAVAQVVLVAVVAAMLLAVTEAAV----------SCGQVSSALSPC
           ----SA---V-LV--VAA-L-----A-V-----------CG-V--AL-PC
Sequence 2 MRTVSARSSVALVVIVAAVLVWTSSASVAPAPAPGSEETCGTVVGALMPC

Sequence 1 ISYARGNGASPSAACCSGVRSLASSARSTADKQAACKCIKSAAAGLNA--
           -----G----PS--CCSG---L------------AC-CI--A--------
Sequence 2 LPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDID

Sequence 1 GKAAG-IPTKCGV---SVPYAISSSVDCSKIR-------
           GK-----P--CG------P--I----DC-----------
Sequence 2 GKLVSEVPKHCGIVDSKLP-PIDVNMDCKTLGVLHYKGN



Alignment 62
Sequence 1:
Sequence 2: Allergen Par j 1, Sequence: O04404
Sequence identity: 34.78 (40/115)
Sequence 1 -MARSAVAQVVLVAVVAAMLLAVTEAAV-----------SCGQVSSALSP
           ----SA---V-LV--VAA-L-----A-V------------CG-V--AL-P
Sequence 2 MRTVSAPSAVALVVIVAAGLAWTSLASVAPPAPAPGSEETCGTVVRALMP

Sequence 1 CISYARGNGASPSAACCSGVRSLASSARSTADKQAACKCIKSAAAGLNA-
           C-----G----PS--CCSG---L------------AC-CI--A-------
Sequence 2 CLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSDI

Sequence 1 -GKAAG-IPTKCGV---SVPYAISSSVDCSKIR-----------------
           -GK-----P--CG------P--I----DC---------------------
Sequence 2 DGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTLGVVPRQPQLPVSLRHGPV

Sequence 1 ---------------------------
           ---------------------------
Sequence 2 TGPSDPAHKARLERPQIRVPPPAPEKA



Alignment 63
Sequence 1:
Sequence 2: Allergen Par j 1, Sequence: P43217
Sequence identity: 24.35 (28/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGNGASP
           ----------------------------CG----AL-PC-----G----P
Sequence 2 -------------------------QETCGTMVRALMPCLPFVQGKEKEP

Sequence 1 SAACCSGVRSLASSARSTADKQAACKCIKSAAAGLNA--GK-AAGIPTKC
           S--CCSG---L------------AC-CI--A--------GK-----P--C
Sequence 2 SKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHC

Sequence 1 GV---SVPYAISSSVDCSKIR-----------------------------
           G------P--I----DC---------------------------------
Sequence 2 GIVDSKLP-PIDVNMDCKTVGVVPRQPQLPVSLRHGPVTGPSDPAHKARL

Sequence 1 ---------------
           ---------------
Sequence 2 ERPQIRVPPPAPEKA



Alignment 64
Sequence 1:
Sequence 2: Allergen Par j 1.0103, Sequence: CAI94601
Sequence identity: 24.35 (28/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGNGASP
           ----------------------------CG----AL-PC-----G----P
Sequence 2 -------------------------QETCGTMVRALMPCLPFVQGKEKEP

Sequence 1 SAACCSGVRSLASSARSTADKQAACKCIKSAAAGLNA--GK-AAGIPTKC
           S--CCSG---L------------AC-CI--A--------GK-----P--C
Sequence 2 SKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHC

Sequence 1 GV---SVPYAISSSVDCSKIR-----------------------------
           G------P--I----DC---------------------------------
Sequence 2 GIVDSKLP-PIDVNMDCKTLGVVPRQPQLPVSLRHGPVTGPSDPAHKARL

Sequence 1 ---------------
           ---------------
Sequence 2 ERPQIRVPPPAPEKA



Alignment 65
Sequence 1:
Sequence 2: Allergen Par j 1.0101, Sequence: CAA54587
Sequence identity: 22.61 (26/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGNGASP
           ----------------------------------AL-PC-----G----P
Sequence 2 -------------------------------MVRALMPCLPFVQGKEKEP

Sequence 1 SAACCSGVRSLASSARSTADKQAACKCIKSAAAGLN--AGKAAG-IPTKC
           S--CCSG---L------------AC-CI--A--------GK-----P--C
Sequence 2 SKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHC

Sequence 1 GV---SVPYAISSSVDCSKIR-----------------------------
           G------P--I----DC---------------------------------
Sequence 2 GIVDSKLP-PIDVNMDCKTVGVVPRQPQLPVSLRHGPVTGPSDPAHKARL

Sequence 1 ---------------
           ---------------
Sequence 2 ERPQIRVPPPAPEKA



Alignment 66
Sequence 1:
Sequence 2: Allergen Vit v 1, Sequence: P80274
Sequence identity: 17.39 (20/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGNGASP
           --------------------------V-CGQV-SALSPCI-Y----GA-P
Sequence 2 -------------------------TVTCGQVASALSPCIDYLQKDGAVP

Sequence 1 SAACCSGVRSLASSARSTADKQAACKCIKSAAAGLNAGKAAGIPTKCGVS
           ---CC----S-A--------------------------------------
Sequence 2 AGSCCXKXLSSA--------------------------------------

Sequence 1 VPYAISSSVDCSKIR
           ---------------
Sequence 2 ---------------



Alignment 67
Sequence 1:
Sequence 2: Allergen Cas s 8, Sequence: 10998016
Sequence identity: 13.91 (16/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGNGASP
           ----------------------------C-QVS--L-PC--Y---NG-SP
Sequence 2 -------------------------SITCTQVSKSLMPCLTYLKSNGGSP

Sequence 1 S-AACCSGVRSLASSARSTADKQAACKCIKSAAAGLNAGKAAGIPTKCGV
           ----CC-GV-----------------------------------------
Sequence 2 PPGTCCQGVKL---------------------------------------

Sequence 1 SVPYAISSSVDCSKIR
           ----------------
Sequence 2 ----------------



Alignment 68
Sequence 1:
Sequence 2: Allergen Art v 3.0101, Sequence: P0C088
Sequence identity: 14.78 (17/115)
Sequence 1 MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGNGASP
           -------------------------A--C--VS---SPC-SY----G--P
Sequence 2 -------------------------ALTCSDVSNKISPCLSYLKQGGEVP

Sequence 1 SAACCSGVRSLASSARSTADKQAACKCIKSAAAGLNAGKAAGIPTKCGVS
           -A-CC-GV--L---------------------------------------
Sequence 2 -ADCCAGVKGLND-------------------------------------

Sequence 1 VPYAISSSVDCSKIR
           ---------------
Sequence 2 ---------------



Alignment 69
Sequence 1:
Sequence 2: Allergen Sola l 6.0101, Sequence: A0A3Q7F7X3
Sequence identity: 26.96 (31/115)
Sequence 1 -MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGNGAS
           ---------V-LV-----------EAA--C----S-LSPC-----G-G--
Sequence 2 MTKVCSFVAVMLVMILVCDQFGANEAA-TCS--ASQLSPCLGAIQG-GTA

Sequence 1 PSAACCSGVRSLASSARSTADKQAACKC-------IKSAAAGLNAGKAAG
           PS--CC----------------Q--C-C---------------NA-K-AG
Sequence 2 PSQDCCARLKN-----------QQPCICGFMKDPNLRQYVNSPNARKVAG

Sequence 1 IPTKCGVSVPYAISSSVDCSKIR
           ----CGVS-P-------------
Sequence 2 ---QCGVSIPSC-----------


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.