The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Bet v 1.0114

Sequence CAB02161

Full FASTA alignment

Sequence name:
Query sequence:
MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
YLLAHSDAYN

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Bet v 1.0114CAB02161Go!160223.22.7e-60
2Bet v 1.0101CAA33887Go!160221.11.2e-59
3Bet v 1.0109CAB02156Go!160220.91.3e-59
4Bet v 1.0112CAB02159Go!160219.63.2e-59
5Bet v 1.0113CAB02160Go!160218.66.5e-59
6Bet v 1.0117CAA07323.1Go!160218.47.5e-59
7Bet v 1.0108CAB02155Go!160218.28.7e-59
8Bet v 1.0110CAB02157Go!160217.11.8e-58
9Bet v 1.0106CAA54487Go!160216.33.2e-58
10Bet v 1.0104CAA54484Go!160215.17.5e-58
11Bet v 1.0111CAB02158Go!160215.17.5e-58
12Bet v 1.0102CAA54482Go!160214.21.3e-57
13Bet v 1.0115CAA96547Go!160214.01.6e-57
14Bet v 1.0105CAA54485Go!160213.81.8e-57
15Bet v 1.0116CAA04827.1Go!159213.62.1e-57
16Bet v 1.0103CAA54483Go!160212.83.7e-57
17Bet v 1.0107CAA54489Go!160212.64.2e-57
18Bet v 1.0118CAA07329.1Go!160210.32.1e-56
19Bet v 1.0119ABC41615.1Go!150202.64.1e-54
20Bet v 1.0205Q39427Go!160200.12.4e-53
21Bet v 1.0204P43186Go!160199.92.8e-53
22Bet v 1.0206CAA04828.1Go!159198.95.7e-53
23Bet v 1.0201CAA54421Go!160197.81.2e-52
24Bet v 1.0203P43184Go!160197.21.8e-52
25Bet v 1.0202CAA54481Go!160195.36.6e-52
26Cor a 1.0201CAA96548Go!160193.03.2e-51
27Aln g 1AAB24432Go!160188.57.6e-50
28Aln g 1P38948Go!159187.02.1e-49
29Bet v 1.0207ACF75030.1Go!150184.51.1e-48
30Car b 1.0302CAB02217Go!161183.72.1e-48
31Car b 1.0301CAB02216Go!161178.57.7e-47
32Car b 1.0104CAB02207Go!160176.62.8e-46
33Car b 1.0103CAB02206Go!160176.43.2e-46
34Car b 1.0109ABZ81040Go!160175.27.7e-46
35Car b 1P38950Go!159175.08.8e-46
36Car b 1.0112ABZ81043Go!160174.41.4e-45
37Car b 1.0111ABZ81042Go!160174.41.4e-45
38Ost c 1.0101ADK39021Go!160174.11.6e-45
39Car b 1.0110ABZ81041Go!160174.11.6e-45
40Car b 1.0105CAB02208Go!160173.91.8e-45
41Car b 1.0113ABZ81044Go!160173.72.1e-45
42Cor a 1.0103CAA50325Go!160172.35.8e-45
43Car b 1.0106CAB02209Go!160171.97.7e-45
44Cor a 1.0102CAA50328Go!160171.97.7e-45
45Car b 1.0102CAA47357Go!159170.61.8e-44
46Cor a 1.0101CAA50327Go!160170.42.1e-44
47Car b 1P38949Go!159170.22.4e-44
48Car b 1.0107CAB02213Go!160169.44.3e-44
49Cor a 1Q08407Go!159168.95.7e-44
50Bet v 1.0301CAA54696.1Go!160168.11.0e-43
51Car b 1.0108CAB02215Go!160167.31.8e-43
52Cor a 1.0104CAA50326Go!160166.53.2e-43
53Cor a 1.0301CAA96549Go!160163.32.8e-42
54Cor a 1.0401AAD48405Go!161157.51.6e-40
55Cor a 1.0404AAG40331Go!161156.92.5e-40
56Cas s 1CAD10374Go!160156.53.3e-40
57Cor a 1.0402AAG40329Go!161156.33.8e-40
58Cor a 1.0403AAG40330Go!161155.75.8e-40
59Mal d 1.0401CAA96535Go!160153.03.8e-39
60Jug r 5.0101APD76154Go!160152.74.3e-39
61Fag s 1.0101ACJ23864Go!160152.35.8e-39
62Mal d 1.0402CAA96536Go!160150.32.4e-38
63Mal d 1.0403CAA96537Go!160149.44.4e-38
64Pru av 1O24248Go!160143.03.8e-36
65Pru p 1.0101Q2I6V8Go!160142.26.7e-36
66Mal d 1.0301CAA96534Go!159141.31.2e-35
67Pru ar 1O50001Go!160140.91.6e-35
68Que a 1.0301ABZ81046Go!160139.25.0e-35
69Mal d 1.0304AAO25113Go!159138.48.9e-35
70Mal d 1.0302AAK13027Go!159138.21.0e-34
71Que m 1.0101AUH28179Go!160135.95.1e-34
72Pru du 1.0101B6CQS9Go!160135.95.1e-34
73Mal d 1.0303AAK13028Go!159134.91.0e-33
74Que i 1.0101QGS84240Go!159134.01.8e-33
75Mal d 1.0201AAB01362Go!159132.84.4e-33
76Mal d 1.0202AAD26545Go!159132.84.4e-33
77Mal d 1.0103AAD26546Go!159132.84.4e-33
78Pyr c 1O65200Go!159132.65.0e-33
79Mal d 1.0108AAD29671Go!159132.45.8e-33
80Que ac 1.0101QOL10866Go!159132.45.8e-33
81Fra a 1Q256S7Go!160132.26.7e-33
82Mal d 1.0104AAD26552Go!159132.07.8e-33
83Mal d 1.0204AAD26548Go!159132.07.8e-33
84Mal d 1.0206AAD13683Go!159131.89.0e-33
85Fra a 1Q3T923Go!160131.89.0e-33
86Mal d 1.0203AAD26547Go!159131.61.0e-32
87Mal d 1.0207AAK13030Go!159131.61.0e-32
88Can s 5.0101AFN42528Go!161131.61.0e-32
89Mal d 1.0101CAA58646Go!159131.31.2e-32
90Mal d 1.0107AAD26555Go!159131.31.2e-32
91Mal d 1.0105AAD26553Go!159131.11.4e-32
92Mal d 1.0205AAD26558Go!159131.11.4e-32
93Mal d 1.0106AAD26554Go!159131.11.4e-32
94Que a 1.0201ABZ81045Go!159130.91.6e-32
95Fra a 1Q256S2Go!160130.91.6e-32
96Que a 1.0401ABZ81047Go!160130.71.8e-32
97Mal d 1.0102CAA88833Go!159130.32.5e-32
98Fra a 1Q256S6Go!160130.32.5e-32
99Mal d 1.0208CAD32318Go!158130.12.8e-32
100Mal d 1.0109AAK13029Go!159130.12.8e-32
101Fra a 1Q256S4Go!159127.81.4e-31
102Act c 8.0101CAM31908Go!159113.52.9e-27
103Act d 8.0101CAM31909Go!157111.61.0e-26
104Rub i 1.0101Q0Z8U9Go!137109.92.9e-26
105Gly m 4CAA42646Go!158109.73.8e-26
106Pha v 1CAA43637Go!156106.24.3e-25
107Pha v 1CAA43636Go!155104.71.2e-24
108Pha v 1P25985Go!155104.71.2e-24
109Sola l 4.0101AHC08073Go!160104.81.2e-24
110Ara h 8.0101AAQ91847Go!157103.92.1e-24
111Sola l 4.0201NP_001275580Go!160102.94.4e-24
112Vig r 1.0101Q2VU97Go!15597.51.8e-22
113Ara h 8.0201EF436550Go!15396.63.2e-22
114Api g 1P49372Go!15495.28.9e-22
115Lyc e 4.0101CAA75803Go!17895.01.1e-21
116Pet c PR10CAA67246Go!15591.51.2e-20
117Api g 1.0201P92918Go!15989.45.1e-20
118Tar o RAPAAB92255Go!15789.25.9e-20
119Dau c 1.0201AAL76932Go!15488.11.2e-19
120Dau c 1.0104CAB03716Go!15487.32.1e-19
121Dau c 1.0105CAB06416Go!15486.73.2e-19
122Dau c 1.0102BAA13604Go!15486.53.8e-19
123Dau c 1.0101AAB01092Go!16886.15.3e-19
124Dau c 1.0103CAB03715Go!15484.61.4e-18
125Fra a 1.0101Q5ULZ4Go!10059.72.7e-11
126Que a 1.0101P85126Go!5052.61.9e-09
127Vig r 6.0101Q9ZWP8Go!15551.21.6e-08
128Cas s 1Q9S8Q4Go!2431.42.2e-03

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Bet v 1.0114, Sequence: CAB02161
Sequence identity: 100.00 (160/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
Sequence 2 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES

Sequence 1 YLLAHSDAYN
           YLLAHSDAYN
Sequence 2 YLLAHSDAYN



Alignment 2
Sequence 1:
Sequence 2: Allergen Bet v 1.0101, Sequence: CAA33887
Sequence identity: 99.38 (159/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEM-ETLLRAVES
Sequence 2 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YLLAHSDAYN
           YLLAHSDAYN
Sequence 2 YLLAHSDAYN



Alignment 3
Sequence 1:
Sequence 2: Allergen Bet v 1.0109, Sequence: CAB02156
Sequence identity: 98.75 (158/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGP-GDTLEKIS
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKIS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEM-ETLLRAVES
Sequence 2 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YLLAHSDAYN
           YLLAHSDAYN
Sequence 2 YLLAHSDAYN



Alignment 4
Sequence 1:
Sequence 2: Allergen Bet v 1.0112, Sequence: CAB02159
Sequence identity: 98.75 (158/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKISFPEG-PFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
Sequence 2 PGTIKKISFPEGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEM-ETLLRAVES
Sequence 2 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YLLAHSDAYN
           YLLAHSDAYN
Sequence 2 YLLAHSDAYN



Alignment 5
Sequence 1:
Sequence 2: Allergen Bet v 1.0113, Sequence: CAB02160
Sequence identity: 98.12 (157/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVFNYETETTSVIPAARLFKAFILDGDNL-PKVAPQAISSVENIEGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGP-GDTLEKIS
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPMGDTLEKIS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEM-ETLLRAVES
Sequence 2 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YLLAHSDAYN
           YLLAHSDAYN
Sequence 2 YLLAHSDAYN



Alignment 6
Sequence 1:
Sequence 2: Allergen Bet v 1.0117, Sequence: CAA07323.1
Sequence identity: 97.50 (156/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           NEIKIVATPDGG--LKISNKYHTKG-HEVKAEQVKASKEM-ETLLRAVES
Sequence 2 NEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YLLAHSDAYN
           YLLAHSDAYN
Sequence 2 YLLAHSDAYN



Alignment 7
Sequence 1:
Sequence 2: Allergen Bet v 1.0108, Sequence: CAB02155
Sequence identity: 96.88 (155/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGP-GDTLEKIS
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKIS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           NEIKIVATPDGG--LKISNKYHTKG-HEVKAEQVKASKEM-ETLLRAVES
Sequence 2 NEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YLLAHSDAYN
           YLLAHSDAYN
Sequence 2 YLLAHSDAYN



Alignment 8
Sequence 1:
Sequence 2: Allergen Bet v 1.0110, Sequence: CAB02157
Sequence identity: 96.88 (155/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGD-LEKIS
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKIS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           NEIKIVATPDGG--LKISNKYHTKG-HEVKAEQVKASKEM-ETLLRAVES
Sequence 2 NEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YLLAHSDAYN
           YLLAHSDAYN
Sequence 2 YLLAHSDAYN



Alignment 9
Sequence 1:
Sequence 2: Allergen Bet v 1.0106, Sequence: CAA54487
Sequence identity: 95.62 (153/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVFNYETE-TSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
Sequence 2 MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKY-YSVIEGGP-GDTLEKIS
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKIS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           NEIKIVATP-GGSILKI-NKYHTKGDHEVKAEQ-KASKEM-ETLLRAVES
Sequence 2 NEIKIVATPNGGSILKINNKYHTKGDHEVKAEQIKASKEMGETLLRAVES

Sequence 1 YLLAHSDAYN
           YLLAHSDAYN
Sequence 2 YLLAHSDAYN



Alignment 10
Sequence 1:
Sequence 2: Allergen Bet v 1.0104, Sequence: CAA54484
Sequence identity: 95.00 (152/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVFNYE-E-TSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
Sequence 2 MGVFNYEIEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKY-YSVIEGGP-GDTLEKIS
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKIS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           NEIKIVATP-GGSILKI-NKYHTKGDHEVKAEQ-KASKEM-ETLLRAVES
Sequence 2 NEIKIVATPNGGSILKINNKYHTKGDHEVKAEQIKASKEMGETLLRAVES

Sequence 1 YLLAHSDAYN
           YLLAHSDAYN
Sequence 2 YLLAHSDAYN



Alignment 11
Sequence 1:
Sequence 2: Allergen Bet v 1.0111, Sequence: CAB02158
Sequence identity: 96.25 (154/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKISFP-G-PFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
Sequence 2 PGTIKKISFPGGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           NEIKIVATPDGG--LKISNKYHTKG-HEVKAEQVKASKEM-ETLLRAVES
Sequence 2 NEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YLLAHSDAYN
           YLLAHSDAYN
Sequence 2 YLLAHSDAYN



Alignment 12
Sequence 1:
Sequence 2: Allergen Bet v 1.0102, Sequence: CAA54482
Sequence identity: 95.00 (152/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVFNYE-ETTSVIPAARLFKAFILDGDNL-PKVAPQAISSVENIEGNGG
Sequence 2 MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-FPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGP-GDTLEKIS
Sequence 2 PGTIKKINFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKIS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           NEIKIVATPDGG--LKISNKYHTKG-HEVKAEQVKASKEM-ETLLRAVES
Sequence 2 NEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YLLAHSDAYN
           YLLAHSDAYN
Sequence 2 YLLAHSDAYN



Alignment 13
Sequence 1:
Sequence 2: Allergen Bet v 1.0115, Sequence: CAA96547
Sequence identity: 96.25 (154/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKISFPEGFPFKYVKDRVDEV-H-NFKY-YSVIEGGPIGDTLEKIS
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKIS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           NEIKIVATPDG-SILKISNKYHTKGDHEVKAEQ-KASKEM-ETLLRAVES
Sequence 2 NEIKIVATPDGRSILKISNKYHTKGDHEVKAEQIKASKEMGETLLRAVES

Sequence 1 YLLAHSDAYN
           YLLAHSDAYN
Sequence 2 YLLAHSDAYN



Alignment 14
Sequence 1:
Sequence 2: Allergen Bet v 1.0105, Sequence: CAA54485
Sequence identity: 94.38 (151/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVFNYE-ETTSVIPAARLFKAFIL-GDNL-PKVAPQAISSVENIEGNGG
Sequence 2 MGVFNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-FPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGP-GDTLEKIS
Sequence 2 PGTIKKINFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKIS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           NEIKIVATPDGG--LKISNKYHTKG-HEVKAEQVKASKEM-ETLLRAVES
Sequence 2 NEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YLLAHSDAYN
           YLLAHSDAYN
Sequence 2 YLLAHSDAYN



Alignment 15
Sequence 1:
Sequence 2: Allergen Bet v 1.0116, Sequence: CAA04827.1
Sequence identity: 95.00 (152/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           -GVFNYETE-TSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
Sequence 2 -GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKISFPEG-PFKYVKDRVDEVDH-NFKY-YS-IEGGP-GDTLEKIS
Sequence 2 PGTIKKISFPEGIPFKYVKDRVDEVDHANFKYSYSLIEGGPVGDTLEKIS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEM-ETLLRAVES
Sequence 2 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YLLAHSDAYN
           YLLAHSDAYN
Sequence 2 YLLAHSDAYN



Alignment 16
Sequence 1:
Sequence 2: Allergen Bet v 1.0103, Sequence: CAA54483
Sequence identity: 94.38 (151/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVFNYETE-TSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
Sequence 2 MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKISFPEG-PFKYVK-RVDEVDHTNFKY-YSVIEGGP-GDTLEKIS
Sequence 2 PGTIKKISFPEGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKIS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           NEIKIVATP-GGSILKI-NKYHTKGDHEVKAEQ-KASKEM-ETLLRAVES
Sequence 2 NEIKIVATPNGGSILKINNKYHTKGDHEVKAEQIKASKEMGETLLRAVES

Sequence 1 YLLAHSDAYN
           YLLAHSDAYN
Sequence 2 YLLAHSDAYN



Alignment 17
Sequence 1:
Sequence 2: Allergen Bet v 1.0107, Sequence: CAA54489
Sequence identity: 93.75 (150/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVFNYETE-TSVIPAAR-FKAFILDGD-L-PKVAPQAISSVENIEGNGG
Sequence 2 MGVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-FPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGP-GDTLEKIS
Sequence 2 PGTIKKINFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKIS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           NEIKIVATPDGG--LKISNKYHTKG-HEVKAEQVKASKEM-ETLLRAVES
Sequence 2 NEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YLLAHSDAYN
           YLLAHSDAYN
Sequence 2 YLLAHSDAYN



Alignment 18
Sequence 1:
Sequence 2: Allergen Bet v 1.0118, Sequence: CAA07329.1
Sequence identity: 93.75 (150/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVFNYETETTSVIPAARLFKAFILDGDNL-PKVAPQAISSVENIEGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           NEIK-VATPDGGSIL-ISNKYHTKGDHE-KAE--KA-KE--E-LLRAVES
Sequence 2 NEIKLVATPDGGSILEISNKYHTKGDHEMKAEHMKAIKEKGEALLRAVES

Sequence 1 YLLAHSDAYN
           YLLAHSDAYN
Sequence 2 YLLAHSDAYN



Alignment 19
Sequence 1:
Sequence 2: Allergen Bet v 1.0119, Sequence: ABC41615.1
Sequence identity: 90.00 (144/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           ---FNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSV-NIEGNGG
Sequence 2 ---FNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVQNIEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-FPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGP-GDTLEKIS
Sequence 2 PGTIKKINFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKIS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           NEIKIVATPDGG-ILKISNKYHTKG-HEVKAEQVKASKEM-ETLLRAVES
Sequence 2 NEIKIVATPDGGCILKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YLLAHSDAYN
           YLL-------
Sequence 2 YLL-------



Alignment 20
Sequence 1:
Sequence 2: Allergen Bet v 1.0205, Sequence: Q39427
Sequence identity: 88.75 (142/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVFNYETETTSVIPAARLFKAFILDGDNL-PKVAPQAISSVENIEGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-FPEG-PFKYVK-RVDEVDH-NFKY-YS-IEGG--GDTLEKI-
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKIC

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           NEIK-VATPDGGSILKISNKYHTKGDHE-KAE--KA-KE--E-LLRAVES
Sequence 2 NEIKLVATPDGGSILKISNKYHTKGDHEMKAEHMKAIKEKAEALLRAVES

Sequence 1 YLLAHSDAYN
           YLLAHSDAYN
Sequence 2 YLLAHSDAYN



Alignment 21
Sequence 1:
Sequence 2: Allergen Bet v 1.0204, Sequence: P43186
Sequence identity: 88.75 (142/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVFNYE-ETTSVIPAARLFKAFILDGDNL-PKVAPQAISSVENIEGNGG
Sequence 2 MGVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-FPEG-PFKYVK-RVDEVDH-NFKY-YS-IEGG--GDTLEKI-
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKIC

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           NEIKIVATPDGGSILKISNKYHTKGDHE-KAE--KA-KE--E-LLRAVES
Sequence 2 NEIKIVATPDGGSILKISNKYHTKGDHEMKAEHMKAIKEKGEALLRAVES

Sequence 1 YLLAHSDAYN
           YLLAHSDAYN
Sequence 2 YLLAHSDAYN



Alignment 22
Sequence 1:
Sequence 2: Allergen Bet v 1.0206, Sequence: CAA04828.1
Sequence identity: 88.12 (141/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           -GVFNYE-ETTSVIPAARLFKAFILDGDNL-PKVAPQAISSVENIEGNGG
Sequence 2 -GVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-FPEG-PFKYVK-RVDEVDH-NFKY-YS-IEGG--GDTLEKI-
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKIC

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           NEIK-VATPDGGSILKISNKYHTKGDHE-KAE--KA-KE--ETLLRAVES
Sequence 2 NEIKLVATPDGGSILKISNKYHTKGDHEMKAEHMKAIKEKGETLLRAVES

Sequence 1 YLLAHSDAYN
           YLLAHSDAYN
Sequence 2 YLLAHSDAYN



Alignment 23
Sequence 1:
Sequence 2: Allergen Bet v 1.0201, Sequence: CAA54421
Sequence identity: 88.12 (141/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVFNYETETTSVIPAARLFKAFIL-GD-L-PKVAPQAISSVENIEGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-FPEG-PFKYVK-RVDEVDH-NFKY-YS-IEGG--GDTLEKI-
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKIC

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           NEIKIVATPDGGSILKISNKYHTKGDHE-KAE--KA-KE--E-LLRAVES
Sequence 2 NEIKIVATPDGGSILKISNKYHTKGDHEMKAEHMKAIKEKGEALLRAVES

Sequence 1 YLLAHSDAYN
           YLLAHSDAYN
Sequence 2 YLLAHSDAYN



Alignment 24
Sequence 1:
Sequence 2: Allergen Bet v 1.0203, Sequence: P43184
Sequence identity: 87.50 (140/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVFNYE-ETTSVIPAARLFKAFIL-GD-L-PKVAPQAISSVENIEGNGG
Sequence 2 MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-FPEG-PFKYVK-RVDEVDH-NFKY-YS-IEGG--GDTLEKI-
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKIC

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           NEIKIVATPDGGSILKISNKYHTKGDHE-KAE--KA-KE--E-LLRAVES
Sequence 2 NEIKIVATPDGGSILKISNKYHTKGDHEMKAEHMKAIKEKGEALLRAVES

Sequence 1 YLLAHSDAYN
           YLLAHSDAYN
Sequence 2 YLLAHSDAYN



Alignment 25
Sequence 1:
Sequence 2: Allergen Bet v 1.0202, Sequence: CAA54481
Sequence identity: 86.88 (139/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVFNYE-ETTSVIPAARLFKAFIL-GD-L-PKVAPQAISSVENIEGNGG
Sequence 2 MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-FPEG-PFKYVK-RVDEVDH-NFKY-YS-IEGG--GDTLEKI-
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKIC

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           NEIKIVATPDGGSILKISNKYHTKGD-E-KAE--KA-KE--E-LLRAVES
Sequence 2 NEIKIVATPDGGSILKISNKYHTKGDQEMKAEHMKAIKEKGEALLRAVES

Sequence 1 YLLAHSDAYN
           YLLAHSDAYN
Sequence 2 YLLAHSDAYN



Alignment 26
Sequence 1:
Sequence 2: Allergen Cor a 1.0201, Sequence: CAA96548
Sequence identity: 83.12 (133/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVFNYETE-TSVIPAARLFKAFILDG-NL-PKVAPQA-SSVEN-EGNGG
Sequence 2 MGVFNYETESTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-F-EG-PFKYVK-RV-EVDHTNFKY-Y-VIEGGP-GD--EKI-
Sequence 2 PGTIKKITFSEGSPFKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKIC

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           NEIKIVA-PDGGSILKISNKYHTKGDHEV-AE--K--KE--E-L-RAVE-
Sequence 2 NEIKIVAAPDGGSILKISNKYHTKGDHEVDAEHIKGGKEKVEGLFRAVEA

Sequence 1 YLLAHSDAYN
           YLLAHSDAYN
Sequence 2 YLLAHSDAYN



Alignment 27
Sequence 1:
Sequence 2: Allergen Aln g 1, Sequence: AAB24432
Sequence identity: 81.25 (130/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVFNYE-ET-SVIPAARLFKAFILDGD-L-PKVAP-A-SSVENIEGNGG
Sequence 2 MGVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-FPEG-PFKYVK-RVDEVD--NFKY--SVIEGG--GD-LEK--
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVC

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           NEIKIVA-PDGGSILKISNK-HTKGDHE--AEQ-K--KE----LL-AVES
Sequence 2 NEIKIVAAPDGGSILKISNKFHTKGDHEINAEQIKIEKEKAVGLLKAVES

Sequence 1 YLLAHSDAYN
           YLLAHSDAYN
Sequence 2 YLLAHSDAYN



Alignment 28
Sequence 1:
Sequence 2: Allergen Aln g 1, Sequence: P38948
Sequence identity: 80.62 (129/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           -GVFNYE-ET-SVIPAARLFKAFILDGD-L-PKVAP-A-SSVENIEGNGG
Sequence 2 -GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-FPEG-PFKYVK-RVDEVD--NFKY--SVIEGG--GD-LEK--
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVC

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           NEIKIVA-PDGGSILKISNK-HTKGDHE--AEQ-K--KE----LL-AVES
Sequence 2 NEIKIVAAPDGGSILKISNKFHTKGDHEINAEQIKIEKEKAVGLLKAVES

Sequence 1 YLLAHSDAYN
           YLLAHSDAYN
Sequence 2 YLLAHSDAYN



Alignment 29
Sequence 1:
Sequence 2: Allergen Bet v 1.0207, Sequence: ACF75030.1
Sequence identity: 81.88 (131/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           ---FNYE-ETTSVIPAARLFKAFIL-GDNL-PKVAPQAISSVENIEGNGG
Sequence 2 ---FNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-FPEG-PFKYVK-RVDEVDH-NFKY-YS-IEGG--GDTLEKI-
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKIC

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           NEIKIVATPDGGSILKISNKYHTKGDHE-KAE--KA-KE--E-LLRAVES
Sequence 2 NEIKIVATPDGGSILKISNKYHTKGDHEMKAEHMKAIKEKGEALLRAVES

Sequence 1 YLLAHSDAYN
           YLL-------
Sequence 2 YLL-------



Alignment 30
Sequence 1:
Sequence 2: Allergen Car b 1.0302, Sequence: CAB02217
Sequence identity: 78.75 (126/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVFNYE-ETTSVIPAARLFKAFILDG-NL-PKVAPQA-SSVEN-EGNGG
Sequence 2 MGVFNYEAETTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-F-EG-P-KYVK-RV-EVDHTNFKY-Y-VIEGGP-GD--EKI-
Sequence 2 PGTIKKITFSEGSPVKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKIC

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           NEIKIVA-PDGGSILKI--KYHTKGDHEV-AE--K--KE--E-LL--VE-
Sequence 2 NEIKIVAAPDGGSILKITSKYHTKGDHEVPAEHIKGGKERVEGLLKPVEA

Sequence 1 YLLAHSDAYN-
           YLLAH---YN-
Sequence 2 YLLAHTAEYNN



Alignment 31
Sequence 1:
Sequence 2: Allergen Car b 1.0301, Sequence: CAB02216
Sequence identity: 76.88 (123/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVFNYE-ETTSVIPAARLFKAFILDG--L-PKV-PQA-SSVEN-EGNGG
Sequence 2 MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-F-EG-P-KYVK-RV-EVDHTNFKY-Y-VIEGG--GD--EKI-
Sequence 2 PGTIKKITFSEGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKIC

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           NEIKIVA-PDGGSILKI--KYHTKGDHEV-AE--K--KE--E-LL--VE-
Sequence 2 NEIKIVAAPDGGSILKITSKYHTKGDHEVPAEHIKGGKERVEGLLKPVEA

Sequence 1 YLLAHSDAYN-
           YLLAH---YN-
Sequence 2 YLLAHTAEYNN



Alignment 32
Sequence 1:
Sequence 2: Allergen Car b 1.0104, Sequence: CAB02207
Sequence identity: 75.00 (120/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVFNYE-ET-SVIPAARLFK---LDGD-L-PKVAPQAISSVEN--GNGG
Sequence 2 MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIK-I-F-EG-PFK-VK-RVDEVD--NFKYNY-VIEG---GD-LEK-S
Sequence 2 PGTIKNITFAEGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDNLEKVS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-KIVA-P-GGSI-KIS-K-H-KGDHEV-AE--K--KEM-E-LLRAVES
Sequence 2 HELKIVAAPGGGSIVKISSKFHAKGDHEVNAEEMKGAKEMAEKLLRAVES

Sequence 1 YLLAHSDAYN
           YLLAH-D-YN
Sequence 2 YLLAHTDEYN



Alignment 33
Sequence 1:
Sequence 2: Allergen Car b 1.0103, Sequence: CAB02206
Sequence identity: 75.00 (120/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVFNYE-ET-SVIPAARLFK---LDGD-L-PKVAPQAISSVEN--GNGG
Sequence 2 MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIK-I-F-EG-PFK-VK-RVDEVD--NFKYNY-VIEG---GD-LEK-S
Sequence 2 PGTIKNITFAEGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-KIVA-P-GGSI-KIS-K-H-KGDHEV-AE--K--KEM-E-LLRAVES
Sequence 2 HELKIVAAPGGGSIVKISSKFHAKGDHEVNAEKMKGAKEMAEKLLRAVES

Sequence 1 YLLAHSDAYN
           YLLAH-D-YN
Sequence 2 YLLAHTDEYN



Alignment 34
Sequence 1:
Sequence 2: Allergen Car b 1.0109, Sequence: ABZ81040
Sequence identity: 75.00 (120/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVFNYE-ET-SVIPAARLFK---LDGD-L-PKVAPQAISSVEN--GNGG
Sequence 2 MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIK-I-F-EG-PFK-VK-RVDEVD--NFKYNY-VIEG---GD-LEK-S
Sequence 2 PGTIKNITFAEGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-KIVA-P-GGSILKIS-K-H-KGDHEV-AE--K--KEM-E-LLRAVES
Sequence 2 HELKIVAAPGGGSILKISSKFHAKGDHEVNAEEMKGAKEMAEKLLRAVES

Sequence 1 YLLAHSDAYN
           YLLAH---YN
Sequence 2 YLLAHTAEYN



Alignment 35
Sequence 1:
Sequence 2: Allergen Car b 1, Sequence: P38950
Sequence identity: 75.00 (120/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           -GVFNYE-ETTSVIPAARLFKAFILDG--L-PKV-PQA-SSVEN-EGNGG
Sequence 2 -GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-F-EG-P-KYVK-RV-E-DHTNFKYNY-VIEG---GD-LEK-S
Sequence 2 PGTIKKITFSEGSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-KIVA-P-GGSI-KIS-K-H-KG-HEV-AE--K--KEM-E-LLRAVES
Sequence 2 HELKIVAAPGGGSIVKISSKFHAKGYHEVNAEEMKGAKEMAEKLLRAVES

Sequence 1 YLLAHSDAYN
           YLLAH---YN
Sequence 2 YLLAHTAEYN



Alignment 36
Sequence 1:
Sequence 2: Allergen Car b 1.0112, Sequence: ABZ81043
Sequence identity: 74.38 (119/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVFNYE-ET-SVIPAARLFK---LDGD-L-PKVAPQAISSVEN--GNGG
Sequence 2 MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIK-I-F-EG-PFK-VK-RVDEVD--NFKYNY-VIEG---GD-LEK-S
Sequence 2 PGTIKNITFAEGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-KIVA-P-GGSI-KIS-K-H-KGDHEV-AE--K--KEM-E-LLRAVES
Sequence 2 HELKIVAAPGGGSIVKISSKFHAKGDHEVNAEEMKGAKEMAEKLLRAVES

Sequence 1 YLLAHSDAYN
           YLLAH---YN
Sequence 2 YLLAHTAEYN



Alignment 37
Sequence 1:
Sequence 2: Allergen Car b 1.0111, Sequence: ABZ81042
Sequence identity: 74.38 (119/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVFNYE-ET-SVIPAARLFK---LDGD-L-PKVAPQAISSVEN--GNGG
Sequence 2 MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIK-I-F-EG-PFK-VK-RVDEVD--NFKYNY-VIEG---GD-LEK-S
Sequence 2 PGTIKNITFAEGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-KIVA-P-GGSI-KIS-K-H-KGDHEV-AE--K--KEM-E-LLRAVES
Sequence 2 HELKIVAAPGGGSIVKISSKFHAKGDHEVNAEKMKGAKEMAEKLLRAVES

Sequence 1 YLLAHSDAYN
           YLLAH---YN
Sequence 2 YLLAHTAEYN



Alignment 38
Sequence 1:
Sequence 2: Allergen Ost c 1.0101, Sequence: ADK39021
Sequence identity: 74.38 (119/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVFNYE-ET-SVIPAARLFK---LDGD-L-PKVAPQAIS-VEN--GNGG
Sequence 2 MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIK-I-F-EG-PFK-VK-RVDEVD--NFKYNY-VIEG---GD-LEK-S
Sequence 2 PGTIKNITFAEGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-KIVA-P-GGSILKIS-K-H-KGDHEV-AE--K--KEM-E-LLRAVES
Sequence 2 HELKIVAAPGGGSILKISSKFHAKGDHEVNAEEMKGAKEMAEKLLRAVES

Sequence 1 YLLAHSDAYN
           YLLAH---YN
Sequence 2 YLLAHTAEYN



Alignment 39
Sequence 1:
Sequence 2: Allergen Car b 1.0110, Sequence: ABZ81041
Sequence identity: 73.75 (118/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVFNYE-ET-SVIPAARLFK---LDGD-L-PKVAPQAISSVEN--GNGG
Sequence 2 MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIK-I-F-EG-PFK-VK-RVDEVD--NFKYNY-VIEG---GD-LEK-S
Sequence 2 PGTIKNITFAEGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-KIVA-P-GGS--KIS-K-H-KGDHEV-AE--K--KEM-E-LLRAVES
Sequence 2 HELKIVAAPGGGSVVKISSKFHAKGDHEVNAEEMKGAKEMAEKLLRAVES

Sequence 1 YLLAHSDAYN
           YLLAH---YN
Sequence 2 YLLAHTAEYN



Alignment 40
Sequence 1:
Sequence 2: Allergen Car b 1.0105, Sequence: CAB02208
Sequence identity: 74.38 (119/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVFNYE-ET-SVIPAARLFK---LD-D-L-PKVAPQAISSVEN--GNGG
Sequence 2 MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIK-I-F-EG-PFK-VK-RVDEVD--NFKYNY-VIEG---GD-LEK-S
Sequence 2 PGTIKNITFAEGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-KIVA-P-GGSI-KIS-K-H-KGDHEV-AE--K--KEM-E-LLRAVES
Sequence 2 HELKIVAAPGGGSIVKISSKFHAKGDHEVNAEKMKGAKEMAEKLLRAVES

Sequence 1 YLLAHSDAYN
           YLLAH-D-YN
Sequence 2 YLLAHTDEYN



Alignment 41
Sequence 1:
Sequence 2: Allergen Car b 1.0113, Sequence: ABZ81044
Sequence identity: 73.75 (118/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVFNYE-ET-SVIPAARLFK---LDGD-L-PKVAPQAISSVEN--GNGG
Sequence 2 MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIK-I-F-EG-PFK-VK-RVDEVD--NFKY-Y-VIEG---GD-LEK-S
Sequence 2 PGTIKNITFAEGIPFKFVKERVDEVDNANFKYSYTVIEGDVLGDKLEKVS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-KIVA-P-GGSI-KIS-K-H-KGDHEV-AE--K--KEM-E-LLRAVES
Sequence 2 HELKIVAAPGGGSIVKISSKFHAKGDHEVNAEEMKGAKEMAEKLLRAVES

Sequence 1 YLLAHSDAYN
           YLLAH---YN
Sequence 2 YLLAHTAEYN



Alignment 42
Sequence 1:
Sequence 2: Allergen Cor a 1.0103, Sequence: CAA50325
Sequence identity: 73.12 (117/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVFNYE-ETTSVIPAARLFK---LDGD-L-PKVAPQAI-SVEN-EGNGG
Sequence 2 MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIK-I-F-EG---KYVK-RVDEVD-TNF-Y-Y-VIEG---GD-LEK--
Sequence 2 PGTIKNITFGEGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVC

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-KIVA-P-GGSILKIS-K-H-KGDHE--AE--K--KEM-E-LLRAVE-
Sequence 2 HELKIVAAPGGGSILKISSKFHAKGDHEINAEEIKGAKEMAEKLLRAVET

Sequence 1 YLLAHSDAYN
           YLLAHS--YN
Sequence 2 YLLAHSAEYN



Alignment 43
Sequence 1:
Sequence 2: Allergen Car b 1.0106, Sequence: CAB02209
Sequence identity: 73.75 (118/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVFNYE-ET-SVIPAARLFK---LD-D-L-PKVAPQAISSVEN--GNGG
Sequence 2 MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIK-I-F-EG-PFK-VK-RVDEVD--NFKYNY-VIEG---GD-LEK-S
Sequence 2 PGTIKNITFAEGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-KIVA-P-GGSI-KIS-K-H-KGDHEV-AE--K--KEM-E-LLRAVES
Sequence 2 HELKIVAAPGGGSIVKISSKFHAKGDHEVNAEEMKGAKEMAEKLLRAVES

Sequence 1 YLLAHSDAYN
           YLLAH---YN
Sequence 2 YLLAHTAEYN



Alignment 44
Sequence 1:
Sequence 2: Allergen Cor a 1.0102, Sequence: CAA50328
Sequence identity: 73.12 (117/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVFNYE-ET-SVIPAARLFK---LDGD-L-PKVAPQAI-SVEN-EGNGG
Sequence 2 MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIK-I-F-EG---KYVK-RVDEVD-TNFKY-Y-VIEG---GD-LEK--
Sequence 2 PGTIKNITFGEGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVC

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-KIVA-P-GGSILKIS-K-H-KGDHE--AE--K--KEM-E-LLRAVE-
Sequence 2 SELKIVAAPGGGSILKISSKFHAKGDHEINAEEMKGAKEMAEKLLRAVET

Sequence 1 YLLAHSDAYN
           YLLAHS--YN
Sequence 2 YLLAHSAEYN



Alignment 45
Sequence 1:
Sequence 2: Allergen Car b 1.0102, Sequence: CAA47357
Sequence identity: 73.12 (117/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           -GVFNYE-ET-SVIPAARLFK---LDGD-L-PKVAPQAISSVEN--GNGG
Sequence 2 -GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIK-I-F-EG-PFK-VK-RVDEVD--NFKYNY-VIEG---GD-LEK-S
Sequence 2 PGTIKNITFAEGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-KIVA-P-GGSI-KIS-K-H-KG-HEV-AE--K--KEM-E-LLRAVES
Sequence 2 HELKIVAAPGGGSIVKISSKFHAKGYHEVNAEEMKGAKEMAEKLLRAVES

Sequence 1 YLLAHSDAYN
           YLLAH---YN
Sequence 2 YLLAHTAEYN



Alignment 46
Sequence 1:
Sequence 2: Allergen Cor a 1.0101, Sequence: CAA50327
Sequence identity: 72.50 (116/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVFNYE-ET-SVIPAARLFK---LDGD-L-PKVAPQAI-SVEN-EGNGG
Sequence 2 MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIK-I-F-EG---KYVK-RVDEVD-TNF-Y-Y-VIEG---GD-LEK--
Sequence 2 PGTIKNITFGEGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVC

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-KIVA-P-GGSILKIS-K-H-KGDHE--AE--K--KEM-E-LLRAVE-
Sequence 2 HELKIVAAPGGGSILKISSKFHAKGDHEINAEEMKGAKEMAEKLLRAVET

Sequence 1 YLLAHSDAYN
           YLLAHS--YN
Sequence 2 YLLAHSAEYN



Alignment 47
Sequence 1:
Sequence 2: Allergen Car b 1, Sequence: P38949
Sequence identity: 72.50 (116/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           -GVFNYE-ET-SVIPAARLFK---LDGD-L-PKVAPQ-ISSVEN--GNGG
Sequence 2 -GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIK-I-F-EG-PFK-VK-RVDEVD--NFKYNY-VIEG---GD-LEK-S
Sequence 2 PGTIKNITFAEGIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-KIVA-P-GGSI-KIS-K-H-KG-HEV-AE--K--KEM-E-LLRAVES
Sequence 2 HELKIVAAPGGGSIVKISSKFHAKGYHEVNAEKMKGAKEMAEKLLRAVES

Sequence 1 YLLAHSDAYN
           YLLAH---YN
Sequence 2 YLLAHTAEYN



Alignment 48
Sequence 1:
Sequence 2: Allergen Car b 1.0107, Sequence: CAB02213
Sequence identity: 73.12 (117/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVFNYE-ET-SVIPAARLFK---LD-D-L-PKVAPQAISSVEN--GNGG
Sequence 2 MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIK-I-F-EG-PFK-VK-RVDEVD--NFK--Y-VIEG---GD-LEK-S
Sequence 2 PGTIKNITFAEGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-KIVA-P-GGSILKIS-K-H-KGDHEV-AE--K--KEM-E-LLRAVES
Sequence 2 LELKIVAAPGGGSILKISGKFHAKGDHEVNAEEMKGAKEMAEKLLRAVES

Sequence 1 YLLAHSDAYN
           YLLAH---YN
Sequence 2 YLLAHTAEYN



Alignment 49
Sequence 1:
Sequence 2: Allergen Cor a 1, Sequence: Q08407
Sequence identity: 71.88 (115/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           -GVFNYE-ET-SVIPAARLFK---LDGD-L-PKVAPQAI-SVEN-EGNGG
Sequence 2 -GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIK-I-F-EG---KYVK-RVDEVD-TNF-Y-Y-VIEG---GD-LEK--
Sequence 2 PGTIKNITFGEGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVC

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-KIVA-P-GGSILKIS-K-H-KGDHE--AE--K--KEM-E-LLRAVE-
Sequence 2 HELKIVAAPGGGSILKISSKFHAKGDHEINAEEMKGAKEMAEKLLRAVET

Sequence 1 YLLAHSDAYN
           YLLAHS--YN
Sequence 2 YLLAHSAEYN



Alignment 50
Sequence 1:
Sequence 2: Allergen Bet v 1.0301, Sequence: CAA54696.1
Sequence identity: 71.88 (115/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVFNYE-E-TSVI--ARLFK-F-LD-DNL-PKVAP---SS-ENIEGNGG
Sequence 2 MGVFNYEDEATSVIAPARLFKSFVLDADNLIPKVAPENVSSAENIEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-FPEG--FKY-K-RVDE-DH-NFKY-YS-IEGGP-GDTLEKIS
Sequence 2 PGTIKKITFPEGSHFKYMKHRVDEIDHANFKYCYSIIEGGPLGDTLEKIS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -EIKIVA-P-GGSILKI--KYHTKGD-----E--KA-KE----L--AVE-
Sequence 2 YEIKIVAAPGGGSILKITSKYHTKGDISLNEEEIKAGKEKGAGLFKAVEN

Sequence 1 YLLAHSDAYN
           YL-AH--AYN
Sequence 2 YLVAHPNAYN



Alignment 51
Sequence 1:
Sequence 2: Allergen Car b 1.0108, Sequence: CAB02215
Sequence identity: 71.88 (115/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVFNYE-ET-SV-PAARLFK---LD-D-L-PKVAPQAISSVEN--GNGG
Sequence 2 MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIK-I-F-EG-PFK-VK-RVDEVD--NFK--Y-VIEG---GD-LEK-S
Sequence 2 PGTIKNITFAEGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E--IVA-P-GGSILKIS-K-H-KGDHEV-AE--K--KEM-E-LLRAVES
Sequence 2 LELTIVAAPGGGSILKISGKFHAKGDHEVNAEEMKGAKEMAEKLLRAVES

Sequence 1 YLLAHSDAYN
           YLLAH---YN
Sequence 2 YLLAHTAEYN



Alignment 52
Sequence 1:
Sequence 2: Allergen Cor a 1.0104, Sequence: CAA50326
Sequence identity: 71.25 (114/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVFNYE-ET-SVI-AARLFK---LDGD-L-PKVAPQAI-SVEN--GNGG
Sequence 2 MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIK-I-F-EG---KYVK-RVDEVD-TNFKY-Y-VIEG---GD-LEK--
Sequence 2 PGTIKNITFGEGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVC

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-KIVA-P-GGS-LKIS-K-H-KGDHE--AE--K--KEM-E-LLRAVE-
Sequence 2 SELKIVAAPGGGSTLKISSKFHAKGDHEINAEEMKGAKEMAEKLLRAVET

Sequence 1 YLLAHSDAYN
           YLLAHS--YN
Sequence 2 YLLAHSAEYN



Alignment 53
Sequence 1:
Sequence 2: Allergen Cor a 1.0301, Sequence: CAA96549
Sequence identity: 71.25 (114/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVFNYETETTSVIP-ARLFK-F-LD-DNL-PKVAP-AI-S-E-IEGNGG
Sequence 2 MGVFNYETETTSVIPPARLFKRFVLDSDNLIPKVAPKAIKSIEIIEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-F-EG-PF-Y-K--V-E-D--NF-Y-YSVIEG----D-LEKI-
Sequence 2 PGTIKKICFDEGSPFNYIKQKVEEIDQANFSYRYSVIEGDALSDKLEKIN

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -EIKIVA-P-GGSILK---KYHT-GDHE-K-EQ-KA-KE----L--AVE-
Sequence 2 YEIKIVASPHGGSILKSISKYHTIGDHELKDEQIKAGKEKASGLFKAVEG

Sequence 1 YLLAHSDAYN
           YLLAHSDAYN
Sequence 2 YLLAHSDAYN



Alignment 54
Sequence 1:
Sequence 2: Allergen Cor a 1.0401, Sequence: AAD48405
Sequence identity: 67.50 (108/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVF-YE-E-TSVIP-ARLFK-F-LD-DNL-PKVAPQ---S-EN-EGNGG
Sequence 2 MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-F-EG--FKY-K--V-E-DH-NFKY-YS-IEGGP-G-TLEKIS
Sequence 2 PGTIKKITFAEGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIS

Sequence 1 NEIKIVATPDGG-SILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVE
           -EIK--A-P-GG-SILKI--KYHTKG------E--KA-KE----L--AVE
Sequence 2 YEIKMAAAPHGGGSILKITSKYHTKGNASINEEEIKAGKEKAAGLFKAVE

Sequence 1 SYLLAHSDAYN
           -YLLAH-DAY-
Sequence 2 AYLLAHPDAYC



Alignment 55
Sequence 1:
Sequence 2: Allergen Cor a 1.0404, Sequence: AAG40331
Sequence identity: 66.88 (107/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVF-YE-E-TSVIP-ARLFK-F-LD-DNL-PKVAPQ---S-EN-EGNGG
Sequence 2 MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-F-EG--FKY-K--V-E-DH-NFKY-YS-IEGGP-G-TLEKI-
Sequence 2 PGTIKKITFAEGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIP

Sequence 1 NEIKIVATPDGG-SILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVE
           -EIK--A-P-GG-SILKI--KYHTKG------E--KA-KE----L--AVE
Sequence 2 YEIKMAAAPHGGGSILKITSKYHTKGNASINEEEIKAGKEKAAGLFKAVE

Sequence 1 SYLLAHSDAYN
           -YLLAH-DAY-
Sequence 2 AYLLAHPDAYC



Alignment 56
Sequence 1:
Sequence 2: Allergen Cas s 1, Sequence: CAD10374
Sequence identity: 68.12 (109/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVF--E-E-TS-IP--RLFKAF-LD-DNL-PK-AP-AI-S-E-IEGNGG
Sequence 2 MGVFTHENEITSAIPPGRLFKAFVLDADNLIPKLAPHAIKSAEIIEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-F-EG--FKYVK-R-DE-D--NF-Y-YSVIEG------LEKIS
Sequence 2 PGTIKKITFGEGSQFKYVKHRIDEIDQANFTYCYSVIEGDVVNELLEKIS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -EIKIVA-PDGGSILK---KYHTKG--E-K-E-V-A-KE----L--AVE-
Sequence 2 YEIKIVASPDGGSILKNTSKYHTKGEQEIKEEKVMAGKEKAAGLFKAVEA

Sequence 1 YLLAHSDAYN
           YLLAHSDAYN
Sequence 2 YLLAHSDAYN



Alignment 57
Sequence 1:
Sequence 2: Allergen Cor a 1.0402, Sequence: AAG40329
Sequence identity: 66.25 (106/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVF-YE-E-TSVIP-ARLFK-F-LD-DNL-PKVAPQ-----EN-EGNGG
Sequence 2 MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-F-EG--FKY-K--V-E-DH-NFKY-YS-IEGGP-G-TLEKIS
Sequence 2 PGTIKKITFAEGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIS

Sequence 1 NEIKIVATPDGG-SILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVE
           -EIK--A-P-GG-SILKI--KYHTKG------E--KA-KE----L--AVE
Sequence 2 YEIKMAAAPHGGGSILKITSKYHTKGNASISEEEIKAGKEKAAGLFKAVE

Sequence 1 SYLLAHSDAYN
           -YLLAH-D-Y-
Sequence 2 AYLLAHPDTYC



Alignment 58
Sequence 1:
Sequence 2: Allergen Cor a 1.0403, Sequence: AAG40330
Sequence identity: 66.25 (106/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVF-YE-E-TSVIP-ARLFK-F-LD-DNL-PKVAPQ-----EN-EGNGG
Sequence 2 MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-F-EG--FKY-K--V-E-DH-NFKY-YS-IEGGP-G-TLEKIS
Sequence 2 PGTIKKITFAEGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIS

Sequence 1 NEIKIVATPDGG-SILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVE
           -EIK--A-P-GG-SILKI--KYHTKG------E--KA-KE----L--AVE
Sequence 2 YEIKMAAAPHGGGSILKITSKYHTKGNASISEEEIKAGKEKAAGLFKAVE

Sequence 1 SYLLAHSDAYN
           -YLLAH-D-Y-
Sequence 2 AYLLAHPDTYC



Alignment 59
Sequence 1:
Sequence 2: Allergen Mal d 1.0401, Sequence: CAA96535
Sequence identity: 65.62 (105/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVFNYETETTSVIPA-RLFKAFILDGDNL-PK-APQAI-S-E-IEG-GG
Sequence 2 MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           -GTIKK--F-EG----YVK-RV---D--NF-Y-YS-IEG----D-LEKI-
Sequence 2 VGTIKKVTFGEGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKIT

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-K--A-PDGGSI-K----YH-KGD-E-K-E-VKA-KE----L----E-
Sequence 2 YETKLIASPDGGSIIKTTSHYHAKGDVEIKEEHVKAGKEKASGLFKLLEA

Sequence 1 YLLAHSDAYN
           YLLAHSDAYN
Sequence 2 YLLAHSDAYN



Alignment 60
Sequence 1:
Sequence 2: Allergen Jug r 5.0101, Sequence: APD76154
Sequence identity: 66.88 (107/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVF-YETE-TSVIP-ARLFKAF-LD-DNL-PKV-PQA--S-E-IEGNGG
Sequence 2 MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-F-EG---KYVK-R-D--D--NF-Y-YSVIEG----D--EKIS
Sequence 2 PGTIKKINFGEGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKIS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-KIVA---GGSILK----YH-KGDHE-K-E-VK--KE----L--AVE-
Sequence 2 YETKIVASHEGGSILKSISHYHSKGDHEIKEEDVKDGKEKASGLFKAVEG

Sequence 1 YLLAHSDAYN
           YLLAH-DAYN
Sequence 2 YLLAHPDAYN



Alignment 61
Sequence 1:
Sequence 2: Allergen Fag s 1.0101, Sequence: ACJ23864
Sequence identity: 65.62 (105/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVF-YE-ETT-VI--ARLFKAF-LD-DNL-PKVAPQAI-S-E-IEG-GG
Sequence 2 MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-F-EG--F-YVK-R-DE-D--NF-Y----IEG--I--TLEKI-
Sequence 2 PGTIKKITFGEGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIA

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -EIK-VA-PDGGSILK---KYHTKGDHE-K--Q-KA-KE-------AVE-
Sequence 2 YEIKLVASPDGGSILKSTSKYHTKGDHEIKEDQIKAGKEEASGIFKAVEA

Sequence 1 YLLAHSDAYN
           YLLA---AY-
Sequence 2 YLLANPAAYH



Alignment 62
Sequence 1:
Sequence 2: Allergen Mal d 1.0402, Sequence: CAA96536
Sequence identity: 64.38 (103/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVFNYETE-TSVIPA-RLFKAFILDGDNL-PK-APQAI-S---IEG-GG
Sequence 2 MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTKIIEGDGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           -GTIKK--F-EG----YVK-RV---D--NF-Y-YS-IEG----D-LEKI-
Sequence 2 VGTIKKVTFGEGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKIT

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-K--A-PDGGSI-K----YH-KGD-E-K-E-VKA-KE----L----E-
Sequence 2 YETKLIASPDGGSIIKTNSHYHAKGDVEIKEEHVKAGKEKASGLFKLLEA

Sequence 1 YLLAHSDAYN
           YLLAHSDAYN
Sequence 2 YLLAHSDAYN



Alignment 63
Sequence 1:
Sequence 2: Allergen Mal d 1.0403, Sequence: CAA96537
Sequence identity: 64.38 (103/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVFNYETE-TSVIPA-RLFKAFILDGDNL-PK-APQAI-S-E-IEG-GG
Sequence 2 MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           -GTIKK--F-EG----YVK-RV---D--NF-Y-YS-IEG----D-LEKI-
Sequence 2 VGTIKKVTFGEGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKIT

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-K--A-PDGGSI-K----Y--KGD-E-K-E-VKA-KE----L----E-
Sequence 2 YETKLIASPDGGSIIKTTSHYRAKGDVEIKEEHVKAGKEKASGLFKLLEA

Sequence 1 YLLAHSDAYN
           YLLAHSDAYN
Sequence 2 YLLAHSDAYN



Alignment 64
Sequence 1:
Sequence 2: Allergen Pru av 1, Sequence: O24248
Sequence identity: 59.38 (95/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVF-YE-E-TS-IP--RLFKAF-LD-DNL-PK-APQAI---E--EG-GG
Sequence 2 MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-F-EG----YVK---D--D--N--Y-Y--IEG---GDTLEKIS
Sequence 2 PGTIKKITFGEGSQYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKIS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-K-VA-P-GGSI-K----YHTKG--E-K-E-VKA-KE----L----E-
Sequence 2 YETKLVASPSGGSIIKSTSHYHTKGNVEIKEEHVKAGKEKASNLFKLIET

Sequence 1 YLLAHSDAYN
           YL--H-DAYN
Sequence 2 YLKGHPDAYN



Alignment 65
Sequence 1:
Sequence 2: Allergen Pru p 1.0101, Sequence: Q2I6V8
Sequence identity: 59.38 (95/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVF-YE-E-TS-IP--RLFKAF-LD-DNL-PK-APQAI---E--EG-GG
Sequence 2 MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-F-EG----YVK---D--D--N--Y-Y--IEG---GD-LEKIS
Sequence 2 PGTIKKITFGEGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKIS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-K-VA-P-GGSI-K----YHTKGD-E-K-E-VKA-KE----L----E-
Sequence 2 YETKLVASPSGGSIIKSTSHYHTKGDVEIKEEHVKAGKEKASNLFKLIET

Sequence 1 YLLAHSDAYN
           YL--H-DAYN
Sequence 2 YLKGHPDAYN



Alignment 66
Sequence 1:
Sequence 2: Allergen Mal d 1.0301, Sequence: CAA96534
Sequence identity: 62.50 (100/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVFNYETE-TSVIP-ARLF-AF-LD-DNL-PK-APQA--S-E--EG-GG
Sequence 2 MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           -GTIKKI-F-EG----YVK-R-D-VD--NF-Y-YSVIEG--I--T-EKIS
Sequence 2 VGTIKKINFGEGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKIS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-K-VA----GS--K----YHTK-D-E-K-E-VKA-KE----L----E-
Sequence 2 YETKLVAS-GSGSVIKSTSHYHTKSDVEIKEEHVKAGKEKASHLFKLIEN

Sequence 1 YLLAHSDAYN
           YLLAHSDAYN
Sequence 2 YLLAHSDAYN



Alignment 67
Sequence 1:
Sequence 2: Allergen Pru ar 1, Sequence: O50001
Sequence identity: 60.00 (96/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVF-YETE-TSVIP---LFKAFILD-DNL-PKVAP-A----E--EG-GG
Sequence 2 MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           -GTIKK--F-EG----YVK-RVD--D--N--Y-Y--IEG----D--E-I-
Sequence 2 VGTIKKVTFGEGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIA

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           --IK-VA-PDGGSI-K----YHTKGD-E-K-EQVKA-KE----L---VE-
Sequence 2 YDIKLVASPDGGSIVKTTSHYHTKGDVEIKEEQVKAGKEKAAGLFKLVEA

Sequence 1 YLLAHSDAYN
           YLLA--DAYN
Sequence 2 YLLANPDAYN



Alignment 68
Sequence 1:
Sequence 2: Allergen Que a 1.0301, Sequence: ABZ81046
Sequence identity: 58.75 (94/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVF-YE-E--SVIP-ARLFKAF-LD-DNL-PKV-PQA--S-E-IEGNGG
Sequence 2 MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-F-EG---K--K-R-D--D--NF-Y--SVIEG----D-LE--S
Sequence 2 PGTIKKITFGEGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-KIVA-PDGGSI-K---KY-TKGD-----E-----KE-------AVE-
Sequence 2 TETKIVASPDGGSIVKSTSKYQTKGDFQLTDELIRGGKEKASEVFKAVEA

Sequence 1 YLLAHSDAYN
           YL-AH-D-Y-
Sequence 2 YLVAHPDLYK



Alignment 69
Sequence 1:
Sequence 2: Allergen Mal d 1.0304, Sequence: AAO25113
Sequence identity: 60.62 (97/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVF-YE-E-TSVIP-ARLF-AF-LD-DNL-PK-APQA--S-E--EG-GG
Sequence 2 MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           -GTIKKI-F-EG----YVK-R-D-VD--NF-Y-YSVIEG--I--T-EKIS
Sequence 2 VGTIKKINFGEGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKIS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-K-VA----GS--K----YHTKGD-E-K-E-VKA-KE----L----E-
Sequence 2 YETKLVAS-GSGSVIKSTSHYHTKGDVEIKEEHVKAGKEKASHLFKLIEN

Sequence 1 YLLAHSDAYN
           YLL-H-DAYN
Sequence 2 YLLEHPDAYN



Alignment 70
Sequence 1:
Sequence 2: Allergen Mal d 1.0302, Sequence: AAK13027
Sequence identity: 60.62 (97/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVF-YE-E-TSVIP-ARLF-AF-LD-DNL-PK-APQA--S-E--EG-GG
Sequence 2 MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           -GTIKKI-F-EG----YVK-R-D-VD--NF-Y-YSVIEG--I--T-EKIS
Sequence 2 VGTIKKINFGEGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKIS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-K-VA----GS--K----YHTKGD-E-K-E-VKA-KE----L----E-
Sequence 2 YETKLVAA-GSGSVIKSTSHYHTKGDVEIKEEHVKAGKEKASHLFKLIEN

Sequence 1 YLLAHSDAYN
           YLL-H-DAYN
Sequence 2 YLLEHQDAYN



Alignment 71
Sequence 1:
Sequence 2: Allergen Que m 1.0101, Sequence: AUH28179
Sequence identity: 57.50 (92/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGV--YE-E--SVIP-ARLFKAF-LD-DNL-PKV-PQA--S-E-IEGNGG
Sequence 2 MGVVAYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-F-EG---K--K-R-D--D--NF----SVIEG----D-LE--S
Sequence 2 PGTIKKITFGEGSHLKHAKHRIDVIDPENFTFSFSVIEGDALFDKLENVS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-KIVA-PDGGSI-K---KY-TKGD-----E-----KE-------AVE-
Sequence 2 TETKIVASPDGGSIVKSTCKYQTKGDFQLTDELIRGGKEKASGVFKAVEA

Sequence 1 YLLAHSDAYN
           YL-AH-D-Y-
Sequence 2 YLVAHPDGYY



Alignment 72
Sequence 1:
Sequence 2: Allergen Pru du 1.0101, Sequence: B6CQS9
Sequence identity: 56.25 (90/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MG-F-Y--E-TSVIP--RLFKA--L--D-L-PK-APQ---S-E--EG-GG
Sequence 2 MGIFTYTDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           -GTIKKISF-EG----YVK---D--D--NF-YNYS--EG----D--EKIS
Sequence 2 VGTIKKISFGEGSHYSYVKHQIDGLDKDNFVYNYSLVEGDALSDKVEKIS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -EIK-VA--DGGS--K----YHTKGD-E-K-E-VKA-KE----L----E-
Sequence 2 YEIKLVASADGGSVIKSTSNYHTKGDVEIKEEDVKAGKEKATGLFKLIEN

Sequence 1 YLLAHSDAYN
           YL-A--DAYN
Sequence 2 YLVANPDAYN



Alignment 73
Sequence 1:
Sequence 2: Allergen Mal d 1.0303, Sequence: AAK13028
Sequence identity: 59.38 (95/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVF-YE-E-TSVIP-ARL--AF-LD-DNL-PK-APQA--S-E--EG-GG
Sequence 2 MGVFTYEFEFTSVIPPARLYNAFVLDADNLIPKIAPQAVKSTEILEGDGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           -GTIKKI-F-EG----YVK---D-VD--NF-Y-YSVIEG--I--T-EKIS
Sequence 2 VGTIKKINFGEGSTYSYVKHKIDGVDKDNFVYQYSVIEGDAISETIEKIS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-K-VA----GS--K----YHTKGD-E-K-E-VKA-KE----L----E-
Sequence 2 YETKLVAS-GSGSVIKSISHYHTKGDVEIKEEHVKAGKEKASHLFKLIEN

Sequence 1 YLLAHSDAYN
           YLL-H-DAYN
Sequence 2 YLLEHHDAYN



Alignment 74
Sequence 1:
Sequence 2: Allergen Que i 1.0101, Sequence: QGS84240
Sequence identity: 59.38 (95/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGV---E---TSVIP-ARLFKAF-LD-DNL-PKV-PQAI-S-E-IEGNGG
Sequence 2 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-F-E---FKY-K-R-D--D--N--Y--SVIEG----D-----S
Sequence 2 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -EIK-VA-PDGGSI-K---KY-TKGD---K-EQ--A--E----L--AVE-
Sequence 2 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA

Sequence 1 YLLAHSDAYN
           YLLAH-D-Y-
Sequence 2 YLLAHPDLYT



Alignment 75
Sequence 1:
Sequence 2: Allergen Mal d 1.0201, Sequence: AAB01362
Sequence identity: 56.88 (91/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGV---E-E-TS-IP--RLFKAF-LD-DNL-PK-APQAI---E--EG-GG
Sequence 2 MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-F-EG----YVK---D-VD--N--Y-Y--IEG----DT-EK-S
Sequence 2 PGTIKKITFGEGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-K-VA----GSI-K----YHTKGD-E-K-E-VKA-KE----L----ES
Sequence 2 YETKLVAS-GSGSIIKSISHYHTKGDVEIKEEHVKAGKEKAHGLFKLIES

Sequence 1 YLLAHSDAYN
           YL--H-DAYN
Sequence 2 YLKGHPDAYN



Alignment 76
Sequence 1:
Sequence 2: Allergen Mal d 1.0202, Sequence: AAD26545
Sequence identity: 56.88 (91/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGV---E-E-TS-IP--RLFKAF-LD-DNL-PK-APQAI---E--EG-GG
Sequence 2 MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-F-EG----YVK---D-VD--N--Y-Y--IEG----DT-EK-S
Sequence 2 PGTIKKITFGEGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-K-VA----GSI-K----YHTKGD-E-K-E-VKA-KE----L----ES
Sequence 2 YETKLVAS-GSGSIIKSISHYHTKGDVEIKEEHVKAGKEKAHGLFKLIES

Sequence 1 YLLAHSDAYN
           YL--H-DAYN
Sequence 2 YLKGHPDAYN



Alignment 77
Sequence 1:
Sequence 2: Allergen Mal d 1.0103, Sequence: AAD26546
Sequence identity: 56.88 (91/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGV---E-E-TS-IP--RLFKAF-LD-DNL-PK-APQAI---E--EGNGG
Sequence 2 MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-F-EG----YVK-R-D--D-----Y-Y--IEG----DT-EKIS
Sequence 2 PGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKIS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-K-VA---G--I--IS--YHTKG--E-K-E-VKA-KE----L----ES
Sequence 2 YETKLVACGSGSTIKSISH-YHTKGNIEIKEEHVKAGKEKAHGLFKLIES

Sequence 1 YLLAHSDAYN
           YL--H-DAYN
Sequence 2 YLKGHPDAYN



Alignment 78
Sequence 1:
Sequence 2: Allergen Pyr c 1, Sequence: O65200
Sequence identity: 57.50 (92/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MG----E-E-TS-IP--RLFKAF-LD-DNL-PK-APQAI---E--EGNGG
Sequence 2 MGLYTFENEFTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-F-EG----YVK-RVD--D-----Y-Y--IEG----DT-EKIS
Sequence 2 PGTIKKITFGEGSQYGYVKHRVDSIDEASYSYAYTLIEGDALTDTIEKIS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-K-VA---G--I--IS--YHTKGD-E-K-E-VKA-KE----L----ES
Sequence 2 YEAKLVASGSGSTIKSISH-YHTKGDIEIKEEHVKAGKEKAHGLFKLIES

Sequence 1 YLLAHSDAYN
           YL--H-DAYN
Sequence 2 YLKDHPDAYN



Alignment 79
Sequence 1:
Sequence 2: Allergen Mal d 1.0108, Sequence: AAD29671
Sequence identity: 56.88 (91/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGV---E-E-TS-IP--RLFKAF-LD-DNL-PK-APQAI---E--EGNGG
Sequence 2 MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-F-EG----YVK-R-D--D-----Y-Y--IEG----DT-EKIS
Sequence 2 PGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKIS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-K-VA---G--I--IS--YHTKG--E-K-E-VKA-KE----L----ES
Sequence 2 YETKLVACGSGSTIKSISH-YHTKGNIEIKEEHVKAGKEKAHGLFKLIES

Sequence 1 YLLAHSDAYN
           YL--H-DAYN
Sequence 2 YLKDHPDAYN



Alignment 80
Sequence 1:
Sequence 2: Allergen Que ac 1.0101, Sequence: QOL10866
Sequence identity: 57.50 (92/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGV-NYE---TSVIP-ARLFKAF-LD-DNL--KV-P-A--S-E-IEGNGG
Sequence 2 MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKK--F-E----KY-K-R-D--D--N--Y--SVIEG----D----IS
Sequence 2 PGTIKKFTFGEASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASIS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-K-VA-PDGGSI-K---KY-TKG----K-EQ--A--E----L--AVE-
Sequence 2 TEVKFVASPDGGSIMKSTTKYQTKGGFQLKEEQIQAAVEKGTGLFKAVEA

Sequence 1 YLLAHSDAYN
           YLLAH-D-YN
Sequence 2 YLLAHPDLYN



Alignment 81
Sequence 1:
Sequence 2: Allergen Fra a 1, Sequence: Q256S7
Sequence identity: 55.00 (88/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGV--YE-E-TS-IPA--LFKAF-LD-DNL-PK-APQAI---E--EG-GG
Sequence 2 MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-F-EG----YVK------D--N--Y-YS-IEG----D--EKI-
Sequence 2 PGTIKKITFGEGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKID

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-K-V--P-GG-I-K---KYHTKGD-E-K-E-VKA-KE----L----E-
Sequence 2 YETKLVSAPHGGTIIKTTSKYHTKGDVEIKEEHVKAGKEKASHLFKLIEG

Sequence 1 YLLAHSDAYN
           YL--H---YN
Sequence 2 YLKDHPSEYN



Alignment 82
Sequence 1:
Sequence 2: Allergen Mal d 1.0104, Sequence: AAD26552
Sequence identity: 56.88 (91/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGV---E-E-TS-IP--RLFKAF-LD-DNL-PK-APQAI---E--EGNGG
Sequence 2 MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-F-EG----YVK-R-D--D-----Y-Y--IEG----DT-EKIS
Sequence 2 PGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKIS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-K-VA---G--I--IS--YHTKG--E-K-E-VKA-KE----L----ES
Sequence 2 YETKLVACGSGSTIKSISH-YHTKGNIEIKEEHVKAGKEKAHGLFKLIES

Sequence 1 YLLAHSDAYN
           YL--H-DAYN
Sequence 2 YLKDHPDAYN



Alignment 83
Sequence 1:
Sequence 2: Allergen Mal d 1.0204, Sequence: AAD26548
Sequence identity: 56.25 (90/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGV---E-E-TS-IP--RLFKAF-LD-DNL-PK-APQAI---E--EG-GG
Sequence 2 MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-F-EG----YVK---D-VD--N--Y-Y--IEG----DT-EK-S
Sequence 2 PGTIKKITFGEGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-K--A----GSI-K----YHTKGD-E-K-E-VKA-KE----L----ES
Sequence 2 YETKLMAS-GSGSIIKSISHYHTKGDVEIKEEHVKAGKEKAHGLFKLIES

Sequence 1 YLLAHSDAYN
           YL--H-DAYN
Sequence 2 YLKGHPDAYN



Alignment 84
Sequence 1:
Sequence 2: Allergen Mal d 1.0206, Sequence: AAD13683
Sequence identity: 56.25 (90/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGV---E-E-TS-IP--RLFK-F-LD-DNL-PK-APQAI---E--EG-GG
Sequence 2 MGVYTFENEYTSEIPPPRLFKGFVLDADNLIPKIAPQAIKHAEILEGDGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-F-EG----YVK---D-VD--N--Y-Y--IEG----DT-EK-S
Sequence 2 PGTIKKITFGEGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-K-VA----GSI-K----YHTKGD-E-K-E-VKA-KE----L----ES
Sequence 2 YETKLVAS-GSGSIIKSISHYHTKGDVEIKEEHVKAGKEKAHGLFKLIES

Sequence 1 YLLAHSDAYN
           YL--H-DAYN
Sequence 2 YLKGHPDAYN



Alignment 85
Sequence 1:
Sequence 2: Allergen Fra a 1, Sequence: Q3T923
Sequence identity: 53.75 (86/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGV--YE-E-TS-IPA--LFKAF-LD-DNL-PK-APQA----E--EG-GG
Sequence 2 MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-F-EG----YVK------D--N--Y-YS-IEG----D--EKI-
Sequence 2 PGTIKKITFGEGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKID

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-K-V--P-GG---K---KYHTKGD-E-K-E-VKA-KE----L----E-
Sequence 2 YETKLVSAPHGGTVIKTTSKYHTKGDVEIKEEHVKAGKEKASHLFKLIEG

Sequence 1 YLLAHSDAYN
           YL--H---YN
Sequence 2 YLKDHPSEYN



Alignment 86
Sequence 1:
Sequence 2: Allergen Mal d 1.0203, Sequence: AAD26547
Sequence identity: 56.25 (90/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGV---E-E-TS-IP--RLFKAF-LD-DNL-PK-APQAI---E--EG-GG
Sequence 2 MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-F-EG----YVK---D-VD--N--Y-Y--IEG----DT-EK-S
Sequence 2 PGTIKKITFGEGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-K-VA----GSI-K----YHTKGD-E-K-E-VKA-KE----L----ES
Sequence 2 YETKLVAS-GSGSIIKSISHYHTKGDVEIKEEHVKAGKEKAHGLFKLIES

Sequence 1 YLLAHSDAYN
           -L--H-DAYN
Sequence 2 HLKGHPDAYN



Alignment 87
Sequence 1:
Sequence 2: Allergen Mal d 1.0207, Sequence: AAK13030
Sequence identity: 56.25 (90/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGV---E-E-TS-IP--RLFKAF-LD-DNL-PK-APQAI---E--EG-GG
Sequence 2 MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGT-KKI-F-EG----YVK---D-VD--N--Y-Y--IEG----DT-EK-S
Sequence 2 PGTTKKITFGEGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-K-VA----GSI-K----YHTKGD-E-K-E-VKA-KE----L----ES
Sequence 2 YETKLVAS-GSGSIIKSISHYHTKGDVEIKEEHVKAGKEKAHGLFKLIES

Sequence 1 YLLAHSDAYN
           YL--H-DAYN
Sequence 2 YLKGHPDAYN



Alignment 88
Sequence 1:
Sequence 2: Allergen Can s 5.0101, Sequence: AFN42528
Sequence identity: 54.38 (87/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVF-YE-E-TS-I--ARLFKAF-LDGDNL-PK-APQA---VE--EGNGG
Sequence 2 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPI-GDTLEKI
           -GTIKKI-F--G-PFKYVK------D-----Y-YS-IEG----G--LEKI
Sequence 2 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI

Sequence 1 SNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVE
           --E-K-VA--DGG---K---KY---GD--V--E-VK---------L--VE
Sequence 2 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE

Sequence 1 SYLLAHSDAYN
           -YL--H--AYN
Sequence 2 AYLKDHPEAYN



Alignment 89
Sequence 1:
Sequence 2: Allergen Mal d 1.0101, Sequence: CAA58646
Sequence identity: 56.25 (90/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGV---E-E-TS-IP--RLFKAF-LD-DNL-PK-APQAI---E--EGNGG
Sequence 2 MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-F-EG----YVK-R-D--D-----Y-Y--IEG----DT-EKIS
Sequence 2 PGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKIS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-K-VA---G--I--IS--YHTKG--E-K-E-VK--KE----L----ES
Sequence 2 YETKLVACGSGSTIKSISH-YHTKGNIEIKEEHVKVGKEKAHGLFKLIES

Sequence 1 YLLAHSDAYN
           YL--H-DAYN
Sequence 2 YLKDHPDAYN



Alignment 90
Sequence 1:
Sequence 2: Allergen Mal d 1.0107, Sequence: AAD26555
Sequence identity: 56.25 (90/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGV---E-E-TS-IP--RLFKAF-LD-DNL-PK-APQAI---E--EGNGG
Sequence 2 MGVYTFENEYTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-F-EG----YVK-R-D--D-----Y-Y--IEG----DT-EKIS
Sequence 2 PGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKIS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-K-VA---G--I--IS--YHTKG--E-K-E-VKA-K-----L----ES
Sequence 2 YETKLVACGSGSTIKSISH-YHTKGNIEIKEEHVKAGKAKAHGLFKLIES

Sequence 1 YLLAHSDAYN
           YL--H-DAYN
Sequence 2 YLKGHPDAYN



Alignment 91
Sequence 1:
Sequence 2: Allergen Mal d 1.0105, Sequence: AAD26553
Sequence identity: 56.88 (91/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGV---E-E-TS-IP--RLFKAF-LD-DNL-PK-APQAI---E--EGNGG
Sequence 2 MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-F-EG----YVK-R-D--D-----Y-Y--IEG----DT-EKIS
Sequence 2 PGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKIS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-K-VA---G--I--IS--YHTKG--E-K-E-VKA-KE----L----ES
Sequence 2 YETKLVACGSGSTIKSISH-YHTKGNIEIKEEHVKAGKEKAHGLFKLIES

Sequence 1 YLLAHSDAYN
           YL--H-DAYN
Sequence 2 YLKDHPDAYN



Alignment 92
Sequence 1:
Sequence 2: Allergen Mal d 1.0205, Sequence: AAD26558
Sequence identity: 56.25 (90/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGV---E-E-TS-IP--RLFKAF-LD-DNL-PK-APQAI---E--EG-GG
Sequence 2 MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-F-EG----YVK---D-VD--N--Y-Y--IEG----DT-EK-S
Sequence 2 PGTIKKITFGEGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-K-VA----GSI-K----YHTKGD-E-K-E-V-A-KE----L----ES
Sequence 2 YETKLVAS-GSGSIIKSISHYHTKGDVEIKEEHVMAGKEKAHGLFKLIES

Sequence 1 YLLAHSDAYN
           YL--H-DAYN
Sequence 2 YLKGHPDAYN



Alignment 93
Sequence 1:
Sequence 2: Allergen Mal d 1.0106, Sequence: AAD26554
Sequence identity: 56.25 (90/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGV---E-E-TS-IP--RLFKAF-LD-DNL-PK-APQAI---E--EGNGG
Sequence 2 MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-F-EG----YVK-R-D--D-----Y-Y--IEG----DT-E-IS
Sequence 2 PGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIENIS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-K-VA---G--I--IS--YHTKG--E-K-E-VKA-KE----L----ES
Sequence 2 YETKLVACGSGSTIKSISH-YHTKGNIEIKEEHVKAGKEKAHGLFKLIES

Sequence 1 YLLAHSDAYN
           YL--H-DAYN
Sequence 2 YLKDHPDAYN



Alignment 94
Sequence 1:
Sequence 2: Allergen Que a 1.0201, Sequence: ABZ81045
Sequence identity: 58.12 (93/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVF--E---TSVI--ARLFKA--LD-DNL--KV-PQAI-S-E-IEGNGG
Sequence 2 MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-F-E---FKY-K-R-D--D--N--Y--SVIEG-------E--S
Sequence 2 PGTIKKITFGEASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -EIK-VA-PDGGSI-K---KY-TKGD---K-EQ--A--E----LL-AVE-
Sequence 2 TEIKCVASPDGGSIMKSTTKYQTKGDFQLKEEQIQAAIEKAAGLLKAVEA

Sequence 1 YLLAHSDAYN
           YL-AH-D-Y-
Sequence 2 YLVAHPDLYK



Alignment 95
Sequence 1:
Sequence 2: Allergen Fra a 1, Sequence: Q256S2
Sequence identity: 53.75 (86/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGV--YE-E-TS-IPA--LFKAF-LD-DNL-PK-APQA----E--EG-GG
Sequence 2 MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-F-EG----YVK------D--N--Y-YS-IEG-------EKI-
Sequence 2 PGTIKKITFGEGSHYGYVKHKIHSIDKVNHTYSYSLIEGDALSENIEKID

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-K-V--P-GG-I-K---KYHTKGD-E-K-E-VKA-KE----L----E-
Sequence 2 YETKLVSAPHGGTIIKTTSKYHTKGDVEIKEEHVKAGKEKAAHLFKLIEG

Sequence 1 YLLAHSDAYN
           YL--H---YN
Sequence 2 YLKDHPSEYN



Alignment 96
Sequence 1:
Sequence 2: Allergen Que a 1.0401, Sequence: ABZ81047
Sequence identity: 56.88 (91/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVF--E---TSVI--ARLFKA--LD-DNL--KV-PQAI-S-E-IEGNGG
Sequence 2 MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-F-EG---K--K-R-D--D--NF-Y--SVIEG----D-LE--S
Sequence 2 PGTIKKITFGEGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-KIVA-PDGGSI-K---KY-TKGD-----E-----KE-------AVE-
Sequence 2 TETKIVASPDGGSIAKSTSKYQTKGDFQLTDELIRGGKEKASGVFKAVEA

Sequence 1 YLLAHSDAYN
           YL-AH-D-Y-
Sequence 2 YLVAHPDLYK



Alignment 97
Sequence 1:
Sequence 2: Allergen Mal d 1.0102, Sequence: CAA88833
Sequence identity: 55.62 (89/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGV---E-E-TS-IP--RLFKAF-LD-DNL-PK-APQAI---E--EGNGG
Sequence 2 MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-F-EG----YVK-R-D--D-----Y-Y--IEG----DT-EKIS
Sequence 2 PGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKIS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-K-VA---G--I--IS--YH-KG--E-K-E-VK--KE----L----ES
Sequence 2 YETKLVACGSGATIKSISH-YHPKGNIEIKEEHVKVGKEKGHGLFKLIES

Sequence 1 YLLAHSDAYN
           YL--H-DAYN
Sequence 2 YLKGHPDAYN



Alignment 98
Sequence 1:
Sequence 2: Allergen Fra a 1, Sequence: Q256S6
Sequence identity: 54.38 (87/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MG---YE-E-TS-IPA--LFKAF-LD-DNL-PK-APQAI---E--EG-GG
Sequence 2 MGGYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-F-EG----YVK------D--N--Y-YS-IEG----D--EKI-
Sequence 2 PGTIKKITFGEGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKID

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-K-V--P-GG-I-K---KYHTKGD-E-K-E-VKA-KE----L----E-
Sequence 2 YETKLVSAPHGGTIIKTTSKYHTKGDVEIKEEHVKAGKEKASHLFKLIEG

Sequence 1 YLLAHSDAYN
           YL--H---YN
Sequence 2 YLKDHPSEYN



Alignment 99
Sequence 1:
Sequence 2: Allergen Mal d 1.0208, Sequence: CAD32318
Sequence identity: 56.25 (90/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           -GV--YE-E-TS-IP--RLFKAF-LD-DNL-PK-APQAI---E--EG-GG
Sequence 2 -GVYTYENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-F-EG----YVK---D-VD--N--Y-Y--IEG----DT-EK-S
Sequence 2 PGTIKKITFGEGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-K-VA----GSI-K----YHTKGD-E---E-VKA-KE----L----ES
Sequence 2 YETKLVAS-GSGSIIKSISHYHTKGDVEIMEEHVKAGKEKAHGLFKLIES

Sequence 1 YLLAHSDAYN
           YL--H-DAYN
Sequence 2 YLKDHPDAYN



Alignment 100
Sequence 1:
Sequence 2: Allergen Mal d 1.0109, Sequence: AAK13029
Sequence identity: 56.25 (90/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGV---E-E-TS-IP--RLFKAF-LD-DNL-PK-APQAI---E--EGNGG
Sequence 2 MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-F-EG----YVK-R-D--D-----Y-Y--IEG----DT-EKIS
Sequence 2 PGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKIS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-K-VA---G--I--IS--YHTKG--E-K-E-VK--KE----L----ES
Sequence 2 YETKLVACGSGSTIKSISH-YHTKGNIEIKEEHVKVGKEKAHGLFKLIES

Sequence 1 YLLAHSDAYN
           YL--H-DAYN
Sequence 2 YLKDHPDAYN



Alignment 101
Sequence 1:
Sequence 2: Allergen Fra a 1, Sequence: Q256S4
Sequence identity: 53.75 (86/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGV--YE-E-TS-IPA--LFKAF-LD-DNL-PK-APQA----E--EG-GG
Sequence 2 MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-F-EG----YVK------D--N--Y-YS-IEG----D--EKI-
Sequence 2 PGTIKKITFGEGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKID

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-K-V--P-G--I-K---KYHTKGD-E-K-E-VKA-KE----L----E-
Sequence 2 YETKLVSAPHG-TIIKTTSKYHTKGDVEIKEEHVKAGKEKASHLFKLIEG

Sequence 1 YLLAHSDAYN
           YL--H---YN
Sequence 2 YLKDHPSEYN



Alignment 102
Sequence 1:
Sequence 2: Allergen Act c 8.0101, Sequence: CAM31908
Sequence identity: 49.38 (79/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGV--Y--E--S--P---L-KAFILDGD-L-PKV-P-AI--V---EG-G-
Sequence 2 MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGC

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           -GTIK---F-EG---K-VK-RVD--D--N--Y-Y--IEG-------E-IS
Sequence 2 AGTIKEVTFGEGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESIS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           --IKIVA-PDGGSI-K----Y-TKGD--V--E--K--KE-------A-E-
Sequence 2 YHIKIVACPDGGSICKNRSIYTTKGDCKVSEEEIKLGKEKAAEIFKALEA

Sequence 1 YLLAHSDAYN
           YLLA--D---
Sequence 2 YLLANPDYC-



Alignment 103
Sequence 1:
Sequence 2: Allergen Act d 8.0101, Sequence: CAM31909
Sequence identity: 49.38 (79/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MG---Y--E--S-I-A---FKAF-LDGD---PK--P-AI--V---EG-GG
Sequence 2 MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           -GTIK---F-EG---K-VK-R-D--D--NF-Y-YS-IEGG---D--E-IS
Sequence 2 VGTIKLTTFGEGSVHKSVKHRIDGLDKENFTYSYSIIEGGAL-DVFESIS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           --IKIVATPDGG-I-K----Y--K-D--V--E--KA-KE--------VE-
Sequence 2 YHIKIVATPDGGCICKNRSIYTPKCDAQVSEEEIKAGKERASGIFKKVEA

Sequence 1 YLLAHSDAYN
           YLLA--D---
Sequence 2 YLLANPDC--



Alignment 104
Sequence 1:
Sequence 2: Allergen Rub i 1.0101, Sequence: Q0Z8U9
Sequence identity: 47.50 (76/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           ----------TSVIP---LFKAF-LD-DNL-PK-APQA--SVE-IEG-GG
Sequence 2 ---------YTSVIPPPKLFKAFVLDADNLIPKIAPQAVKSVEIIEGDGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           -GT-KKI---EG----YVK---D--D--NF-Y-YS--EG---GD--EKIS
Sequence 2 VGTVKKIHLGEGTEHSYVKHKIDGLDKVNFVYSYSITEGDALGDKIEKIS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -EIK-VA---G-SI-K----YH-KG--E-K-EQVK--KE----L------
Sequence 2 YEIKLVASGRG-SIIKTTSHYHCKGGAEIKEEQVKDGKERAAGLFKI---

Sequence 1 YLLAHSDAYN
           ----------
Sequence 2 ----------



Alignment 105
Sequence 1:
Sequence 2: Allergen Gly m 4, Sequence: CAA42646
Sequence identity: 48.12 (77/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVF--E-E--S----A-L-KA---D-DN--PK-A-----SVEN-EGNGG
Sequence 2 MGVFTFEDEINSPVAPATLYKALVTDADNVIPK-ALDSFKSVENVEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKI-F-E----K-V-------D--N--Y-YSV--G----DT-EKI-
Sequence 2 PGTIKKITFLEDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKIT

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           ---K-VA-P-GGS--K---KY-TKGD-E------K--K-----L--A-E-
Sequence 2 FDSKLVAGPNGGSAGKLTVKYETKGDAEPNQDELKTGKAKADALFKAIEA

Sequence 1 YLLAHSDAYN
           YLLAH-D-YN
Sequence 2 YLLAHPD-YN



Alignment 106
Sequence 1:
Sequence 2: Allergen Pha v 1, Sequence: CAA43637
Sequence identity: 44.38 (71/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVF--E--TTS----A-L-KA---D-D--FPK--P----SVE--EGNGG
Sequence 2 MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKISF-E----K-V-------D--N--Y-YS---G-----T-EKI-
Sequence 2 PGTIKKISFVEDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKIT

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           ---K----P-GGS--K-S--YH-KGD--------KA-K-----L--AVE-
Sequence 2 FDSKLSDGPNGGSLIKLSITYHSKGDAPPNEDELKAGKAKSDSLFKAVEA

Sequence 1 YLLAHSDAYN
           YLLA------
Sequence 2 YLLANP----



Alignment 107
Sequence 1:
Sequence 2: Allergen Pha v 1, Sequence: CAA43636
Sequence identity: 44.38 (71/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           M-VF--E--TTS----A-L-KA---D-D---PK-A-----SVE--EGNGG
Sequence 2 MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKISF-E----K-V-----E-D--N--Y-YS---G----DT-EKIS
Sequence 2 PGTIKKISFVEDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKIS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           ---K----P-GGS--K-S-KYH-KGD--------KA-K-----L----E-
Sequence 2 IDSKLSDGPNGGSVVKLSIKYHSKGDAPPNEDELKAGKAKSDALFKVIEA

Sequence 1 YLLAHSDAYN
           YLLA------
Sequence 2 YLLANP----



Alignment 108
Sequence 1:
Sequence 2: Allergen Pha v 1, Sequence: P25985
Sequence identity: 43.75 (70/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           -GVF--E--TTS----A-L-KA---D-D--FPK--P----SVE--EGNGG
Sequence 2 -GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKISF-E----K-V-------D--N--Y-YS---G-----T-EKI-
Sequence 2 PGTIKKISFVEDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKIT

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           ---K----P-GGS--K-S--YH-KGD--------KA-K-----L--AVE-
Sequence 2 FDSKLSDGPNGGSLIKLSITYHSKGDAPPNEDELKAGKAKSDSLFKAVEA

Sequence 1 YLLAHSDAYN
           YLLA------
Sequence 2 YLLANP----



Alignment 109
Sequence 1:
Sequence 2: Allergen Sola l 4.0101, Sequence: AHC08073
Sequence identity: 44.38 (71/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGV--Y--E-T--I---RLFKA--LD-DNL-PK---Q-----E-IEG-GG
Sequence 2 MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           -G-IK---F-EG-P-KY-K------D--N----YS-IEG---G--LE-I-
Sequence 2 VGSIKQMNFVEGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESIT

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           --IK--A---GG---K----YHTKGDH-V--E------E-------AVE-
Sequence 2 YDIKFEANDNGGCVYKTTTEYHTKGDHVVSEEEHNVGRERIMNISKAVEA

Sequence 1 YLLAHSDAYN
           YLLA----Y-
Sequence 2 YLLANPSVYA



Alignment 110
Sequence 1:
Sequence 2: Allergen Ara h 8.0101, Sequence: AAQ91847
Sequence identity: 45.62 (73/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGVF--E-E-TS--P-A-L--A---D-D---PK-------SVE--EGNGG
Sequence 2 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKK----E----K-----V---D--N--YNYSV--G-----T-EKI-
Sequence 2 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-K-V--P-GGSI-K---KYHTKGD-----E--K--K---E-L-RA-E-
Sequence 2 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG

Sequence 1 YLLAHSDAYN
           Y-LA----Y-
Sequence 2 YVLANPTQY-



Alignment 111
Sequence 1:
Sequence 2: Allergen Sola l 4.0201, Sequence: NP_001275580
Sequence identity: 42.50 (68/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGV-----E-T--I---RLFK---LD-D-L-PK-------S-E--EG-GG
Sequence 2 MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           -G-IK---F-EG-P-KY-K------D--N----YS-IEG---GD-LE-I-
Sequence 2 AGSIKQMNFVEGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIA

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           ---K--A--DGG---K----YHTKGDH-V--E-----K-----L--A-E-
Sequence 2 YDVKFEAAGDGGCVCKTTTEYHTKGDHVVSEEEHNVGKGKAIDLFKAIEA

Sequence 1 YLLAHSDAYN
           YLLA----Y-
Sequence 2 YLLANPSVYA



Alignment 112
Sequence 1:
Sequence 2: Allergen Vig r 1.0101, Sequence: Q2VU97
Sequence identity: 43.12 (69/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           M-VF------TS----A-L--A---D-DN--PK-A-----SVE--EGNGG
Sequence 2 MAVFTFDDQATSPVAPATLYNALAKDADNIIPK-AVGSFQSVEIVEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGTIKKISF-E----K-V------VD--N--Y-YS---G----DT-EKI-
Sequence 2 PGTIKKISFVEDGETKFVLHKIESVDEANLGYSYSIVGGVALPDTAEKIT

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           ---KI----DGGS--K----YH-KGD--------KA-K-----L--AVE-
Sequence 2 IDTKISDGADGGSLIKLTISYHGKGDAPPNEDELKAGKAKSDALFKAVEA

Sequence 1 YLLAHSDAYN
           YLLA------
Sequence 2 YLLANP----



Alignment 113
Sequence 1:
Sequence 2: Allergen Ara h 8.0201, Sequence: EF436550
Sequence identity: 40.62 (65/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGV---E-E-TS--P-A-LFKA---DGD-L-PK--P-AI-S-E--EGNGG
Sequence 2 MGVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIP-AIQSIEIVEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGT-KK----E-----YV----D--D-----Y-Y----G------LEK-S
Sequence 2 PGTVKKVTAVEDGKTSYVLHKIDAIDEATYTYDYTISGGTGFQEILEKVS

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           ---K--A--DGGS--K-S---HTKGD-----E-----K--------A-E-
Sequence 2 FKTKLEAA-DGGSKIKVSVTFHTKGDAPLPDEVHQDVKQKSQGIFKAIEG

Sequence 1 YLLAHSDAYN
           Y-L-------
Sequence 2 YVLSN-----



Alignment 114
Sequence 1:
Sequence 2: Allergen Api g 1, Sequence: P49372
Sequence identity: 40.62 (65/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGV-----E-TS---A---F--F--D-D---PK-AP-A--SVE-I-G-GG
Sequence 2 MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           PGT-K-I--P-G-P------R-D-V--------YSVI-G-------E-I-
Sequence 2 PGTLKIITLPDGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIE

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           N----V-T-DGGSI-K-----HTKGD--V--E--K---E----L--A-E-
Sequence 2 NHVVLVPTADGGSICKTTAIFHTKGDAVVPEENIKYANEQNTALFKALEA

Sequence 1 YLLAHSDAYN
           YL-A------
Sequence 2 YLIAN-----



Alignment 115
Sequence 1:
Sequence 2: Allergen Lyc e 4.0101, Sequence: CAA75803
Sequence identity: 40.00 (64/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGV--Y--E-T--I---RLFKA--LD-DNL-PK---Q-----E-IEG-GG
Sequence 2 MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           -G-IK---F-EG-P-KY-K------D--N----YS-IEG---G--LE-I-
Sequence 2 VGSIKQMNFVEGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESIT

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           --IK--A---GG---K----YHTKGDH-V--E-----------------S
Sequence 2 YDIKFEANDNGGCVYKTTTEYHTKGDHVVSEEEHNVGRRENHEYFQGCRS

Sequence 1 YLLAHSDAYN------------------
           -----S----------------------
Sequence 2 IPSRESFCLRLNIDEKESGLHVRNYACT



Alignment 116
Sequence 1:
Sequence 2: Allergen Pet c PR10, Sequence: CAA67246
Sequence identity: 38.12 (61/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGV---E---TS--PAA-LFKA--LD-D-L-P-V-P-AI---E--EG-GG
Sequence 2 MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           -GT-K--------P-K--K---D--D---F---YS-I-G---------I-
Sequence 2 VGTVKLVTLGDASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSIN

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           N----V-T-DGG----------TKGD--V--E--K-----------AVE-
Sequence 2 NHLSFVPTADGGCTATSTAVFNTKGDAVVPEENIKFANDQNNLIFKAVEA

Sequence 1 YLLAHSDAYN
           YLLA------
Sequence 2 YLLAN-----



Alignment 117
Sequence 1:
Sequence 2: Allergen Api g 1.0201, Sequence: P92918
Sequence identity: 38.75 (62/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGV-----E--S---A------F-LD-D--FPKV-PQ-I-SVE--EG-GG
Sequence 2 MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           -GT-K-----E-------K--VD--D-----Y-Y--I-G----D-LE---
Sequence 2 VGTVKLVHLGEATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVV

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           NE---V-T-DGG-I-K----Y-TKGD--------K---E-------AVE-
Sequence 2 NEFVVVPT-DGGCIVKNTTIYNTKGDAVLPEDKIKEATEKSALAFKAVEA

Sequence 1 YLLAHSDAYN
           YLLA------
Sequence 2 YLLANLQFLA



Alignment 118
Sequence 1:
Sequence 2: Allergen Tar o RAP, Sequence: AAB92255
Sequence identity: 35.00 (56/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           ------E-E-TS-------FKAF--D-D---PK--P----S---IEG-GG
Sequence 2 --MAVAEFEITSSLSPSNIFKAFVIDFDTIAPKAEPETYKSIKTIEGDGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           -GTIK-I----G-PF---K--VD--D--NF---Y---EG-------E---
Sequence 2 VGTIKSITYSDGVPFTSSKHKVDAIDSNNFSISYTIFEGDVLMGIIESGT

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           ---K-----DGGS--K-S-----KGD-----E-V---KE-------A-E-
Sequence 2 HHLKFLPSADGGSVYKHSMVFKCKGDAKLTDENVSLMKEGLKKTFKAIET

Sequence 1 YLLAHSDAYN
           Y---H--A--
Sequence 2 YVISHPEAC-



Alignment 119
Sequence 1:
Sequence 2: Allergen Dau c 1.0201, Sequence: AAL76932
Sequence identity: 38.12 (61/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MGV---E-E--S---A------F-LD-D--FPKV-PQ-I-SVE--EG-GG
Sequence 2 MGVQKTEVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           -GT-------E-------K--VD--D-----Y-Y--I-G------LE---
Sequence 2 VGTVRLVHLGEATEYTTMKQKVDVIDKAGLGYTYTTIGGDILVEGLESVV

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           N----V-T-DGG-I-K----Y-TKGD-------VK---E-------AVE-
Sequence 2 NQFVVVPT-DGGCIVKNTTIYNTKGDAVLPEDKVKEATEKSALAFKAVEA

Sequence 1 YLLAHSDAYN
           YLLA------
Sequence 2 YLLAN-----



Alignment 120
Sequence 1:
Sequence 2: Allergen Dau c 1.0104, Sequence: CAB03716
Sequence identity: 36.88 (59/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MG------E-TS---A---F----LD-D---PK-AP-A--SV----G-GG
Sequence 2 MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           -GT---I--PEG-P------R-D-V------Y---VI-G-------E-I-
Sequence 2 AGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIE

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -----V-T-DGGSI-K-----HTKGD--V--E--K---E----L--A-E-
Sequence 2 THLVVVPTADGGSITKTTAIFHTKGDAVVPEENIKFADEQNTALFKAIEA

Sequence 1 YLLAHSDAYN
           YL-A------
Sequence 2 YLIAN-----



Alignment 121
Sequence 1:
Sequence 2: Allergen Dau c 1.0105, Sequence: CAB06416
Sequence identity: 36.88 (59/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MG------E-TS---A---F----LD-D---PK-AP-A--SVE---G-GG
Sequence 2 MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVE-VKGDGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           -GT---I--PEG-P------R-D-V------Y---VI-G-------E-I-
Sequence 2 AGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIE

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -----V-T-DGGSI-K-----HTKGD--V--E--K--------L--A-E-
Sequence 2 THLVVVPTADGGSITKTTAIFHTKGDAVVPEENIKFADAQNTALFKAIEA

Sequence 1 YLLAHSDAYN
           YL-A------
Sequence 2 YLIAN-----



Alignment 122
Sequence 1:
Sequence 2: Allergen Dau c 1.0102, Sequence: BAA13604
Sequence identity: 36.25 (58/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MG------E-TS---A---F----LD-D---PK-AP-A--SV----G-GG
Sequence 2 MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           -GT---I--PEG-P------R-D-V------Y---VI-G-------E-I-
Sequence 2 AGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIE

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -----V-T-DGGSI-K-----HTKGD--V--E--K--------L--A-E-
Sequence 2 THMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKFADAQNTALFKAIEA

Sequence 1 YLLAHSDAYN
           YL-A------
Sequence 2 YLIAN-----



Alignment 123
Sequence 1:
Sequence 2: Allergen Dau c 1.0101, Sequence: AAB01092
Sequence identity: 36.25 (58/160)
Sequence 1 --------------MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAP
           --------------MG------E-TS---A---F----LD-D---PK-AP
Sequence 2 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP

Sequence 1 QAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSV
           -A--SV----G-GG-GT---I--PEG-P------R-D-V------Y---V
Sequence 2 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV

Sequence 1 IEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKA
           I-G-------E-I------V-T-DGGSI-K-----HTKGD--V--E--K-
Sequence 2 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF

Sequence 1 SKEMRETLLRAVESYLLAHSDAYN
           -------L--A-E-YL-A------
Sequence 2 ADAQNTALFKAIEAYLIAN-----



Alignment 124
Sequence 1:
Sequence 2: Allergen Dau c 1.0103, Sequence: CAB03715
Sequence identity: 36.25 (58/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           MG------E-TS---A---F----LD-D---PK-A--A--SVE---G-GG
Sequence 2 MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           -GT---I--PEG-P------R-D-V------Y---VI-G-------E-I-
Sequence 2 AGTVRIITLPEGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIE

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -----V-T-DGGSI-K-----HTKGD--V--E--K--------L--A-E-
Sequence 2 THMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKFADAQNTALFKAIEA

Sequence 1 YLLAHSDAYN
           YL-A------
Sequence 2 YLIAN-----



Alignment 125
Sequence 1:
Sequence 2: Allergen Fra a 1.0101, Sequence: Q5ULZ4
Sequence identity: 33.12 (53/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           ---------------------AF-LD-DNL-PK-----------------
Sequence 2 ---------------------AFVLDADNLIPK-----------------

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           -----KI-F-EG----YVK------------------EG----DTLEKI-
Sequence 2 -----KITFGEGSQYGYVK-----------------VEGDALSDTLEKID

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           -E-K-V--P----I-K---KYHTKGD-E-K-E-VKA-KE----L----E-
Sequence 2 YETKLVSAPSSSTIIKTTSKYHTKGDVEIKEEHVKAGKEKAAHLFKLIEG

Sequence 1 YLLAHSDAYN
           YL--H---YN
Sequence 2 YLKDHPSEYN



Alignment 126
Sequence 1:
Sequence 2: Allergen Que a 1.0101, Sequence: P85126
Sequence identity: 21.25 (34/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           -GVF--E---TSVI--ARLFKA--LD-DNL--KV-PQAI-S-E-IEGNGG
Sequence 2 -GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGG

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           P-------------------------------------------------
Sequence 2 P-------------------------------------------------

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 YLLAHSDAYN
           ----------
Sequence 2 ----------



Alignment 127
Sequence 1:
Sequence 2: Allergen Vig r 6.0101, Sequence: Q9ZWP8
Sequence identity: 31.88 (51/160)
Sequence 1 -MGVFNYETETTSVIPA--ARLFKAFILDGDNLFPKVAPQAISSVENIEG
           ----FN--TE------A--A-L-K-FI-------PKV-P-----V--IEG
Sequence 2 MVKEFNTQTELSVRLEALWAVLSKDFI----TVVPKVLPHIVKDVQLIEG

Sequence 1 NGGPGTIKKISF-PEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTL
           -GG-GTI----F-PE--P--Y------E-D---------VIEGG-----L
Sequence 2 DGGVGTILIFNFLPEVSP-SYQREEITEFDESSHEIGLQVIEGGYLNQGL

Sequence 1 EKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETL--
           -------K----------------Y----D-E---E-V---K----TL--
Sequence 2 SYYKTTFKLSEIEEDKTLVNVKISYDHDSDIE---EKVTPTKTSQSTLMY

Sequence 1 LRAVESYLLAHSDAYN
           LR--E-YL---S----
Sequence 2 LRRLERYLSNGSA---



Alignment 128
Sequence 1:
Sequence 2: Allergen Cas s 1, Sequence: Q9S8Q4
Sequence identity: 10.62 (17/160)
Sequence 1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG
           -GVF--E---TSVIP-ARLFKAF-L-------------------------
Sequence 2 -GVFTHESQETSVIPPARLFKAFVL-------------------------

Sequence 1 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 YLLAHSDAYN
           ----------
Sequence 2 ----------


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.