The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Mal d 3

Sequence Q9M5X7

Full FASTA alignment

Sequence name:
Query sequence:
MASSAVTKLALVVALCMAVSVAHAITCGQVTSSLAPCIGYVRSGGAVPPA
CCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVN
VPYKISTSTNCATVK

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Mal d 3Q9M5X7Go!115149.42.3e-38
2Pyr c 3Q9M5X6Go!115135.73.0e-34
3Pru av 3Q9M5X8Go!117125.63.5e-31
4Rub i 3.0101Q0Z8V0Go!117115.83.1e-28
5Fra a 3.0202Q4PLT6Go!117114.19.8e-28
6Fra a 3.0101Q8VX12Go!117113.91.1e-27
7Pru ar 3P81651Go!91112.81.9e-27
8Fra a 3.0201Q4PLU0Go!117112.53.1e-27
9Fra a 3.0102Q4PLT9Go!117112.33.5e-27
10Pru d 3P82534Go!91109.12.5e-26
11Pru p 3CAB96876Go!91107.38.9e-26
12Pru p 3P81402Go!91106.51.5e-25
13Hev b 12AAL25839Go!116102.14.0e-24
14Lup an 3.0101XP_019446786Go!116101.27.6e-24
15Ara h 9.0101ABX56711Go!116100.41.3e-23
16Pha v 3.0101ADC80502Go!11599.52.4e-23
17Cor a 8AAK28533Go!11597.11.3e-22
18Pun g 1.0301A0A059ST23Go!12097.01.5e-22
19Pun g 1.0101A0A059STC4Go!12096.42.2e-22
20Pha v 3.0201ADC80503Go!11895.34.6e-22
21Mor n 3.0101P85894Go!9194.08.9e-22
22Pla or 3.0101ABY21307Go!11892.92.4e-21
23Pla a 3.0101CAL07989Go!11892.14.1e-21
24Can s 3.0101W0U0V5Go!9190.31.2e-20
25Pru du 3.0101ACN11576Go!12390.31.5e-20
26Ara h 17.0101A0A510A9S3Go!9388.34.8e-20
27Len c 3.0101A0AT29Go!11888.55.3e-20
28Pun g 1.0201A0A059SSZ0Go!12088.55.3e-20
29Zea m 14.0101P19656-1Go!12087.78.9e-20
30Ara h 9.0201ABX75045Go!9287.39.0e-20
31Zea m 14.0102P19656-2Go!12887.01.5e-19
32Api g 2ACV04796Go!11885.93.2e-19
33Pis s 3.0101A0A161AT60Go!12084.01.1e-18
34Lyc e 3AAB42069Go!11483.31.9e-18
35Sola l 3.0101P93224Go!11483.31.9e-18
36Tri tu 14.0101CAH69206Go!11582.72.8e-18
37Art si 3.0102ANC85027Go!11679.91.9e-17
38Art ar 3.0102ANC85020Go!11679.91.9e-17
39Art v 3.0202ACE07187Go!11679.91.9e-17
40Art gm 3.0102ANC85023Go!11778.74.6e-17
41Art gm 3.0101ANC85022Go!11778.74.6e-17
42Art v 3.0201EU564845Go!11476.61.9e-16
43Art si 3.0101ANC85026Go!11676.61.9e-16
44Art la 3.0101ANC85024Go!11676.61.9e-16
45Art ar 3.0101ANC85019Go!11676.61.9e-16
46Art an 3.0102ANC85018Go!11776.61.9e-16
47Art ca 3.0102QIN55516Go!11776.12.8e-16
48Hor v 1AAA32970Go!11775.73.6e-16
49Art v 3.0301EU564847Go!11775.15.3e-16
50Hor v 1CAA42832Go!13475.35.6e-16
51Sin a 3.0101ABU95411Go!9274.47.0e-16
52Art ca 3.0101ANC85021Go!11774.67.8e-16
53Art an 3.0101ANC85017Go!11774.67.8e-16
54Art la 3.0102ANC85025Go!11574.01.1e-15
55Hel a 3.0101P82007Go!11671.66.0e-15
56Sola l 7.0101NP_001316123Go!11571.18.8e-15
57Tri a 14.010119846220Go!9067.96.2e-14
58Amb a 6O04004Go!11847.41.2e-07
59Par j 2O04403Go!13343.91.6e-06
60Par j 2P55958Go!13342.44.4e-06
61Par j 1Q40905Go!13842.44.5e-06
62Par j 1P43217Go!13942.05.8e-06
63Par j 1O04404Go!17642.17.3e-06
64Par j 1.0103CAI94601Go!13941.39.7e-06
65Par j 1.0101CAA54587Go!13337.41.4e-04
66Art v 3.0101P0C088Go!3734.62.6e-04
67Cas s 810998016Go!3633.08.1e-04
68Vit v 1P80274Go!3731.91.8e-03

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Mal d 3, Sequence: Q9M5X7
Sequence identity: 100.00 (115/115)
Sequence 1 MASSAVTKLALVVALCMAVSVAHAITCGQVTSSLAPCIGYVRSGGAVPPA
           MASSAVTKLALVVALCMAVSVAHAITCGQVTSSLAPCIGYVRSGGAVPPA
Sequence 2 MASSAVTKLALVVALCMAVSVAHAITCGQVTSSLAPCIGYVRSGGAVPPA

Sequence 1 CCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVN
           CCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVN
Sequence 2 CCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVN

Sequence 1 VPYKISTSTNCATVK
           VPYKISTSTNCATVK
Sequence 2 VPYKISTSTNCATVK



Alignment 2
Sequence 1:
Sequence 2: Allergen Pyr c 3, Sequence: Q9M5X6
Sequence identity: 87.83 (101/115)
Sequence 1 MASSAVTKLALVVALCMAVSVAHAITCGQVTSSLAPCIGYVRSGGAVPPA
           MASSAV-KLALVVALCMAVSVAHAITC-QV---LAPCI-YVRSGGAVPPA
Sequence 2 MASSAVIKLALVVALCMAVSVAHAITCSQVSANLAPCINYVRSGGAVPPA

Sequence 1 CCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVN
           CCNGI-TINGLA-TT-DRQ-ACNCLKNLAGS-SGVNP-NA--LPGKCGVN
Sequence 2 CCNGIKTINGLAKTTPDRQAACNCLKNLAGSVSGVNPGNAESLPGKCGVN

Sequence 1 VPYKISTSTNCATVK
           VPYKISTSTNCATVK
Sequence 2 VPYKISTSTNCATVK



Alignment 3
Sequence 1:
Sequence 2: Allergen Pru av 3, Sequence: Q9M5X8
Sequence identity: 82.61 (95/115)
Sequence 1 MASSAVTKLALVVALCMAVSV--AHAITCGQVTSSLAPCIGYVRSGGAVP
           MA-SA-TKLALVVALCM-VSV--A-A-TCGQV-S-LAPCI-YVR-GGAVP
Sequence 2 MACSAMTKLALVVALCMVVSVPIAQALTCGQVSSNLAPCIAYVRGGGAVP

Sequence 1 PACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCG
           PACCNGIR-IN-LA-TTADRQTACNCLK-L--S--GVN-NNAA-LPGKCG
Sequence 2 PACCNGIRNINNLAKTTADRQTACNCLKQLSASVPGVNANNAAALPGKCG

Sequence 1 VNVPYKISTSTNCATVK
           VNVPYKIS-STNCATVK
Sequence 2 VNVPYKISPSTNCATVK



Alignment 4
Sequence 1:
Sequence 2: Allergen Rub i 3.0101, Sequence: Q0Z8V0
Sequence identity: 74.78 (86/115)
Sequence 1 MASSAVTKLALVVALCM--AVSVAHAITCGQVTSSLAPCIGYVRSGGAVP
           MA-SAV-KLALV--LC---AV-VA-AITCGQVT---APC--YV--GGAVP
Sequence 2 MACSAVMKLALVALLCIVVAVPVAQAITCGQVTQNVAPCFNYVKNGGAVP

Sequence 1 PACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCG
           -ACCNG-R--N--A-TTADRQ--CNCLKN-AGSI-G-NP--AAGLPGKCG
Sequence 2 AACCNGVRNLNSQAKTTADRQQTCNCLKNAAGSIPGLNPSLAAGLPGKCG

Sequence 1 VNVPYKISTSTNCATVK
           V-VPYKISTSTNCATVK
Sequence 2 VSVPYKISTSTNCATVK



Alignment 5
Sequence 1:
Sequence 2: Allergen Fra a 3.0202, Sequence: Q4PLT6
Sequence identity: 71.30 (82/115)
Sequence 1 MASSAVTKLALVVALCMAVS--VAHAITCGQVTSSLAPCIGYVRSGGAVP
           MA-S---KL-LV--LC--V----A-AITCGQV-SS--PC--YV-SGGAVP
Sequence 2 MAISTAMKLSLVALLCIVVALPIAQAITCGQVASSISPCVNYVKSGGAVP

Sequence 1 PACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCG
           -ACCNGIR--N--A-TTADRQT-CNCLK---G-I-G-NPN-AAGLPGKCG
Sequence 2 AACCNGIRSLNSAAKTTADRQTTCNCLKQASGAIKGLNPNLAAGLPGKCG

Sequence 1 VNVPYKISTSTNCATVK
           VNVPYKISTSTNCA-VK
Sequence 2 VNVPYKISTSTNCAAVK



Alignment 6
Sequence 1:
Sequence 2: Allergen Fra a 3.0101, Sequence: Q8VX12
Sequence identity: 70.43 (81/115)
Sequence 1 MASSAVTKLALVVALCMAVS--VAHAITCGQVTSSLAPCIGYVRSGGAVP
           MASS---KL-LV--LC--V----A-AITCGQV-S---PC--YV-SGGAVP
Sequence 2 MASSTAMKLSLVALLCIVVALPIAQAITCGQVASNISPCLTYVKSGGAVP

Sequence 1 PACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCG
           -ACC-GIR--NG-A-TTADRQ-ACNCLK--AG-I-G-NPN-AAGLPGKCG
Sequence 2 AACCSGIRNLNGMAKTTADRQAACNCLKQAAGGIKGLNPNLAAGLPGKCG

Sequence 1 VNVPYKISTSTNCATVK
           V-VPYKIST-TNCA-VK
Sequence 2 VSVPYKISTTTNCAAVK



Alignment 7
Sequence 1:
Sequence 2: Allergen Pru ar 3, Sequence: P81651
Sequence identity: 68.70 (79/115)
Sequence 1 MASSAVTKLALVVALCMAVSVAHAITCGQVTSSLAPCIGYVRSGGAVPPA
           ------------------------ITCGQV-SSLAPCIGYVR-GGAVPPA
Sequence 2 ------------------------ITCGQVSSSLAPCIGYVRGGGAVPPA

Sequence 1 CCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVN
           CCNGIR--N-LARTT-DR-TACNCLK-L-GSISGVNPNNAA-LPGKCGVN
Sequence 2 CCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAAALPGKCGVN

Sequence 1 VPYKISTSTNCATVK
           -PYKIS-STNCATVK
Sequence 2 IPYKISASTNCATVK



Alignment 8
Sequence 1:
Sequence 2: Allergen Fra a 3.0201, Sequence: Q4PLU0
Sequence identity: 69.57 (80/115)
Sequence 1 MASSAVTKLALVVALCMAVS--VAHAITCGQVTSSLAPCIGYVRSGGAVP
           MASS---KL-LV--LC--V----A-AITCGQV-SS--PC--YV-SGGAVP
Sequence 2 MASSTAMKLSLVALLCIVVALPIAQAITCGQVASSISPCVNYVKSGGAVP

Sequence 1 PACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCG
           -ACCNGIR--N--A-TTADRQ--CNCLK---G-I-G-NP--AAGLPGKCG
Sequence 2 AACCNGIRSLNSAAKTTADRQATCNCLKQASGAIKGLNPSLAAGLPGKCG

Sequence 1 VNVPYKISTSTNCATVK
           V-VPYKISTSTNCA-VK
Sequence 2 VSVPYKISTSTNCAAVK



Alignment 9
Sequence 1:
Sequence 2: Allergen Fra a 3.0102, Sequence: Q4PLT9
Sequence identity: 68.70 (79/115)
Sequence 1 MASSAVTKLALVVALCMAVS--VAHAITCGQVTSSLAPCIGYVRSGGAVP
           MASS---KL-LV--LC--V----A-AITCGQV-S---PC--YV-SGGAVP
Sequence 2 MASSTAMKLSLVALLCIVVALPIAQAITCGQVASNISPCVTYVKSGGAVP

Sequence 1 PACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCG
           --CC-GIR--NG-A-TTADRQ--CNCLK--AG-I-G-NPN-AAGLPGKCG
Sequence 2 APCCSGIRNLNGMAKTTADRQATCNCLKQAAGGIKGLNPNLAAGLPGKCG

Sequence 1 VNVPYKISTSTNCATVK
           V-VPYKIST-TNCA-VK
Sequence 2 VSVPYKISTTTNCAAVK



Alignment 10
Sequence 1:
Sequence 2: Allergen Pru d 3, Sequence: P82534
Sequence identity: 66.09 (76/115)
Sequence 1 MASSAVTKLALVVALCMAVSVAHAITCGQVTSSLAPCIGYVRSGGAVPPA
           ------------------------ITCGQV-S-LAPCI-YV--GGAVPPA
Sequence 2 ------------------------ITCGQVSSNLAPCINYVKGGGAVPPA

Sequence 1 CCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVN
           CCNGIR--N-LARTTADR--ACNCLK-L-GSI-GVNPNNAA-LPGKCGVN
Sequence 2 CCNGIRNVNNLARTTADRRAACNCLKQLSGSIPGVNPNNAAALPGKCGVN

Sequence 1 VPYKISTSTNCATVK
           VPYKIS-STNCATVK
Sequence 2 VPYKISASTNCATVK



Alignment 11
Sequence 1:
Sequence 2: Allergen Pru p 3, Sequence: CAB96876
Sequence identity: 64.35 (74/115)
Sequence 1 MASSAVTKLALVVALCMAVSVAHAITCGQVTSSLAPCIGYVRSGGAVPPA
           ------------------------ITCGQV-SSLAPCI-YVR-GGAVPPA
Sequence 2 ------------------------ITCGQVSSSLAPCIPYVRGGGAVPPA

Sequence 1 CCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVN
           CCNGIR--N-LARTT-DRQ-ACNCLK-L--S--GVNPNNAA-LPGKCGV-
Sequence 2 CCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCGVS

Sequence 1 VPYKISTSTNCATVK
           -PYKIS-STNCATVK
Sequence 2 IPYKISASTNCATVK



Alignment 12
Sequence 1:
Sequence 2: Allergen Pru p 3, Sequence: P81402
Sequence identity: 63.48 (73/115)
Sequence 1 MASSAVTKLALVVALCMAVSVAHAITCGQVTSSLAPCIGYVRSGGAVPPA
           ------------------------ITCGQV-S-LAPCI-YVR-GGAVPPA
Sequence 2 ------------------------ITCGQVSSALAPCIPYVRGGGAVPPA

Sequence 1 CCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVN
           CCNGIR--N-LARTT-DRQ-ACNCLK-L--S--GVNPNNAA-LPGKCGV-
Sequence 2 CCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCGVH

Sequence 1 VPYKISTSTNCATVK
           -PYKIS-STNCATVK
Sequence 2 IPYKISASTNCATVK



Alignment 13
Sequence 1:
Sequence 2: Allergen Hev b 12, Sequence: AAL25839
Sequence identity: 62.61 (72/115)
Sequence 1 MASSAVTKLALVVALCMAVSV---AHAITCGQVTSSLAPCIGYVRSGGAV
           ----A--K------LCM-V-----A-AITCGQV-S-L-PC--Y----G--
Sequence 2 ---MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPT

Sequence 1 PPA-CCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGK
           PPA-CCNG-RTIN--A-TTADR-TAC-CLK--AGS--G-NP---AGLPGK
Sequence 2 PPATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGK

Sequence 1 CGVNVPYKISTSTNCATVK
           CGVN-PYKIS-STNCATVK
Sequence 2 CGVNIPYKISLSTNCATVK



Alignment 14
Sequence 1:
Sequence 2: Allergen Lup an 3.0101, Sequence: XP_019446786
Sequence identity: 62.61 (72/115)
Sequence 1 MASSAVTKLALVVALCMAVSVA---HAITCGQVTSSLAPCIGYVRSGGAV
           -------KLA--V--CM-V--A----AITCGQVT--LA-C--Y-RSGGAV
Sequence 2 --MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAV

Sequence 1 PPACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKC
           P--CCNGI--I--LA-TT-DR-TACNCLK--A----G-NP-NA--LPGKC
Sequence 2 PAPCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKC

Sequence 1 GVNVPYKISTSTNCATVK
           GVN-PYKISTSTNCA--K
Sequence 2 GVNIPYKISTSTNCASIK



Alignment 15
Sequence 1:
Sequence 2: Allergen Ara h 9.0101, Sequence: ABX56711
Sequence identity: 60.87 (70/115)
Sequence 1 MASSAVTKLALVVALCMAV---SVAHAITCGQVTSSLAPCIGYVRSGGAV
           ----A--K-A-V---CMA--------AI-CGQV-S-LAPCI-----GGA-
Sequence 2 ---MASLKFAFVMLVCMAMVGAPMVNAISCGQVNSALAPCIPFLTKGGAP

Sequence 1 PPACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKC
           PPACC-G-R---G--RTTADRQ-ACNCLK--AGS--G-N--NAA-LPG-C
Sequence 2 PPACCSGVRGLLGALRTTADRQAACNCLKAAAGSLRGLNQGNAAALPGRC

Sequence 1 GVNVPYKISTSTNCATVK-
           GV--PYKISTSTNCAT-K-
Sequence 2 GVSIPYKISTSTNCATIKF



Alignment 16
Sequence 1:
Sequence 2: Allergen Pha v 3.0101, Sequence: ADC80502
Sequence identity: 59.13 (68/115)
Sequence 1 MASSAVTKLALVVALCMAVSVAHA---ITCGQVTSSLAPCIGYVRSGGAV
           ----A--K-A-VV-LCM-V--AH-----TCGQV-S-L-PC------GG-V
Sequence 2 ---MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFV

Sequence 1 PPACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKC
           P--CCNG-R-I---AR-TADR---CNCLK--AG---G-NPNNA--LPGKC
Sequence 2 PAGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKC

Sequence 1 GVNVPYKISTSTNCATVK
           GVN-PYKISTSTNCA---
Sequence 2 GVNIPYKISTSTNCASIN



Alignment 17
Sequence 1:
Sequence 2: Allergen Cor a 8, Sequence: AAK28533
Sequence identity: 57.39 (66/115)
Sequence 1 MASSAVTKLALVVALCMAVS--VAHA-ITCGQVTSSLAPCIGYVRSGGAV
           -------KL---V-LCM-V---VA-A--TC-Q----L-PC--Y---GG--
Sequence 2 ---MGSLKLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVL

Sequence 1 PPACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKC
           PP-CC-G-R--N---RTT-DRQ-ACNCLK--A--I-G-NPN-AAGLPGKC
Sequence 2 PPSCCKGVRAVNDASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKC

Sequence 1 GVNVPYKISTSTNCATVK
           GVN-PYKIS-STNC--VK
Sequence 2 GVNIPYKISPSTNCNNVK



Alignment 18
Sequence 1:
Sequence 2: Allergen Pun g 1.0301, Sequence: A0A059ST23
Sequence identity: 66.09 (76/115)
Sequence 1 MASSAVTKLALVVALCMAV--SVAHA-ITCGQVTSSLAPCIGYVRSGGA-
           MASS----LA--V--CMAV---VA-A-ITCGQV-SSLA-CI-Y-R--GA-
Sequence 2 MASSGFLRLAGFVLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAG

Sequence 1 -VPPACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPG
           -VP-ACCNGIR--N--A-TT-DRQ-AC-CLK-LA-SISG-N----AG-PG
Sequence 2 PVPQACCNGIRSLNSAAKTTPDRQAACRCLKSLASSISGINYGLVAGAPG

Sequence 1 KCGVNVPYKISTSTNCATVK
           KCGV--PYKI--STNC--VK
Sequence 2 KCGVSIPYKIAPSTNCDNVK



Alignment 19
Sequence 1:
Sequence 2: Allergen Pun g 1.0101, Sequence: A0A059STC4
Sequence identity: 63.48 (73/115)
Sequence 1 MASSAVTKLA---LVVALCMA-VSVAHAITCGQVTSSLAPCIGYVRS-GG
           M--S---KLA-----VAL--A------A-TCGQV-SSLAPCI-Y-RS-GG
Sequence 2 MTGSGLFKLACAVFAVALVAAPIATEAAVTCGQVASSLAPCIPYARSAGG

Sequence 1 AVPPACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPG
           AVPPACC-GI-T--G-ARTT-DRQ--C-CLK----SISG-N----A-LP-
Sequence 2 AVPPACCSGIKTLDGMARTTPDRQATCKCLKSASTSISGINYGLVASLPA

Sequence 1 KCGVNVPYKISTSTNCATVK
           KCGVN-PYKIS-ST-CA-VK
Sequence 2 KCGVNIPYKISPSTDCARVK



Alignment 20
Sequence 1:
Sequence 2: Allergen Pha v 3.0201, Sequence: ADC80503
Sequence identity: 61.74 (71/115)
Sequence 1 MASSAVTKLALVVA-LCMAV---SVAHA-ITCGQVTSSLAPCIGYVRSGG
           ----A----A-VVA-LC--V-----AHA-I-CGQVTSSLA-CI-----GG
Sequence 2 ---MATLNSACVVAVLCLVVLTAPTAHAAISCGQVTSSLASCIPFLTKGG

Sequence 1 AVPPACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPG
           -VP--CC-G-R--N--A-TT-DRQ--CNCLK--AG-I-G-N-NNA--LPG
Sequence 2 PVPASCCSGVRSLNAAAKTTPDRQAVCNCLKSAAGAIPGFNANNAGILPG

Sequence 1 KCGVNVPYKISTSTNCATVK-
           KCGV--PYKISTSTNCAT-K-
Sequence 2 KCGVSIPYKISTSTNCATIKF



Alignment 21
Sequence 1:
Sequence 2: Allergen Mor n 3.0101, Sequence: P85894
Sequence identity: 55.65 (64/115)
Sequence 1 MASSAVTKLALVVALCMAVSVAHAITCGQVTSSLAPCIGYVRSGGAVPPA
           ------------------------ITCGQV-SSLAPCI-Y-R-GG-VP--
Sequence 2 ------------------------ITCGQVSSSLAPCINYLRAGGVVPAN

Sequence 1 CCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVN
           CCNG-R--N--A-TTADRQ-ACNCLK----SI-G-N-N-AAGLPGKCGV-
Sequence 2 CCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCGVS

Sequence 1 VPYKISTSTNCATVK
           VPYKIS-ST-C--VK
Sequence 2 VPYKISPSTDCKSVK



Alignment 22
Sequence 1:
Sequence 2: Allergen Pla or 3.0101, Sequence: ABY21307
Sequence identity: 57.39 (66/115)
Sequence 1 MASSAVTKLALVVALCMAVSVAHA---ITCGQVTSSLAPCIGYVRSGGAV
           MA-S-V-KLA-----CM-----HA---ITCG-V---L-PC--Y-RSGGAV
Sequence 2 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAV

Sequence 1 PPACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKC
           -PACCNG----N--A-TT-DRQ-AC-CLK----SISG----NAA-L-GKC
Sequence 2 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC

Sequence 1 GVNVPYKISTSTNCATVK
           GVN-PYKIS----C--VK
Sequence 2 GVNLPYKISPTIDCSKVK



Alignment 23
Sequence 1:
Sequence 2: Allergen Pla a 3.0101, Sequence: CAL07989
Sequence identity: 56.52 (65/115)
Sequence 1 MASSAVTKLALVVALCMAVSVAHA---ITCGQVTSSLAPCIGYVRSGGAV
           MA-S-V-KLA-----CM-----HA---ITCG-V---L-PC----RSGGAV
Sequence 2 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV

Sequence 1 PPACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKC
           -PACCNG----N--A-TT-DRQ-AC-CLK----SISG----NAA-L-GKC
Sequence 2 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC

Sequence 1 GVNVPYKISTSTNCATVK
           GVN-PYKIS----C--VK
Sequence 2 GVNLPYKISPTIDCSKVK



Alignment 24
Sequence 1:
Sequence 2: Allergen Can s 3.0101, Sequence: W0U0V5
Sequence identity: 52.17 (60/115)
Sequence 1 MASSAVTKLALVVALCMAVSVAHAITCGQVTSSLAPCIGYVRSGGAVPPA
           ------------------------ITCGQV-SSLAPC--Y---GGAVP--
Sequence 2 ------------------------ITCGQVASSLAPCLSYLKVGGAVPDG

Sequence 1 CCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVN
           CCN-I----G-A-T-ADRQ-AC-CLK--A-SI-GVN-N-A-GLPGKCGV-
Sequence 2 CCNDIKSLSGAAKTPADRQAACKCLKSAASSIKGVNFNLASGLPGKCGVS

Sequence 1 VPYKISTSTNCATVK
           -PYKIS-ST-C--VK
Sequence 2 IPYKISPSTDCSSVK



Alignment 25
Sequence 1:
Sequence 2: Allergen Pru du 3.0101, Sequence: ACN11576
Sequence identity: 59.13 (68/115)
Sequence 1 MASSA-VTKLALVVAL--CMAVS---VAHAITCGQVTSSLAPCIGYVRSG
           MASS----KL---VA---CMAV-------A--CGQV---L-PCI-YV--G
Sequence 2 MASSGQLLKLVCLVAVMCCMAVGGPKAMAAVSCGQVVNNLTPCINYVANG

Sequence 1 GAVPPACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNN--AAG
           GA--P-CC-G-R----LA-TTADRQ--CNCLK-----I---N-N---AAG
Sequence 2 GALNPSCCTGVRSLYSLAQTTADRQSICNCLKQAVNGIPYTNANAGLAAG

Sequence 1 LPGKCGVNVPYKISTSTNCATVK
           LPGKCGVN-PYKIS-ST-C-T-K
Sequence 2 LPGKCGVNIPYKISPSTDCKTIK



Alignment 26
Sequence 1:
Sequence 2: Allergen Ara h 17.0101, Sequence: A0A510A9S3
Sequence identity: 51.30 (59/115)
Sequence 1 MASSAVTKLALVVALCMAVSVAHAITCGQVTSSLAPCIGYVRSGGAVPPA
           -----------------------AI-C--VT-S-APC-GY--SGG-V---
Sequence 2 -----------------------AIQCSFVTKSIAPCFGYLKSGGTVSGP

Sequence 1 CCNGIRTINGLARTTADRQTACNCLKNLAGSI-SGVNPNNAAGLPGKCGV
           CC-GI--ING-A-TT-DRQ--CNCLK--A-S--S--NPNNAA-LPGKCGV
Sequence 2 CCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLPGKCGV

Sequence 1 NVPYKISTSTNCATVK
           --PYKISTS-NC---K
Sequence 2 SIPYKISTSINCSSIK



Alignment 27
Sequence 1:
Sequence 2: Allergen Len c 3.0101, Sequence: A0AT29
Sequence identity: 56.52 (65/115)
Sequence 1 MASSAVTKLALVV-ALCMAVSVAHA---ITCGQVTSSLAPCIGYVRSGGA
           -------KLA-VV---CM-V----A---I-CG-VTS-L-PC--Y---G--
Sequence 2 --MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPG

Sequence 1 VPPACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGK
           --P-CC-G-------A-TT-DRQ-ACNCLK--AGSI---N-NNAA-LPGK
Sequence 2 PSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGK

Sequence 1 CGVNVPYKISTSTNCATVK-
           CGVN-PYKIST-TNC-TVK-
Sequence 2 CGVNIPYKISTTTNCNTVKF



Alignment 28
Sequence 1:
Sequence 2: Allergen Pun g 1.0201, Sequence: A0A059SSZ0
Sequence identity: 58.26 (67/115)
Sequence 1 MASSA-VTKLALVVALCMAVS---VAHAITCGQVTSSLAPCIGYVRSGGA
           MAS------L-----LCM-V----V--A-TCGQVTSSL-PCI-Y-R---A
Sequence 2 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA

Sequence 1 VPPA-CCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPG
           -P-A-CC-G-R--N--A-TT-DRQTACNCLK--A-SI-G-N------LPG
Sequence 2 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG

Sequence 1 KCGVNVPYKISTSTNCATVK
           KCGV--PYKIS-ST-C--VK
Sequence 2 KCGVSIPYKISPSTDCSRVK



Alignment 29
Sequence 1:
Sequence 2: Allergen Zea m 14.0101, Sequence: P19656-1
Sequence identity: 53.04 (61/115)
Sequence 1 ---MASSAVTKLALVVALCMAVSVAHA-ITCGQVTSSLAPCIGYVRSGGA
           -------AV---A-V-----A-----A-I-CGQV-S--APCI-Y-R--G-
Sequence 2 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS

Sequence 1 VPPA-CCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPG
           -P-A-CC-G-R--N--ARTTADR--ACNCLKN-A---SG-N--NAA--P-
Sequence 2 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS

Sequence 1 KCGVNVPYKISTSTNCATVK
           KCGV--PY-ISTST-C--V-
Sequence 2 KCGVSIPYTISTSTDCSRVN



Alignment 30
Sequence 1:
Sequence 2: Allergen Ara h 9.0201, Sequence: ABX75045
Sequence identity: 49.57 (57/115)
Sequence 1 MASSAVTKLALVVALCMAVSVAHAITCGQVTSSLAPCIGYVRSGGAVPPA
           --------------------------CGQV-S-LAPCI-----GG-----
Sequence 2 ------------------------LSCGQVNSALAPCITFLTKGGVPSGP

Sequence 1 CCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVN
           CC-G-R---G-A-TTADRQ-ACNCLK--AGS--G-N--NAA-LPG-CGV-
Sequence 2 CCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHGLNQGNAAALPGRCGVS

Sequence 1 VPYKISTSTNCATVK-
           -PYKISTSTNCAT-K-
Sequence 2 IPYKISTSTNCATIKF



Alignment 31
Sequence 1:
Sequence 2: Allergen Zea m 14.0102, Sequence: P19656-2
Sequence identity: 52.17 (60/115)
Sequence 1 ---MASSAVTKLALVVALCMAVSVAHA-ITCGQVTSSLAPCIGYVRSGGA
           -------AV---A-V-----A-----A-I-CGQV-S--APCI-Y-R--G-
Sequence 2 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS

Sequence 1 VPPA-CCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPG
           -P-A-CC-G-R--N--ARTTADR--ACNCLKN-A---SG-N--NAA--P-
Sequence 2 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS

Sequence 1 KCGVNVPYKISTSTNCATVK--------
           KCGV--PY-ISTST-C------------
Sequence 2 KCGVSIPYTISTSTDCSRYSRRMHASAD



Alignment 32
Sequence 1:
Sequence 2: Allergen Api g 2, Sequence: ACV04796
Sequence identity: 50.43 (58/115)
Sequence 1 MASSAVTKLALVVA-LCMAVSVAH-----AITCGQVTSSLAPCIGYVRSG
           -----V-K-A--VA---M-V---H-------TCGQVT--L--C-GY---G
Sequence 2 ---MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGG

Sequence 1 GAVPPACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLP
           G---PACC-G----N-LA-T-ADR--AC-CLK-LAGS--G-N---A--LP
Sequence 2 GYPSPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALP

Sequence 1 GKCGVNVPYKISTSTNCATVK
           GKCG---PY-IS-ST-C--V-
Sequence 2 GKCGIRIPYPISPSTDCSRVN



Alignment 33
Sequence 1:
Sequence 2: Allergen Pis s 3.0101, Sequence: A0A161AT60
Sequence identity: 52.17 (60/115)
Sequence 1 MASSA-VTKLALVVALCMAVSVAHA-ITCGQVTSSLAPCIGYVRS--GGA
           MA-S------ALV---------A-A---CG-V----APC--Y--------
Sequence 2 MARSMKLACVALVICMVVIAPMAEAALSCGTVSADMAPCVTYLQAPNNAS

Sequence 1 VPPACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGK
           -PP-CC-G-------A-TT-DRQ-ACNCLK--AGSI---N-NNAA-LPGK
Sequence 2 PPPPCCAGVKKLLAAATTTPDRQAACNCLKSAAGSIPKLNTNNAAALPGK

Sequence 1 CGVNVPYKISTSTNCATVK-
           CGV--PYKISTSTNC-TV--
Sequence 2 CGVSIPYKISTSTNCNTVRF



Alignment 34
Sequence 1:
Sequence 2: Allergen Lyc e 3, Sequence: AAB42069
Sequence identity: 49.57 (57/115)
Sequence 1 MASSAVTKLALVVALCMAVSVAHA--ITCGQVTSSLAPCIGYVRSGGAVP
           -------K-A--V--CM-V---HA----CG-VTS-LAPC--Y----G---
Sequence 2 --MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPLG

Sequence 1 PACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCG
           --CC-G-----G-A-T--DR-TAC-CLK--A-SI-G-----AAGLPG-CG
Sequence 2 -GCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCG

Sequence 1 VNVPYKISTSTNCATVK
           VN-PYKIS-ST-C-TV-
Sequence 2 VNIPYKISPSTDCSTVQ



Alignment 35
Sequence 1:
Sequence 2: Allergen Sola l 3.0101, Sequence: P93224
Sequence identity: 49.57 (57/115)
Sequence 1 MASSAVTKLALVVALCMAVSVAHA--ITCGQVTSSLAPCIGYVRSGGAVP
           -------K-A--V--CM-V---HA----CG-VTS-LAPC--Y----G---
Sequence 2 --MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPLG

Sequence 1 PACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCG
           --CC-G-----G-A-T--DR-TAC-CLK--A-SI-G-----AAGLPG-CG
Sequence 2 -GCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCG

Sequence 1 VNVPYKISTSTNCATVK
           VN-PYKIS-ST-C-TV-
Sequence 2 VNIPYKISPSTDCSTVQ



Alignment 36
Sequence 1:
Sequence 2: Allergen Tri tu 14.0101, Sequence: CAH69206
Sequence identity: 51.30 (59/115)
Sequence 1 MASSAVTKL---ALVVALCMAVSVAHAITCGQVTSSLAPCIGYVRSGGAV
           MA-SAV------A-V-A---AV--A-A--CGQV-S-L-PCI-Y-R--GA-
Sequence 2 MARSAVAQVVLVAVVAAMLLAVTEA-AVSCGQVSSALSPCISYARGNGAS

Sequence 1 PPA-CCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGK
           P-A-CC-G-R-----AR-TAD-Q-AC-C-K--A----G-N---AAG-P-K
Sequence 2 PSAACCSGVRSLASSARSTADKQAACKCIKSAA---AGLNAGKAAGIPTK

Sequence 1 CGVNVPYKISTSTNCATVK
           CGV-VPY-IS-S--C----
Sequence 2 CGVSVPYAISSSVDCSKIR



Alignment 37
Sequence 1:
Sequence 2: Allergen Art si 3.0102, Sequence: ANC85027
Sequence identity: 45.22 (52/115)
Sequence 1 -MASSAVTKLALVVALCMAVSVAHAITCGQVTSSLAPCIGYVRSGGAVPP
           ----------A-VV------S-A-A-TC--V-----PC--Y---GG-VP-
Sequence 2 MAMKMMKFFCAMVVCMVLSSSYAEALTCSDVSNKITPCLNYLKQGGEVPA

Sequence 1 ACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGV
           -CC-G----N--A-TT-DRQTACNCLK----S--------AA-LP-KCGV
Sequence 2 DCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKCGV

Sequence 1 NVPYKISTSTNCATVK
           N-PYKIS--T-C--VK
Sequence 2 NIPYKISLETDCNKVK



Alignment 38
Sequence 1:
Sequence 2: Allergen Art ar 3.0102, Sequence: ANC85020
Sequence identity: 45.22 (52/115)
Sequence 1 -MASSAVTKLALVVALCMAVSVAHAITCGQVTSSLAPCIGYVRSGGAVPP
           ----------A-VV------S-A-A-TC--V-----PC--Y---GG-VP-
Sequence 2 MAMKMMKFFCAMVVCMVLSSSYAEALTCSDVSNKITPCLNYLKQGGEVPA

Sequence 1 ACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGV
           -CC-G----N--A-TT-DRQTACNCLK----S--------AA-LP-KCGV
Sequence 2 DCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKCGV

Sequence 1 NVPYKISTSTNCATVK
           N-PYKIS--T-C--VK
Sequence 2 NIPYKISLETDCNKVK



Alignment 39
Sequence 1:
Sequence 2: Allergen Art v 3.0202, Sequence: ACE07187
Sequence identity: 45.22 (52/115)
Sequence 1 -MASSAVTKLALVVALCMAVSVAHAITCGQVTSSLAPCIGYVRSGGAVPP
           ----------A-VV------S-A-A-TC--V-----PC--Y---GG-VP-
Sequence 2 MAMKMMKFFCAMVVCMVLSSSYAEALTCSDVSNKITPCLNYLKQGGEVPA

Sequence 1 ACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGV
           -CC-G----N--A-TT-DRQTACNCLK----S--------AA-LP-KCGV
Sequence 2 DCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKCGV

Sequence 1 NVPYKISTSTNCATVK
           N-PYKIS--T-C--VK
Sequence 2 NIPYKISLETDCNKVK



Alignment 40
Sequence 1:
Sequence 2: Allergen Art gm 3.0102, Sequence: ANC85023
Sequence identity: 45.22 (52/115)
Sequence 1 MASSAVTKLALVVALCMAVSVAHA---ITCGQVTSSLAPCIGYVRSGGAV
           -------K---V---CM-VS---A----TC--V-----PC------GG-V
Sequence 2 -MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKISPCLSFLKQGGEV

Sequence 1 PPACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKC
           P--CC-G----N--A-TT-DRQTACNCLK----S-------NA--LP-KC
Sequence 2 PADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDNAVVLPSKC

Sequence 1 GVNVPYKISTSTNCATVK
           GVN-PYKIS--T-C--VK
Sequence 2 GVNIPYKISLETDCNKVK



Alignment 41
Sequence 1:
Sequence 2: Allergen Art gm 3.0101, Sequence: ANC85022
Sequence identity: 46.09 (53/115)
Sequence 1 MASSAVTKLALVVALCMAVSVAHA---ITCGQVTSSLAPCIGYVRSGGAV
           -------K---V---CM-VS---A----TC--V-----PC------GG-V
Sequence 2 -MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKISPCTSFLKQGGEV

Sequence 1 PPACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKC
           P--CC-G----N--A-TT-DRQTACNCLK----S-------NAA-LP-KC
Sequence 2 PADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDFKSDNAAVLPSKC

Sequence 1 GVNVPYKISTSTNCATVK
           GVN-PYKIS--T-C--VK
Sequence 2 GVNIPYKISLETDCNKVK



Alignment 42
Sequence 1:
Sequence 2: Allergen Art v 3.0201, Sequence: EU564845
Sequence identity: 43.48 (50/115)
Sequence 1 MASSAVTKLALVVALCMAVSVAHAITCGQVTSSLAPCIGYVRSGGAVPPA
           ---------A-VV------S-A-A--C--V------C--Y---GG-VP--
Sequence 2 -MKMMKFFCAMVVCMVVSSSYAEALKCSDVSNKISACLSYLKQGGEVPAD

Sequence 1 CCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVN
           CC-G----N--A-TT-DRQTACNCLK----S--------AA-LP-KCGVN
Sequence 2 CCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKCGVN

Sequence 1 VPYKISTSTNCATVK
           -PYKIS--T-C--VK
Sequence 2 IPYKISLETDCNKVK



Alignment 43
Sequence 1:
Sequence 2: Allergen Art si 3.0101, Sequence: ANC85026
Sequence identity: 43.48 (50/115)
Sequence 1 MASSAVTKLALVVALCMAVS--VAHAITCGQVTSSLAPCIGYVRSGGAVP
           -------K---V---CM-VS---A-A-TC--V-----PC--Y---GG-VP
Sequence 2 -MAMKMMKVFCVMVVCMVVSSSYAEALTCSDVSNKISPCLNYLKQGGEVP

Sequence 1 PACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCG
           --CC-G----N--A-TT-DRQTAC-CLKN------------A--LP-KCG
Sequence 2 ANCCAGVKGLNDAAKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCG

Sequence 1 VNVPYKISTSTNCATVK
           V--PYK-S--T-C--VK
Sequence 2 VTIPYKLSMETDCNKVK



Alignment 44
Sequence 1:
Sequence 2: Allergen Art la 3.0101, Sequence: ANC85024
Sequence identity: 43.48 (50/115)
Sequence 1 -MASSAVTKLALVVALCMAVSVAHAITCGQVTSSLAPCIGYVRSGGAVPP
           ----------A-VV------S-A-A--C--V------C--Y---GG-VP-
Sequence 2 MAMKMMKFFCAMVVCMVVSSSYAEALKCSDVSNKISACLSYLKQGGEVPA

Sequence 1 ACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGV
           -CC-G----N--A-TT-DRQTACNCLK----S--------AA-LP-KCGV
Sequence 2 DCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKCGV

Sequence 1 NVPYKISTSTNCATVK
           N-PYKIS--T-C--VK
Sequence 2 NIPYKISLETDCNKVK



Alignment 45
Sequence 1:
Sequence 2: Allergen Art ar 3.0101, Sequence: ANC85019
Sequence identity: 43.48 (50/115)
Sequence 1 -MASSAVTKLALVVALCMAVSVAHAITCGQVTSSLAPCIGYVRSGGAVPP
           ----------A-VV------S-A-A--C--V------C--Y---GG-VP-
Sequence 2 MAMKMMKFFCAMVVCMVVSSSYAEALKCSDVSNKISACLSYLKQGGEVPA

Sequence 1 ACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGV
           -CC-G----N--A-TT-DRQTACNCLK----S--------AA-LP-KCGV
Sequence 2 DCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKCGV

Sequence 1 NVPYKISTSTNCATVK
           N-PYKIS--T-C--VK
Sequence 2 NIPYKISLETDCNKVK



Alignment 46
Sequence 1:
Sequence 2: Allergen Art an 3.0102, Sequence: ANC85018
Sequence identity: 45.22 (52/115)
Sequence 1 MASSAVTKLALVVALCMAVSVAHA---ITCGQVTSSLAPCIGYVRSGGAV
           -------K---V---CM-V----A----TC--VT----PC------GG-V
Sequence 2 -MAMKMMKVFCVMVVCMVVTSSYAEAALTCNDVTKKISPCTSFLEKGGEV

Sequence 1 PPACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKC
           P--CC-G----N--A-TT-DRQ-ACNCLK----S-------NAA-LP-KC
Sequence 2 PVDCCTGVKGLNDAAKTTPDRQAACNCLKTSFKSSNNFKEENAAVLPSKC

Sequence 1 GVNVPYKISTSTNCATVK
           GVN-PYKIS--T-C--VK
Sequence 2 GVNIPYKISLETDCNKVK



Alignment 47
Sequence 1:
Sequence 2: Allergen Art ca 3.0102, Sequence: QIN55516
Sequence identity: 45.22 (52/115)
Sequence 1 MASSAVTKLALVVALCMAV--SVAHA-ITCGQVTSSLAPCIGYVRSGGAV
           -------K---V---CM-V--S-A-A--TC--V-----PC------GG-V
Sequence 2 -MAMKMMKVFCVMIVCMVVLSSYAEAALTCSDVSNKITPCLSFLKQGGEV

Sequence 1 PPACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKC
           P--CC-G----N--A-T--DRQ-ACNCLK----S-------NA--LP-KC
Sequence 2 PADCCTGVKGLNDAAKTGPDRQKACNCLKTTFKSNKDLKSDNAVVLPSKC

Sequence 1 GVNVPYKISTSTNCATVK
           GVN-PYKIS--T-C-TVK
Sequence 2 GVNIPYKISLETDCNTVK



Alignment 48
Sequence 1:
Sequence 2: Allergen Hor v 1, Sequence: AAA32970
Sequence identity: 46.09 (53/115)
Sequence 1 MASSAVTKLA--LVVALCMAVSVAHAITCGQVTSSLAPCIGYVRSGGAVP
           MA---V---A--LV--L--A---A-A--CGQV-S---PC--YV--G----
Sequence 2 MARAQVLLMAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYVQGGPGPS

Sequence 1 PACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCG
           --CCNG-R-----A----DRQT-CNCLK--A--I---N-NNAA--P-KC-
Sequence 2 GECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCN

Sequence 1 VNVPYKISTSTNCATVK
           VNVPY-IS----C----
Sequence 2 VNVPYTISPDIDCSRIY



Alignment 49
Sequence 1:
Sequence 2: Allergen Art v 3.0301, Sequence: EU564847
Sequence identity: 41.74 (48/115)
Sequence 1 MASSAVTKLALVVALCMAVSVAHA---ITCGQVTSSLAPCIGYVRSGGAV
           -------K-------CM-VS---A----TC--V-----PC--Y---GG-V
Sequence 2 -MAIKMMKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEV

Sequence 1 PPACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKC
           P--CC-G----N----TT-DRQTACNCLK----S--------A--LP-KC
Sequence 2 PADCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKC

Sequence 1 GVNVPYKISTSTNCATVK
           G-N-PYK-S--T-C--VK
Sequence 2 GLNLPYKLSLETDCNKVK



Alignment 50
Sequence 1:
Sequence 2: Allergen Hor v 1, Sequence: CAA42832
Sequence identity: 46.09 (53/115)
Sequence 1 MASSAVTKLA--LVVALCMAVSVAHAITCGQVTSSLAPCIGYVRSGGAVP
           MA---V---A--LV--L--A---A-A--CGQV-S---PC--YV--G----
Sequence 2 MARAQVLLMAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYVQGGPGPS

Sequence 1 PACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCG
           --CCNG-R-----A----DRQT-CNCLK--A--I---N-NNAA--P-KC-
Sequence 2 GECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCN

Sequence 1 VNVPYKISTSTNCATVK-----------------
           VNVPY-IS----C---------------------
Sequence 2 VNVPYTISPDIDCSRFTERRSVKLVLSSSIHVEL



Alignment 51
Sequence 1:
Sequence 2: Allergen Sin a 3.0101, Sequence: ABU95411
Sequence identity: 41.74 (48/115)
Sequence 1 MASSAVTKLALVVALCMAVSVAHAITCGQVTSSLAPCIGYVRSGGAVPPA
           -----------------------A--CG-V-S-LA-CIGY-------P--
Sequence 2 -----------------------ALSCGTVNSNLAACIGYLTQNAPLPKG

Sequence 1 CCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVN
           CC-G----N--ARTT-DRQ-AC-CL---A-S----N---AA-LP--CGVN
Sequence 2 CCTGVTNLNNMARTTPDRQQACRCLVGAANSFPSLNAARAAALPKACGVN

Sequence 1 VPYKISTSTNCATVK
           -PYKIS-STNC--V-
Sequence 2 IPYKISKSTNCNSVR



Alignment 52
Sequence 1:
Sequence 2: Allergen Art ca 3.0101, Sequence: ANC85021
Sequence identity: 43.48 (50/115)
Sequence 1 MASSAVTKLALVVALCMAVSVAHA---ITCGQVTSSLAPCIGYVRSGGAV
           -------K---V---CM-VS---A----TC--V-----PC------GG-V
Sequence 2 -MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKILPCTSFLKQGGEV

Sequence 1 PPACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKC
           ---CC-G----N--A-TT-DRQ-ACNCLK----S-------NA--LP-KC
Sequence 2 SADCCTGVKGLNDAAKTTPDRQAACNCLKTTFKSNKDFKSDNAVVLPSKC

Sequence 1 GVNVPYKISTSTNCATVK
           GVN-PYKIS--T-C--VK
Sequence 2 GVNIPYKISLETDCNKVK



Alignment 53
Sequence 1:
Sequence 2: Allergen Art an 3.0101, Sequence: ANC85017
Sequence identity: 43.48 (50/115)
Sequence 1 MASSAVTKLALVVALCMAVSVAHA---ITCGQVTSSLAPCIGYVRSGGAV
           -------K---V---CM-VS---A----TC--V-----PC------GG-V
Sequence 2 -MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKILPCTSFLKQGGEV

Sequence 1 PPACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKC
           ---CC-G----N--A-TT-DRQ-ACNCLK----S-------NA--LP-KC
Sequence 2 SADCCTGVKGLNDAAKTTPDRQAACNCLKTTFKSNKDFKSDNAVVLPSKC

Sequence 1 GVNVPYKISTSTNCATVK
           GVN-PYKIS--T-C--VK
Sequence 2 GVNIPYKISLETDCNKVK



Alignment 54
Sequence 1:
Sequence 2: Allergen Art la 3.0102, Sequence: ANC85025
Sequence identity: 41.74 (48/115)
Sequence 1 MASSAVTKLALVVALCMAVSVAHA---ITCGQVTSSLAPCIGYVRSGGAV
           -------K---V---CM-V----A----TC--V-----PC--Y---GG-V
Sequence 2 ---MKMMKVFCVMVVCMVVKSSYAEAALTCSDVSTKISPCLSYLKKGGEV

Sequence 1 PPACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKC
           P--CC-G----N----TT-DRQTACNCLK----S--------A--LP-KC
Sequence 2 PADCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKC

Sequence 1 GVNVPYKISTSTNCATVK
           G-N-PYK-S--T-C--VK
Sequence 2 GLNLPYKLSLETDCNKVK



Alignment 55
Sequence 1:
Sequence 2: Allergen Hel a 3.0101, Sequence: P82007
Sequence identity: 43.48 (50/115)
Sequence 1 --MASSAVTKLALVVALCMAVSVAHAITCGQVTSSLAPCIGYVRSGGAVP
           ----S--V--LA--V-----V----AITC--VT--L-PC--Y-RSGG---
Sequence 2 MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKPT

Sequence 1 PACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCG
           PACC-G-----G--RT-ADR-TAC-C-K--A-----V-P--A--LPGKCG
Sequence 2 PACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPGKCG

Sequence 1 VNVPYKISTSTNCATVK
           ------I----NC-T--
Sequence 2 ISTSIPINPNVNCNTIP



Alignment 56
Sequence 1:
Sequence 2: Allergen Sola l 7.0101, Sequence: NP_001316123
Sequence identity: 39.13 (45/115)
Sequence 1 MASSAVTKLALVVALCMAVSVAHAITCGQVTSSLAPCIGYVRSGGAVPPA
           M---A---L--------A-----AITCGQV---LAPC------GG----A
Sequence 2 MKAIAILVLVVLAVFQLAMVARGAITCGQVDANLAPCVPFLTQGGEPGAA

Sequence 1 CCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVN
           CC-G-RT-NG------DR-TACNC-K--A----------A--LP-KCG--
Sequence 2 CCSGVRTLNGNTQSSDDRRTACNCVKAAANRYPNLKDDAAQSLPSKCGIS

Sequence 1 VPYKISTSTNCATVK
           ----IS---NC-T--
Sequence 2 LTVPISRTVNCDTIS



Alignment 57
Sequence 1:
Sequence 2: Allergen Tri a 14.0101, Sequence: 19846220
Sequence identity: 35.65 (41/115)
Sequence 1 MASSAVTKLALVVALCMAVSVAHAITCGQVTSSLAPCIGYVRSGGAVPPA
           ------------------------I-CG-V-S---PC--YV--G------
Sequence 2 ------------------------IDCGHVDSLVRPCLSYVQGGPGPSGQ

Sequence 1 CCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVN
           CC-G-------AR---DRQ-ACNCLK--A--I---N--NA---P-KCGVN
Sequence 2 CCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCGVN

Sequence 1 VPYKISTSTNCATVK
           -PY-IS----C--V-
Sequence 2 LPYTISLNIDCSRV-



Alignment 58
Sequence 1:
Sequence 2: Allergen Amb a 6, Sequence: O04004
Sequence identity: 29.57 (34/115)
Sequence 1 ---MASSAVTKLALVVALCMAVSVAHAITCGQVTSSLAPCIGYVRSGGAV
           -------------L----------A---TC--V---LAPC-G----G---
Sequence 2 MDCIRILWSVAVGLLLVSWRPTMFAASPTCDTVQNILAPCAGFL-TGQEP

Sequence 1 PPACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKC
           --ACC-G----N----T-ADR---CNC-K-L--SI----P-----L--KC
Sequence 2 SKACCTGVNNLNNSRKTKADRVAVCNCIKELTKSIA-YDPKRMPLLSTKC

Sequence 1 GVNVPYK-ISTSTNCATVK-
           GV------------C-----
Sequence 2 GVKPDFPAVDKNLDCSKLPV



Alignment 59
Sequence 1:
Sequence 2: Allergen Par j 2, Sequence: O04403
Sequence identity: 23.48 (27/115)
Sequence 1 --------MASSAVTKLALVVALCMAVSVAHAITCGQVTSSLAPCIGYVR
           ------------A--------A------------CG-V-----PC---V-
Sequence 2 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK

Sequence 1 SGGAVPP-ACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAA
           -----P---CC-G---------TT-----AC-C-------ISG------A
Sequence 2 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA

Sequence 1 GLPGKCGVNVPYK-ISTSTNCATVK--------
           --P-KCG-------I-----C------------
Sequence 2 EVPKKCGITTTLPPITADFDCSKIESTIFRGYY



Alignment 60
Sequence 1:
Sequence 2: Allergen Par j 2, Sequence: P55958
Sequence identity: 22.61 (26/115)
Sequence 1 --------MASSAVTKLALVVALCMAVSVAHAITCGQVTSSLAPCIGYVR
           ------------A--------A------------CG-V-----PC---V-
Sequence 2 MRTVSMAALVVIAAALAWTSSAEPAPAPAPGEEACGKVVQDIMPCLHFVK

Sequence 1 SGGAVPPA-CCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAA
           -----P---CC-G---------TT-----AC-C-------ISG------A
Sequence 2 GEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVA

Sequence 1 GLPGKCGVNVPYK-ISTSTNCATVK--------
           --P-KC--------I-----C------------
Sequence 2 EVPKKCDIKTTLPPITADFDCSKIQSTIFRGYY



Alignment 61
Sequence 1:
Sequence 2: Allergen Par j 1, Sequence: Q40905
Sequence identity: 30.43 (35/115)
Sequence 1 ----MASSAVTKLALVVALCM---AVSVAHAI------TCGQVTSSLAPC
           -----A-S-V-----V-A--------SVA-A-------TCG-V---L-PC
Sequence 2 MRTVSARSSVALVVIVAAVLVWTSSASVAPAPAPGSEETCGTVVGALMPC

Sequence 1 IGYVRSGGAVPP-ACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVN
           ---V------P---CC-G-----G---T---R--AC-C--------S---
Sequence 2 LPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDID

Sequence 1 PNNAAGLPGKCGV---NVPYKISTSTNCATVK-------
           -------P--CG------P--I-----C-T---------
Sequence 2 GKLVSEVPKHCGIVDSKLP-PIDVNMDCKTLGVLHYKGN



Alignment 62
Sequence 1:
Sequence 2: Allergen Par j 1, Sequence: P43217
Sequence identity: 22.61 (26/115)
Sequence 1 MASSAVTKLALVVALCMAVSVAHAITCGQVTSSLAPCIGYVRSGGAVPP-
           -------------------------TCG-----L-PC---V------P--
Sequence 2 -----------------------QETCGTMVRALMPCLPFVQGKEKEPSK

Sequence 1 ACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGV
           -CC-G-----G---T---R--AC-C--------S----------P--CG-
Sequence 2 GCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGI

Sequence 1 ---NVPYKISTSTNCATVK-------------------------------
           -----P--I-----C-TV--------------------------------
Sequence 2 VDSKLP-PIDVNMDCKTVGVVPRQPQLPVSLRHGPVTGPSDPAHKARLER

Sequence 1 -------------
           -------------
Sequence 2 PQIRVPPPAPEKA



Alignment 63
Sequence 1:
Sequence 2: Allergen Par j 1, Sequence: O04404
Sequence identity: 24.35 (28/115)
Sequence 1 --------------MASSAVTKLALVVALCMAVSVAHAITCGQVTSSLAP
           ------------------------L------A-------TCG-V---L-P
Sequence 2 MRTVSAPSAVALVVIVAAGLAWTSLASVAPPAPAPGSEETCGTVVRALMP

Sequence 1 CIGYVRSGGAVPP-ACCNGIRTINGLARTTADRQTACNCLKNLAGSISGV
           C---V------P---CC-G-----G---T---R--AC-C--------S--
Sequence 2 CLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSDI

Sequence 1 NPNNAAGLPGKCGV---NVPYKISTSTNCATVK-----------------
           --------P--CG------P--I-----C-T-------------------
Sequence 2 DGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTLGVVPRQPQLPVSLRHGPV

Sequence 1 ---------------------------
           ---------------------------
Sequence 2 TGPSDPAHKARLERPQIRVPPPAPEKA



Alignment 64
Sequence 1:
Sequence 2: Allergen Par j 1.0103, Sequence: CAI94601
Sequence identity: 21.74 (25/115)
Sequence 1 MASSAVTKLALVVALCMAVSVAHAITCGQVTSSLAPCIGYVRSGGAVPP-
           -------------------------TCG-----L-PC---V------P--
Sequence 2 -----------------------QETCGTMVRALMPCLPFVQGKEKEPSK

Sequence 1 ACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGV
           -CC-G-----G---T---R--AC-C--------S----------P--CG-
Sequence 2 GCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGI

Sequence 1 ---NVPYKISTSTNCATVK-------------------------------
           -----P--I-----C-T---------------------------------
Sequence 2 VDSKLP-PIDVNMDCKTLGVVPRQPQLPVSLRHGPVTGPSDPAHKARLER

Sequence 1 -------------
           -------------
Sequence 2 PQIRVPPPAPEKA



Alignment 65
Sequence 1:
Sequence 2: Allergen Par j 1.0101, Sequence: CAA54587
Sequence identity: 20.00 (23/115)
Sequence 1 MASSAVTKLALVVALCMAVSVAHAITCGQVTSSLAPCIGYVRSGGAVPP-
           ---------------------------------L-PC---V------P--
Sequence 2 -----------------------------MVRALMPCLPFVQGKEKEPSK

Sequence 1 ACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGV
           -CC-G-----G---T---R--AC-C--------S----------P--CG-
Sequence 2 GCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGI

Sequence 1 ---NVPYKISTSTNCATVK-------------------------------
           -----P--I-----C-TV--------------------------------
Sequence 2 VDSKLP-PIDVNMDCKTVGVVPRQPQLPVSLRHGPVTGPSDPAHKARLER

Sequence 1 -------------
           -------------
Sequence 2 PQIRVPPPAPEKA



Alignment 66
Sequence 1:
Sequence 2: Allergen Art v 3.0101, Sequence: P0C088
Sequence identity: 13.04 (15/115)
Sequence 1 MASSAVTKLALVVALCMAVSVAHAITCGQVTSSLAPCIGYVRSGGAVPPA
           -----------------------A-TC--V-----PC--Y---GG-VP--
Sequence 2 -----------------------ALTCSDVSNKISPCLSYLKQGGEVPAD

Sequence 1 CCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVN
           CC-G----N-----------------------------------------
Sequence 2 CCAGVKGLND----------------------------------------

Sequence 1 VPYKISTSTNCATVK
           ---------------
Sequence 2 ---------------



Alignment 67
Sequence 1:
Sequence 2: Allergen Cas s 8, Sequence: 10998016
Sequence identity: 14.78 (17/115)
Sequence 1 MASSAVTKLALVVALCMAVSVAHAITCGQVTSSLAPCIGYVRSGGAVPP-
           ------------------------ITC-QV--SL-PC--Y--S-G--PP-
Sequence 2 -----------------------SITCTQVSKSLMPCLTYLKSNGGSPPP

Sequence 1 -ACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCG
           --CC-G--------------------------------------------
Sequence 2 GTCCQGVKL-----------------------------------------

Sequence 1 VNVPYKISTSTNCATVK
           -----------------
Sequence 2 -----------------



Alignment 68
Sequence 1:
Sequence 2: Allergen Vit v 1, Sequence: P80274
Sequence identity: 14.78 (17/115)
Sequence 1 MASSAVTKLALVVALCMAVSVAHAITCGQVTSSLAPCIGYVRSGGAVPP-
           -------------------------TCGQV-S-L-PCI-Y----GAVP--
Sequence 2 -----------------------TVTCGQVASALSPCIDYLQKDGAVPAG

Sequence 1 ACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGV
           -CC-----------------------------------------------
Sequence 2 SCCXKXLSSA----------------------------------------

Sequence 1 NVPYKISTSTNCATVK
           ----------------
Sequence 2 ----------------


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.