The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Hev b 12

Sequence 20135538

Full FASTA alignment

Sequence name:
Query sequence:
MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTPPA
TCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKCGV
NIPYKISLSTNCATVK

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Hev b 12AAL25839Go!116149.72.0e-38
2Fra a 3.0202Q4PLT6Go!117103.71.4e-24
3Pha v 3.0101ADC80502Go!115102.04.2e-24
4Fra a 3.0201Q4PLU0Go!117102.04.2e-24
5Mal d 3Q9M5X7Go!115101.56.2e-24
6Rub i 3.0101Q0Z8V0Go!117101.09.1e-24
7Fra a 3.0101Q8VX12Go!117100.41.3e-23
8Pru av 3Q9M5X8Go!11799.13.2e-23
9Fra a 3.0102Q4PLT9Go!11798.64.7e-23
10Cor a 8AAK28533Go!11598.06.9e-23
11Ara h 9.0101ABX56711Go!11695.44.1e-22
12Pyr c 3Q9M5X6Go!11594.96.0e-22
13Lup an 3.0101XP_019446786Go!11694.21.0e-21
14Pru d 3P82534Go!9192.52.5e-21
15Pru ar 3P81651Go!9192.32.9e-21
16Len c 3.0101A0AT29Go!11892.43.6e-21
17Pun g 1.0201A0A059SSZ0Go!12090.71.1e-20
18Pun g 1.0301A0A059ST23Go!12090.71.1e-20
19Pha v 3.0201ADC80503Go!11890.31.4e-20
20Mor n 3.0101P85894Go!9188.83.2e-20
21Pru p 3P81402Go!9188.34.7e-20
22Sola l 3.0101P93224Go!11488.55.1e-20
23Lyc e 3AAB42069Go!11488.55.1e-20
24Pis s 3.0101A0A161AT60Go!12088.35.8e-20
25Pru p 3CAB96876Go!9187.57.8e-20
26Zea m 14.0101P19656-1Go!12086.91.6e-19
27Zea m 14.0102P19656-2Go!12886.22.7e-19
28Pun g 1.0101A0A059STC4Go!12085.44.5e-19
29Can s 3.0101W0U0V5Go!9184.66.0e-19
30Pla or 3.0101ABY21307Go!11884.86.5e-19
31Ara h 9.0201ABX75045Go!9284.27.7e-19
32Pla a 3.0101CAL07989Go!11884.11.1e-18
33Art si 3.0102ANC85027Go!11682.43.4e-18
34Art ar 3.0102ANC85020Go!11682.43.4e-18
35Art v 3.0202ACE07187Go!11682.43.4e-18
36Art gm 3.0102ANC85023Go!11781.75.6e-18
37Art gm 3.0101ANC85022Go!11780.81.1e-17
38Art ca 3.0102QIN55516Go!11779.92.0e-17
39Art la 3.0101ANC85024Go!11679.52.6e-17
40Art ar 3.0101ANC85019Go!11679.52.6e-17
41Art la 3.0102ANC85025Go!11579.32.9e-17
42Pru du 3.0101ACN11576Go!12379.43.0e-17
43Art v 3.0301EU564847Go!11779.03.8e-17
44Tri tu 14.0101CAH69206Go!11578.84.2e-17
45Art v 3.0201EU564845Go!11478.64.8e-17
46Api g 2ACV04796Go!11878.26.3e-17
47Art si 3.0101ANC85026Go!11678.07.1e-17
48Art an 3.0101ANC85017Go!11777.31.2e-16
49Art ca 3.0101ANC85021Go!11777.31.2e-16
50Hor v 1AAA32970Go!11777.01.5e-16
51Art an 3.0102ANC85018Go!11776.81.7e-16
52Hor v 1CAA42832Go!13476.52.3e-16
53Ara h 17.0101A0A510A9S3Go!9373.11.8e-15
54Sin a 3.0101ABU95411Go!9270.98.2e-15
55Sola l 7.0101NP_001316123Go!11570.21.7e-14
56Tri a 14.010119846220Go!9067.96.2e-14
57Hel a 3.0101P82007Go!11665.25.1e-13
58Par j 2O04403Go!13352.44.4e-09
59Par j 2P55958Go!13350.31.8e-08
60Amb a 6O04004Go!11849.72.5e-08
61Par j 1Q40905Go!13848.28.2e-08
62Par j 1O04404Go!17648.11.1e-07
63Par j 1P43217Go!13946.52.6e-07
64Par j 1.0103CAI94601Go!13945.84.3e-07
65Par j 1.0101CAA54587Go!13342.54.2e-06
66Cas s 810998016Go!3635.91.1e-04
67Art v 3.0101P0C088Go!3732.89.5e-04
68Vit v 1P80274Go!3732.41.2e-03
69Jug r 8.0101XP_018816661Go!9631.36.7e-03

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Hev b 12, Sequence: AAL25839
Sequence identity: 100.00 (116/116)
Sequence 1 MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTPPA
           MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTPPA
Sequence 2 MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTPPA

Sequence 1 TCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKCGV
           TCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKCGV
Sequence 2 TCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKCGV

Sequence 1 NIPYKISLSTNCATVK
           NIPYKISLSTNCATVK
Sequence 2 NIPYKISLSTNCATVK



Alignment 2
Sequence 1:
Sequence 2: Allergen Fra a 3.0202, Sequence: Q4PLT6
Sequence identity: 62.07 (72/116)
Sequence 1 ---MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPT
           -----A-K------LC--VA-P--AQAITCGQV-S---PC--Y-K--G--
Sequence 2 MAISTAMKLSLVALLCIVVALPI-AQAITCGQVASSISPCVNYVKSGGAV

Sequence 1 PPATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGK
           P-A-CCNG-R--N-AAKTTADR-T-C-CLK-A-G--KGLNP---AGLPGK
Sequence 2 P-AACCNGIRSLNSAAKTTADRQTTCNCLKQASGAIKGLNPNLAAGLPGK

Sequence 1 CGVNIPYKISLSTNCATVK
           CGVN-PYKIS-STNCA-VK
Sequence 2 CGVNVPYKISTSTNCAAVK



Alignment 3
Sequence 1:
Sequence 2: Allergen Pha v 3.0101, Sequence: ADC80502
Sequence identity: 61.21 (71/116)
Sequence 1 MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTPPA
           MA--K-----VLCM-V----TAQ--TCGQVQS-LVPC---L---G--P-A
Sequence 2 MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVP-A

Sequence 1 TCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKCGV
           -CCNGVR-I-N-A--TADRR--C-CLK-AAG-V-GLNP-----LPGKCGV
Sequence 2 GCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGV

Sequence 1 NIPYKISLSTNCATVK
           NIPYKIS-STNCA---
Sequence 2 NIPYKISTSTNCASIN



Alignment 4
Sequence 1:
Sequence 2: Allergen Fra a 3.0201, Sequence: Q4PLU0
Sequence identity: 60.34 (70/116)
Sequence 1 ---MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPT
           -----A-K------LC--VA-P--AQAITCGQV-S---PC--Y-K--G--
Sequence 2 MASSTAMKLSLVALLCIVVALPI-AQAITCGQVASSISPCVNYVKSGGAV

Sequence 1 PPATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGK
           P-A-CCNG-R--N-AAKTTADR---C-CLK-A-G--KGLNP---AGLPGK
Sequence 2 P-AACCNGIRSLNSAAKTTADRQATCNCLKQASGAIKGLNPSLAAGLPGK

Sequence 1 CGVNIPYKISLSTNCATVK
           CGV--PYKIS-STNCA-VK
Sequence 2 CGVSVPYKISTSTNCAAVK



Alignment 5
Sequence 1:
Sequence 2: Allergen Mal d 3, Sequence: Q9M5X7
Sequence identity: 62.07 (72/116)
Sequence 1 ---MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPT
           ----A--K------LCM-V-----A-AITCGQV-S-L-PC--Y----G--
Sequence 2 MASSAVTKLALVVALCMAVSV---AHAITCGQVTSSLAPCIGYVRSGGAV

Sequence 1 PPATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGK
           PPA-CCNG-RTIN--A-TTADR-TAC-CLK--AGS--G-NP---AGLPGK
Sequence 2 PPA-CCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGK

Sequence 1 CGVNIPYKISLSTNCATVK
           CGVN-PYKIS-STNCATVK
Sequence 2 CGVNVPYKISTSTNCATVK



Alignment 6
Sequence 1:
Sequence 2: Allergen Rub i 3.0101, Sequence: Q0Z8V0
Sequence identity: 61.21 (71/116)
Sequence 1 ---MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPT
           ----A--K------LC--VA-P--AQAITCGQV-----PC--Y-K--G--
Sequence 2 MACSAVMKLALVALLCIVVAVPV-AQAITCGQVTQNVAPCFNYVKNGGAV

Sequence 1 PPATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGK
           P-A-CCNGVR--N--AKTTADR---C-CLK-AAGS--GLNP---AGLPGK
Sequence 2 P-AACCNGVRNLNSQAKTTADRQQTCNCLKNAAGSIPGLNPSLAAGLPGK

Sequence 1 CGVNIPYKISLSTNCATVK
           CGV--PYKIS-STNCATVK
Sequence 2 CGVSVPYKISTSTNCATVK



Alignment 7
Sequence 1:
Sequence 2: Allergen Fra a 3.0101, Sequence: Q8VX12
Sequence identity: 60.34 (70/116)
Sequence 1 ---MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPT
           -----A-K------LC--VA-P--AQAITCGQV-S---PCL-Y-K--G--
Sequence 2 MASSTAMKLSLVALLCIVVALPI-AQAITCGQVASNISPCLTYVKSGGAV

Sequence 1 PPATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGK
           P-A-CC-G-R--N--AKTTADR--AC-CLK-AAG--KGLNP---AGLPGK
Sequence 2 P-AACCSGIRNLNGMAKTTADRQAACNCLKQAAGGIKGLNPNLAAGLPGK

Sequence 1 CGVNIPYKISLSTNCATVK
           CGV--PYKIS--TNCA-VK
Sequence 2 CGVSVPYKISTTTNCAAVK



Alignment 8
Sequence 1:
Sequence 2: Allergen Pru av 3, Sequence: Q9M5X8
Sequence identity: 61.21 (71/116)
Sequence 1 ---MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPT
           ----A--K------LCM-V--P--AQA-TCGQV-S-L-PC--Y----G--
Sequence 2 MACSAMTKLALVVALCMVVSVPI-AQALTCGQVSSNLAPCIAYVRGGGAV

Sequence 1 PPATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGK
           PPA-CCNG-R-INN-AKTTADR-TAC-CLK----SV-G-N----A-LPGK
Sequence 2 PPA-CCNGIRNINNLAKTTADRQTACNCLKQLSASVPGVNANNAAALPGK

Sequence 1 CGVNIPYKISLSTNCATVK
           CGVN-PYKIS-STNCATVK
Sequence 2 CGVNVPYKISPSTNCATVK



Alignment 9
Sequence 1:
Sequence 2: Allergen Fra a 3.0102, Sequence: Q4PLT9
Sequence identity: 58.62 (68/116)
Sequence 1 ---MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPT
           -----A-K------LC--VA-P--AQAITCGQV-S---PC--Y-K--G--
Sequence 2 MASSTAMKLSLVALLCIVVALPI-AQAITCGQVASNISPCVTYVKSGGAV

Sequence 1 PPATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGK
           P-A-CC-G-R--N--AKTTADR---C-CLK-AAG--KGLNP---AGLPGK
Sequence 2 P-APCCSGIRNLNGMAKTTADRQATCNCLKQAAGGIKGLNPNLAAGLPGK

Sequence 1 CGVNIPYKISLSTNCATVK
           CGV--PYKIS--TNCA-VK
Sequence 2 CGVSVPYKISTTTNCAAVK



Alignment 10
Sequence 1:
Sequence 2: Allergen Cor a 8, Sequence: AAK28533
Sequence identity: 56.90 (66/116)
Sequence 1 MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTPPA
           M--LK-V----LCM-VAAP------TC-Q----L-PC--YLK--G--PP-
Sequence 2 MGSLKLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPP-

Sequence 1 TCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKCGV
           -CC-GVR--N-A--TT-DR--AC-CLK--A----GLNP---AGLPGKCGV
Sequence 2 SCCKGVRAVNDASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGV

Sequence 1 NIPYKISLSTNCATVK
           NIPYKIS-STNC--VK
Sequence 2 NIPYKISPSTNCNNVK



Alignment 11
Sequence 1:
Sequence 2: Allergen Ara h 9.0101, Sequence: ABX56711
Sequence identity: 59.48 (69/116)
Sequence 1 MAALKMVSFLVLCM-LVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTPP
           MA-LK-------CM--V-APM---AI-CGQV-SAL-PC---L-T-G--PP
Sequence 2 MASLKFAFVMLVCMAMVGAPMV-NAISCGQVNSALAPCIPFL-TKGGAPP

Sequence 1 ATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKCG
           --CC-GVR----A--TTADR--AC-CLK-AAGS--GLN----A-LPG-CG
Sequence 2 PACCSGVRGLLGALRTTADRQAACNCLKAAAGSLRGLNQGNAAALPGRCG

Sequence 1 VNIPYKISLSTNCATVK-
           V-IPYKIS-STNCAT-K-
Sequence 2 VSIPYKISTSTNCATIKF



Alignment 12
Sequence 1:
Sequence 2: Allergen Pyr c 3, Sequence: Q9M5X6
Sequence identity: 57.76 (67/116)
Sequence 1 ---MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPT
           ----A--K------LCM-V-----A-AITC-QV---L-PC--Y----G--
Sequence 2 MASSAVIKLALVVALCMAVSV---AHAITCSQVSANLAPCINYVRSGGAV

Sequence 1 PPATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGK
           PPA-CCNG--TIN--AKTT-DR--AC-CLK--AGSV-G-NP-----LPGK
Sequence 2 PPA-CCNGIKTINGLAKTTPDRQAACNCLKNLAGSVSGVNPGNAESLPGK

Sequence 1 CGVNIPYKISLSTNCATVK
           CGVN-PYKIS-STNCATVK
Sequence 2 CGVNVPYKISTSTNCATVK



Alignment 13
Sequence 1:
Sequence 2: Allergen Lup an 3.0101, Sequence: XP_019446786
Sequence identity: 59.48 (69/116)
Sequence 1 MAAL-KMVSFLVLCMLV-AAPMTAQAITCGQVQSALVPCLSYLKTTGPTP
           MA---K-------CM-V--AP-T--AITCGQV---L--CL-YL---G--P
Sequence 2 MAGIVKLACAVLICMVVVSAPLT-KAITCGQVTANLAQCLNYLRSGGAVP

Sequence 1 PATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKC
           -A-CCNG---I-N-AKTT-DRRTAC-CLK-AA----GLNP-----LPGKC
Sequence 2 -APCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKC

Sequence 1 GVNIPYKISLSTNCATVK
           GVNIPYKIS-STNCA--K
Sequence 2 GVNIPYKISTSTNCASIK



Alignment 14
Sequence 1:
Sequence 2: Allergen Pru d 3, Sequence: P82534
Sequence identity: 53.45 (62/116)
Sequence 1 MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTPPA
           ------------------------ITCGQV-S-L-PC--Y-K--G--PPA
Sequence 2 ------------------------ITCGQVSSNLAPCINYVKGGGAVPPA

Sequence 1 TCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKCGV
           -CCNG-R--NN-A-TTADRR-AC-CLK---GS--G-NP---A-LPGKCGV
Sequence 2 -CCNGIRNVNNLARTTADRRAACNCLKQLSGSIPGVNPNNAAALPGKCGV

Sequence 1 NIPYKISLSTNCATVK
           N-PYKIS-STNCATVK
Sequence 2 NVPYKISASTNCATVK



Alignment 15
Sequence 1:
Sequence 2: Allergen Pru ar 3, Sequence: P81651
Sequence identity: 53.45 (62/116)
Sequence 1 MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTPPA
           ------------------------ITCGQV-S-L-PC--Y----G--PPA
Sequence 2 ------------------------ITCGQVSSSLAPCIGYVRGGGAVPPA

Sequence 1 TCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKCGV
           -CCNG-R--NN-A-TT-DRRTAC-CLK---GS--G-NP---A-LPGKCGV
Sequence 2 -CCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAAALPGKCGV

Sequence 1 NIPYKISLSTNCATVK
           NIPYKIS-STNCATVK
Sequence 2 NIPYKISASTNCATVK



Alignment 16
Sequence 1:
Sequence 2: Allergen Len c 3.0101, Sequence: A0AT29
Sequence identity: 57.76 (67/116)
Sequence 1 --MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTP
           -----------LV-CM-V-APM---AI-CG-V-S-L-PCL-YL-T-GP-P
Sequence 2 MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYL-TGGPGP

Sequence 1 PATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKC
           ---CC-GV-----AA-TT-DR--AC-CLKSAAGS---LN----A-LPGKC
Sequence 2 SPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKC

Sequence 1 GVNIPYKISLSTNCATVK-
           GVNIPYKIS--TNC-TVK-
Sequence 2 GVNIPYKISTTTNCNTVKF



Alignment 17
Sequence 1:
Sequence 2: Allergen Pun g 1.0201, Sequence: A0A059SSZ0
Sequence identity: 55.17 (64/116)
Sequence 1 ----MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGP
           ----------V--L-LCM-VAA-----A-TCGQV-S-L-PC--Y------
Sequence 2 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA

Sequence 1 TPPATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPG
           -P-A-CC-GVR--NNAAKTT-DR-TAC-CLK--A-S--G-N---V--LPG
Sequence 2 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG

Sequence 1 KCGVNIPYKISLSTNCATVK
           KCGV-IPYKIS-ST-C--VK
Sequence 2 KCGVSIPYKISPSTDCSRVK



Alignment 18
Sequence 1:
Sequence 2: Allergen Pun g 1.0301, Sequence: A0A059ST23
Sequence identity: 53.45 (62/116)
Sequence 1 ---MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPT
           ------L----F---CM-VA-------ITCGQV-S-L--C--Y----G--
Sequence 2 MASSGFLRLAGFVLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAG

Sequence 1 P-PATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPG
           P-P--CCNG-R--N-AAKTT-DR--AC-CLKS-A-S--G-N---VAG-PG
Sequence 2 PVPQACCNGIRSLNSAAKTTPDRQAACRCLKSLASSISGINYGLVAGAPG

Sequence 1 KCGVNIPYKISLSTNCATVK
           KCGV-IPYKI--STNC--VK
Sequence 2 KCGVSIPYKIAPSTNCDNVK



Alignment 19
Sequence 1:
Sequence 2: Allergen Pha v 3.0201, Sequence: ADC80503
Sequence identity: 56.90 (66/116)
Sequence 1 MAALKMVSFL-VLCMLV-AAPMTAQAITCGQVQSALVPCLSYLKTTGPTP
           MA-L-------VLC--V--AP----AI-CGQV-S-L--C---L---GP-P
Sequence 2 MATLNSACVVAVLCLVVLTAPTAHAAISCGQVTSSLASCIPFLTKGGPVP

Sequence 1 PATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKC
           -A-CC-GVR--N-AAKTT-DR---C-CLKSAAG---G-N------LPGKC
Sequence 2 -ASCCSGVRSLNAAAKTTPDRQAVCNCLKSAAGAIPGFNANNAGILPGKC

Sequence 1 GVNIPYKISLSTNCATVK-
           GV-IPYKIS-STNCAT-K-
Sequence 2 GVSIPYKISTSTNCATIKF



Alignment 20
Sequence 1:
Sequence 2: Allergen Mor n 3.0101, Sequence: P85894
Sequence identity: 53.45 (62/116)
Sequence 1 MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTPPA
           ------------------------ITCGQV-S-L-PC--YL---G--P-A
Sequence 2 ------------------------ITCGQVSSSLAPCINYLRAGGVVP-A

Sequence 1 TCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKCGV
           -CCNGVR--NNAAKTTADR--AC-CLKSA--S-KGLN----AGLPGKCGV
Sequence 2 NCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCGV

Sequence 1 NIPYKISLSTNCATVK
           --PYKIS-ST-C--VK
Sequence 2 SVPYKISPSTDCKSVK



Alignment 21
Sequence 1:
Sequence 2: Allergen Pru p 3, Sequence: P81402
Sequence identity: 51.72 (60/116)
Sequence 1 MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTPPA
           ------------------------ITCGQV-SAL-PC--Y----G--PPA
Sequence 2 ------------------------ITCGQVSSALAPCIPYVRGGGAVPPA

Sequence 1 TCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKCGV
           -CCNG-R--NN-A-TT-DR--AC-CLK----SV-G-NP---A-LPGKCGV
Sequence 2 -CCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCGV

Sequence 1 NIPYKISLSTNCATVK
           -IPYKIS-STNCATVK
Sequence 2 HIPYKISASTNCATVK



Alignment 22
Sequence 1:
Sequence 2: Allergen Sola l 3.0101, Sequence: P93224
Sequence identity: 54.31 (63/116)
Sequence 1 -MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTPP
           -----K---F-V-CM-V-AP--A----CG-V-S-L-PCL-YL---GP---
Sequence 2 MEMFGKIACFVVFCMVVVAPH-AESLSCGEVTSGLAPCLPYLEGRGPL--

Sequence 1 ATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKCG
           --CC-GV-----AAKT--DR-TAC-CLKSAA-S-KG------AGLPG-CG
Sequence 2 GGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCG

Sequence 1 VNIPYKISLSTNCATVK
           VNIPYKIS-ST-C-TV-
Sequence 2 VNIPYKISPSTDCSTVQ



Alignment 23
Sequence 1:
Sequence 2: Allergen Lyc e 3, Sequence: AAB42069
Sequence identity: 54.31 (63/116)
Sequence 1 -MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTPP
           -----K---F-V-CM-V-AP--A----CG-V-S-L-PCL-YL---GP---
Sequence 2 MEMFGKIACFVVFCMVVVAPH-AESLSCGEVTSGLAPCLPYLEGRGPL--

Sequence 1 ATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKCG
           --CC-GV-----AAKT--DR-TAC-CLKSAA-S-KG------AGLPG-CG
Sequence 2 GGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCG

Sequence 1 VNIPYKISLSTNCATVK
           VNIPYKIS-ST-C-TV-
Sequence 2 VNIPYKISPSTDCSTVQ



Alignment 24
Sequence 1:
Sequence 2: Allergen Pis s 3.0101, Sequence: A0A161AT60
Sequence identity: 51.72 (60/116)
Sequence 1 --MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKT-TGPT
           -----------LV-CM-V-APM---A--CG-V-----PC--YL-------
Sequence 2 MARSMKLACVALVICMVVIAPMAEAALSCGTVSADMAPCVTYLQAPNNAS

Sequence 1 PPATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGK
           PP--CC-GV-----AA-TT-DR--AC-CLKSAAGS---LN----A-LPGK
Sequence 2 PPPPCCAGVKKLLAAATTTPDRQAACNCLKSAAGSIPKLNTNNAAALPGK

Sequence 1 CGVNIPYKISLSTNCATVK-
           CGV-IPYKIS-STNC-TV--
Sequence 2 CGVSIPYKISTSTNCNTVRF



Alignment 25
Sequence 1:
Sequence 2: Allergen Pru p 3, Sequence: CAB96876
Sequence identity: 50.86 (59/116)
Sequence 1 MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTPPA
           ------------------------ITCGQV-S-L-PC--Y----G--PPA
Sequence 2 ------------------------ITCGQVSSSLAPCIPYVRGGGAVPPA

Sequence 1 TCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKCGV
           -CCNG-R--NN-A-TT-DR--AC-CLK----SV-G-NP---A-LPGKCGV
Sequence 2 -CCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCGV

Sequence 1 NIPYKISLSTNCATVK
           -IPYKIS-STNCATVK
Sequence 2 SIPYKISASTNCATVK



Alignment 26
Sequence 1:
Sequence 2: Allergen Zea m 14.0101, Sequence: P19656-1
Sequence identity: 51.72 (60/116)
Sequence 1 ----MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGP
           --------------V---L-AA-----AI-CGQV-SA--PC-SY----G-
Sequence 2 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS

Sequence 1 TPPATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPG
           -P-A-CC-GVR--NNAA-TTADRR-AC-CLK-AA--V-GLN----A--P-
Sequence 2 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS

Sequence 1 KCGVNIPYKISLSTNCATVK
           KCGV-IPY-IS-ST-C--V-
Sequence 2 KCGVSIPYTISTSTDCSRVN



Alignment 27
Sequence 1:
Sequence 2: Allergen Zea m 14.0102, Sequence: P19656-2
Sequence identity: 50.86 (59/116)
Sequence 1 ----MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGP
           --------------V---L-AA-----AI-CGQV-SA--PC-SY----G-
Sequence 2 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS

Sequence 1 TPPATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPG
           -P-A-CC-GVR--NNAA-TTADRR-AC-CLK-AA--V-GLN----A--P-
Sequence 2 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS

Sequence 1 KCGVNIPYKISLSTNCATVK--------
           KCGV-IPY-IS-ST-C------------
Sequence 2 KCGVSIPYTISTSTDCSRYSRRMHASAD



Alignment 28
Sequence 1:
Sequence 2: Allergen Pun g 1.0101, Sequence: A0A059STC4
Sequence identity: 50.86 (59/116)
Sequence 1 ---MAALKMVSFLVLCMLVAAPM-TAQAITCGQVQSALVPCLSYLKTTGP
           -------K---------LVAAP--T--A-TCGQV-S-L-PC--Y----G-
Sequence 2 MTGSGLFKLACAVFAVALVAAPIATEAAVTCGQVASSLAPCIPYARSAGG

Sequence 1 TPPATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPG
           --P--CC-G--T----A-TT-DR---C-CLKSA--S--G-N---VA-LP-
Sequence 2 AVPPACCSGIKTLDGMARTTPDRQATCKCLKSASTSISGINYGLVASLPA

Sequence 1 KCGVNIPYKISLSTNCATVK
           KCGVNIPYKIS-ST-CA-VK
Sequence 2 KCGVNIPYKISPSTDCARVK



Alignment 29
Sequence 1:
Sequence 2: Allergen Can s 3.0101, Sequence: W0U0V5
Sequence identity: 50.00 (58/116)
Sequence 1 MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTPPA
           ------------------------ITCGQV-S-L-PCLSYLK--G--P--
Sequence 2 ------------------------ITCGQVASSLAPCLSYLKVGGAVPDG

Sequence 1 TCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKCGV
           -CCN-------AAKT-ADR--AC-CLKSAA-S-KG-N-----GLPGKCGV
Sequence 2 -CCNDIKSLSGAAKTPADRQAACKCLKSAASSIKGVNFNLASGLPGKCGV

Sequence 1 NIPYKISLSTNCATVK
           -IPYKIS-ST-C--VK
Sequence 2 SIPYKISPSTDCSSVK



Alignment 30
Sequence 1:
Sequence 2: Allergen Pla or 3.0101, Sequence: ABY21307
Sequence identity: 50.00 (58/116)
Sequence 1 ---MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPT
           -------K----L--CM---AP----AITCG-V---L-PCL-YL---G--
Sequence 2 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAV

Sequence 1 PPATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGK
           -PA-CCNGV---NN-AKTT-DR--AC-CLK-A--S--G------A-L-GK
Sequence 2 APA-CCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGK

Sequence 1 CGVNIPYKISLSTNCATVK
           CGVN-PYKIS----C--VK
Sequence 2 CGVNLPYKISPTIDCSKVK



Alignment 31
Sequence 1:
Sequence 2: Allergen Ara h 9.0201, Sequence: ABX75045
Sequence identity: 50.00 (58/116)
Sequence 1 MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTPPA
           --------------------------CGQV-SAL-PC---L-T-G--P--
Sequence 2 ------------------------LSCGQVNSALAPCITFL-TKGGVPSG

Sequence 1 TCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKCGV
           -CC-GVR----AAKTTADR--AC-CLK-AAGS--GLN----A-LPG-CGV
Sequence 2 PCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHGLNQGNAAALPGRCGV

Sequence 1 NIPYKISLSTNCATVK-
           -IPYKIS-STNCAT-K-
Sequence 2 SIPYKISTSTNCATIKF



Alignment 32
Sequence 1:
Sequence 2: Allergen Pla a 3.0101, Sequence: CAL07989
Sequence identity: 49.14 (57/116)
Sequence 1 ---MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPT
           -------K----L--CM---AP----AITCG-V---L-PCL--L---G--
Sequence 2 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV

Sequence 1 PPATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGK
           -PA-CCNGV---NN-AKTT-DR--AC-CLK-A--S--G------A-L-GK
Sequence 2 APA-CCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGK

Sequence 1 CGVNIPYKISLSTNCATVK
           CGVN-PYKIS----C--VK
Sequence 2 CGVNLPYKISPTIDCSKVK



Alignment 33
Sequence 1:
Sequence 2: Allergen Art si 3.0102, Sequence: ANC85027
Sequence identity: 52.59 (61/116)
Sequence 1 MAALKMVSF---LVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPT
           --A-KM--F----V-CM-------A-A-TC--V-----PCL-YLK--G--
Sequence 2 -MAMKMMKFFCAMVVCMVLSSSY-AEALTCSDVSNKITPCLNYLKQGGEV

Sequence 1 PPATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGK
           P-A-CC-GV---N-AAKTT-DR-TAC-CLK----S-K-L-----A-LP-K
Sequence 2 P-ADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSK

Sequence 1 CGVNIPYKISLSTNCATVK
           CGVNIPYKISL-T-C--VK
Sequence 2 CGVNIPYKISLETDCNKVK



Alignment 34
Sequence 1:
Sequence 2: Allergen Art ar 3.0102, Sequence: ANC85020
Sequence identity: 52.59 (61/116)
Sequence 1 MAALKMVSF---LVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPT
           --A-KM--F----V-CM-------A-A-TC--V-----PCL-YLK--G--
Sequence 2 -MAMKMMKFFCAMVVCMVLSSSY-AEALTCSDVSNKITPCLNYLKQGGEV

Sequence 1 PPATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGK
           P-A-CC-GV---N-AAKTT-DR-TAC-CLK----S-K-L-----A-LP-K
Sequence 2 P-ADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSK

Sequence 1 CGVNIPYKISLSTNCATVK
           CGVNIPYKISL-T-C--VK
Sequence 2 CGVNIPYKISLETDCNKVK



Alignment 35
Sequence 1:
Sequence 2: Allergen Art v 3.0202, Sequence: ACE07187
Sequence identity: 52.59 (61/116)
Sequence 1 MAALKMVSF---LVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPT
           --A-KM--F----V-CM-------A-A-TC--V-----PCL-YLK--G--
Sequence 2 -MAMKMMKFFCAMVVCMVLSSSY-AEALTCSDVSNKITPCLNYLKQGGEV

Sequence 1 PPATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGK
           P-A-CC-GV---N-AAKTT-DR-TAC-CLK----S-K-L-----A-LP-K
Sequence 2 P-ADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSK

Sequence 1 CGVNIPYKISLSTNCATVK
           CGVNIPYKISL-T-C--VK
Sequence 2 CGVNIPYKISLETDCNKVK



Alignment 36
Sequence 1:
Sequence 2: Allergen Art gm 3.0102, Sequence: ANC85023
Sequence identity: 50.00 (58/116)
Sequence 1 --MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTP
           --M---K-----V-CM-V-------A-TC--V-----PCLS-LK--G--P
Sequence 2 MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKISPCLSFLKQGGEVP

Sequence 1 PATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKC
           -A-CC-GV---N-AAKTT-DR-TAC-CLK----S-K-L-------LP-KC
Sequence 2 -ADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDNAVVLPSKC

Sequence 1 GVNIPYKISLSTNCATVK
           GVNIPYKISL-T-C--VK
Sequence 2 GVNIPYKISLETDCNKVK



Alignment 37
Sequence 1:
Sequence 2: Allergen Art gm 3.0101, Sequence: ANC85022
Sequence identity: 49.14 (57/116)
Sequence 1 --MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTP
           --M---K-----V-CM-V-------A-TC--V-----PC-S-LK--G--P
Sequence 2 MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKISPCTSFLKQGGEVP

Sequence 1 PATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKC
           -A-CC-GV---N-AAKTT-DR-TAC-CLK----S-K-------A-LP-KC
Sequence 2 -ADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDFKSDNAAVLPSKC

Sequence 1 GVNIPYKISLSTNCATVK
           GVNIPYKISL-T-C--VK
Sequence 2 GVNIPYKISLETDCNKVK



Alignment 38
Sequence 1:
Sequence 2: Allergen Art ca 3.0102, Sequence: QIN55516
Sequence identity: 48.28 (56/116)
Sequence 1 --MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTP
           --M---K-------CM-V-------A-TC--V-----PCLS-LK--G--P
Sequence 2 MAMKMMKVFCVMIVCMVVLSSYAEAALTCSDVSNKITPCLSFLKQGGEVP

Sequence 1 PATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKC
           -A-CC-GV---N-AAKT--DR--AC-CLK----S-K-L-------LP-KC
Sequence 2 -ADCCTGVKGLNDAAKTGPDRQKACNCLKTTFKSNKDLKSDNAVVLPSKC

Sequence 1 GVNIPYKISLSTNCATVK
           GVNIPYKISL-T-C-TVK
Sequence 2 GVNIPYKISLETDCNTVK



Alignment 39
Sequence 1:
Sequence 2: Allergen Art la 3.0101, Sequence: ANC85024
Sequence identity: 51.72 (60/116)
Sequence 1 MAALKMVSF---LVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPT
           --A-KM--F----V-CM-V-----A-A--C--V------CLSYLK--G--
Sequence 2 -MAMKMMKFFCAMVVCMVVSSSY-AEALKCSDVSNKISACLSYLKQGGEV

Sequence 1 PPATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGK
           P-A-CC-GV---N-AAKTT-DR-TAC-CLK----S-K-------A-LP-K
Sequence 2 P-ADCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSK

Sequence 1 CGVNIPYKISLSTNCATVK
           CGVNIPYKISL-T-C--VK
Sequence 2 CGVNIPYKISLETDCNKVK



Alignment 40
Sequence 1:
Sequence 2: Allergen Art ar 3.0101, Sequence: ANC85019
Sequence identity: 51.72 (60/116)
Sequence 1 MAALKMVSF---LVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPT
           --A-KM--F----V-CM-V-----A-A--C--V------CLSYLK--G--
Sequence 2 -MAMKMMKFFCAMVVCMVVSSSY-AEALKCSDVSNKISACLSYLKQGGEV

Sequence 1 PPATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGK
           P-A-CC-GV---N-AAKTT-DR-TAC-CLK----S-K-------A-LP-K
Sequence 2 P-ADCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSK

Sequence 1 CGVNIPYKISLSTNCATVK
           CGVNIPYKISL-T-C--VK
Sequence 2 CGVNIPYKISLETDCNKVK



Alignment 41
Sequence 1:
Sequence 2: Allergen Art la 3.0102, Sequence: ANC85025
Sequence identity: 47.41 (55/116)
Sequence 1 MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTPPA
           M---K-----V-CM-V-------A-TC--V-----PCLSYLK--G--P-A
Sequence 2 MKMMKVFCVMVVCMVVKSSYAEAALTCSDVSTKISPCLSYLKKGGEVP-A

Sequence 1 TCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKCGV
           -CC-GV---N-A-KTT-DR-TAC-CLK----S-K-L-------LP-KCG-
Sequence 2 DCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGL

Sequence 1 NIPYKISLSTNCATVK
           N-PYK-SL-T-C--VK
Sequence 2 NLPYKLSLETDCNKVK



Alignment 42
Sequence 1:
Sequence 2: Allergen Pru du 3.0101, Sequence: ACN11576
Sequence identity: 48.28 (56/116)
Sequence 1 ----MAALKMVSFLVL--CMLVAAPMTAQAITCGQVQSALVPCLSYLKTT
           -------LK-V-------CM-V--P----A--CGQV---L-PC--Y----
Sequence 2 MASSGQLLKLVCLVAVMCCMAVGGPKAMAAVSCGQVVNNLTPCINYVANG

Sequence 1 GPTPPATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTT--VA
           G---P--CC-GVR-----A-TTADR---C-CLK-A-------N------A
Sequence 2 GALNP-SCCTGVRSLYSLAQTTADRQSICNCLKQAVNGIPYTNANAGLAA

Sequence 1 GLPGKCGVNIPYKISLSTNCATVK
           GLPGKCGVNIPYKIS-ST-C-T-K
Sequence 2 GLPGKCGVNIPYKISPSTDCKTIK



Alignment 43
Sequence 1:
Sequence 2: Allergen Art v 3.0301, Sequence: EU564847
Sequence identity: 46.55 (54/116)
Sequence 1 --MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTP
           ------K-----V-CM-V-------A-TC--V-----PCLSYLK--G--P
Sequence 2 MAIKMMKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVP

Sequence 1 PATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKC
           -A-CC-GV---N-A-KTT-DR-TAC-CLK----S-K-L-------LP-KC
Sequence 2 -ADCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKC

Sequence 1 GVNIPYKISLSTNCATVK
           G-N-PYK-SL-T-C--VK
Sequence 2 GLNLPYKLSLETDCNKVK



Alignment 44
Sequence 1:
Sequence 2: Allergen Tri tu 14.0101, Sequence: CAH69206
Sequence identity: 47.41 (55/116)
Sequence 1 MAALKMVSFLVLCMLVAAPM---TAQAITCGQVQSALVPCLSYLKTTGPT
           --A---V---VL---VAA-----T--A--CGQV-SAL-PC-SY----G--
Sequence 2 -MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGNGAS

Sequence 1 PPATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGK
           P-A-CC-GVR-----A--TAD---AC-C-KSAA----GLN----AG-P-K
Sequence 2 PSAACCSGVRSLASSARSTADKQAACKCIKSAAA---GLNAGKAAGIPTK

Sequence 1 CGVNIPYKISLSTNCATVK
           CGV--PY-IS-S--C----
Sequence 2 CGVSVPYAISSSVDCSKIR



Alignment 45
Sequence 1:
Sequence 2: Allergen Art v 3.0201, Sequence: EU564845
Sequence identity: 50.86 (59/116)
Sequence 1 MAALKMVSF---LVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPT
           ----KM--F----V-CM-V-----A-A--C--V------CLSYLK--G--
Sequence 2 ---MKMMKFFCAMVVCMVVSSSY-AEALKCSDVSNKISACLSYLKQGGEV

Sequence 1 PPATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGK
           P-A-CC-GV---N-AAKTT-DR-TAC-CLK----S-K-------A-LP-K
Sequence 2 P-ADCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSK

Sequence 1 CGVNIPYKISLSTNCATVK
           CGVNIPYKISL-T-C--VK
Sequence 2 CGVNIPYKISLETDCNKVK



Alignment 46
Sequence 1:
Sequence 2: Allergen Api g 2, Sequence: ACV04796
Sequence identity: 46.55 (54/116)
Sequence 1 ---MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPT
           ---------V-----------P------TCGQV---L--CL-YLK--G--
Sequence 2 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYP

Sequence 1 PPATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGK
           -PA-CC-GV---N--AKT-ADR--AC-CLK--AGSVKG-N------LPGK
Sequence 2 SPA-CCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGK

Sequence 1 CGVNIPYKISLSTNCATVK
           CG--IPY-IS-ST-C--V-
Sequence 2 CGIRIPYPISPSTDCSRVN



Alignment 47
Sequence 1:
Sequence 2: Allergen Art si 3.0101, Sequence: ANC85026
Sequence identity: 47.41 (55/116)
Sequence 1 --MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTP
           --M---K-----V-CM-V-----A-A-TC--V-----PCL-YLK--G--P
Sequence 2 MAMKMMKVFCVMVVCMVVSSSY-AEALTCSDVSNKISPCLNYLKQGGEVP

Sequence 1 PATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKC
           -A-CC-GV---N-AAKTT-DR-TAC-CLK------K-L-------LP-KC
Sequence 2 -ANCCAGVKGLNDAAKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKC

Sequence 1 GVNIPYKISLSTNCATVK
           GV-IPYK-S--T-C--VK
Sequence 2 GVTIPYKLSMETDCNKVK



Alignment 48
Sequence 1:
Sequence 2: Allergen Art an 3.0101, Sequence: ANC85017
Sequence identity: 46.55 (54/116)
Sequence 1 --MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTP
           --M---K-----V-CM-V-------A-TC--V-----PC-S-LK--G---
Sequence 2 MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKILPCTSFLKQGGEVS

Sequence 1 PATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKC
           -A-CC-GV---N-AAKTT-DR--AC-CLK----S-K---------LP-KC
Sequence 2 -ADCCTGVKGLNDAAKTTPDRQAACNCLKTTFKSNKDFKSDNAVVLPSKC

Sequence 1 GVNIPYKISLSTNCATVK
           GVNIPYKISL-T-C--VK
Sequence 2 GVNIPYKISLETDCNKVK



Alignment 49
Sequence 1:
Sequence 2: Allergen Art ca 3.0101, Sequence: ANC85021
Sequence identity: 46.55 (54/116)
Sequence 1 --MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTP
           --M---K-----V-CM-V-------A-TC--V-----PC-S-LK--G---
Sequence 2 MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKILPCTSFLKQGGEVS

Sequence 1 PATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKC
           -A-CC-GV---N-AAKTT-DR--AC-CLK----S-K---------LP-KC
Sequence 2 -ADCCTGVKGLNDAAKTTPDRQAACNCLKTTFKSNKDFKSDNAVVLPSKC

Sequence 1 GVNIPYKISLSTNCATVK
           GVNIPYKISL-T-C--VK
Sequence 2 GVNIPYKISLETDCNKVK



Alignment 50
Sequence 1:
Sequence 2: Allergen Hor v 1, Sequence: AAA32970
Sequence identity: 45.69 (53/116)
Sequence 1 ---MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPT
           ------L-M---LVL-ML-AAP--A-A--CGQV-S---PCL-Y----GP-
Sequence 2 MARAQVLLMAAALVL-MLTAAPRAAVALNCGQVDSKMKPCLTYVQG-GPG

Sequence 1 PPATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGK
           P---CCNGVR---N-A----DR-T-C-CLK--A-----LN----A--P-K
Sequence 2 PSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSK

Sequence 1 CGVNIPYKISLSTNCATVK
           C-VN-PY-IS----C----
Sequence 2 CNVNVPYTISPDIDCSRIY



Alignment 51
Sequence 1:
Sequence 2: Allergen Art an 3.0102, Sequence: ANC85018
Sequence identity: 45.69 (53/116)
Sequence 1 --MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTP
           --M---K-----V-CM-V-------A-TC--V-----PC-S-L---G--P
Sequence 2 MAMKMMKVFCVMVVCMVVTSSYAEAALTCNDVTKKISPCTSFLEKGGEVP

Sequence 1 PATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKC
           ---CC-GV---N-AAKTT-DR--AC-CLK----S---------A-LP-KC
Sequence 2 -VDCCTGVKGLNDAAKTTPDRQAACNCLKTSFKSSNNFKEENAAVLPSKC

Sequence 1 GVNIPYKISLSTNCATVK
           GVNIPYKISL-T-C--VK
Sequence 2 GVNIPYKISLETDCNKVK



Alignment 52
Sequence 1:
Sequence 2: Allergen Hor v 1, Sequence: CAA42832
Sequence identity: 45.69 (53/116)
Sequence 1 ---MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPT
           ------L-M---LVL-ML-AAP--A-A--CGQV-S---PCL-Y----GP-
Sequence 2 MARAQVLLMAAALVL-MLTAAPRAAVALNCGQVDSKMKPCLTYVQG-GPG

Sequence 1 PPATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGK
           P---CCNGVR---N-A----DR-T-C-CLK--A-----LN----A--P-K
Sequence 2 PSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSK

Sequence 1 CGVNIPYKISLSTNCATVK-----------------
           C-VN-PY-IS----C---------------------
Sequence 2 CNVNVPYTISPDIDCSRFTERRSVKLVLSSSIHVEL



Alignment 53
Sequence 1:
Sequence 2: Allergen Ara h 17.0101, Sequence: A0A510A9S3
Sequence identity: 43.10 (50/116)
Sequence 1 MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTPPA
           -----------------------AI-C--V-----PC--YLK--G-T---
Sequence 2 -----------------------AIQCSFVTKSIAPCFGYLKSGG-TVSG

Sequence 1 TCCNGVRTINNAAKTTADRRTACQCLKSAAGSV-KGLNPTTVAGLPGKCG
           -CC-G---IN--AKTT-DR---C-CLKSAA-S-----NP---A-LPGKCG
Sequence 2 PCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLPGKCG

Sequence 1 VNIPYKISLSTNCATVK
           V-IPYKIS-S-NC---K
Sequence 2 VSIPYKISTSINCSSIK



Alignment 54
Sequence 1:
Sequence 2: Allergen Sin a 3.0101, Sequence: ABU95411
Sequence identity: 42.24 (49/116)
Sequence 1 MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTPPA
           -----------------------A--CG-V-S-L--C--YL----P-P--
Sequence 2 -----------------------ALSCGTVNSNLAACIGYLTQNAPLPKG

Sequence 1 TCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKCGV
           -CC-GV---NN-A-TT-DR--AC-CL--AA-S---LN----A-LP--CGV
Sequence 2 -CCTGVTNLNNMARTTPDRQQACRCLVGAANSFPSLNAARAAALPKACGV

Sequence 1 NIPYKISLSTNCATVK
           NIPYKIS-STNC--V-
Sequence 2 NIPYKISKSTNCNSVR



Alignment 55
Sequence 1:
Sequence 2: Allergen Sola l 7.0101, Sequence: NP_001316123
Sequence identity: 41.38 (48/116)
Sequence 1 MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTPPA
           M-A-------VL-----A-----AITCGQV---L-PC---L-T-G--P-A
Sequence 2 MKAIAILVLVVLAVFQLAMVARGAITCGQVDANLAPCVPFL-TQGGEPGA

Sequence 1 TCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKCGV
           -CC-GVRT-N-------DRRTAC-C-K-AA-----L-------LP-KCG-
Sequence 2 ACCSGVRTLNGNTQSSDDRRTACNCVKAAANRYPNLKDDAAQSLPSKCGI

Sequence 1 NIPYKISLSTNCATVK
           -----IS---NC-T--
Sequence 2 SLTVPISRTVNCDTIS



Alignment 56
Sequence 1:
Sequence 2: Allergen Tri a 14.0101, Sequence: 19846220
Sequence identity: 36.21 (42/116)
Sequence 1 MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTPPA
           ------------------------I-CG-V-S---PCLSY----GP-P--
Sequence 2 ------------------------IDCGHVDSLVRPCLSYVQG-GPGPSG

Sequence 1 TCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKCGV
           -CC-GV----N-A----DR--AC-CLK--A-----LN-------P-KCGV
Sequence 2 QCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCGV

Sequence 1 NIPYKISLSTNCATVK
           N-PY-ISL---C--V-
Sequence 2 NLPYTISLNIDCSRV-



Alignment 57
Sequence 1:
Sequence 2: Allergen Hel a 3.0101, Sequence: P82007
Sequence identity: 39.66 (46/116)
Sequence 1 MAALKMVSFLVLCMLVAAPMTAQ---AITCGQVQSALVPCLSYLKTTGPT
           -----------L-M-V-A--------AITC--V---L-PCL-YL---G--
Sequence 2 -MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKP

Sequence 1 PPATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGK
           -PA-CC-G------A--T-ADRRTAC-C-K-AA---K---P-----LPGK
Sequence 2 TPA-CCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPGK

Sequence 1 CGVNIPYKISLSTNCATVK
           CG------I----NC-T--
Sequence 2 CGISTSIPINPNVNCNTIP



Alignment 58
Sequence 1:
Sequence 2: Allergen Par j 2, Sequence: O04403
Sequence identity: 27.59 (32/116)
Sequence 1 ---------MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYL
           -----------------------L--AP-------CG-V-----PCL---
Sequence 2 MRTVSMAALVVIAAALAWTSSAELASAPAPGEG-PCGKVVHHIMPCLKFV

Sequence 1 KTTGPTPPATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTV
           K-----P---CC-G--------KTT---R-AC-C---A-----G-----V
Sequence 2 KGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELV

Sequence 1 AGLPGKCGV--NIPYKISLSTNCATVK--------
           A--P-KCG-----P--I-----C------------
Sequence 2 AEVPKKCGITTTLP-PITADFDCSKIESTIFRGYY



Alignment 59
Sequence 1:
Sequence 2: Allergen Par j 2, Sequence: P55958
Sequence identity: 31.03 (36/116)
Sequence 1 -----MAALKMVSFLVLCMLVAAPMTAQAI---TCGQVQSALVPCLSYLK
           -----MAAL------------A-P--A-A-----CG-V-----PCL---K
Sequence 2 MRTVSMAALVVIAAALAWTSSAEPAPAPAPGEEACGKVVQDIMPCLHFVK

Sequence 1 TTGPTPPATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVA
           -----P---CC-G--------KTT---R-AC-C---A-----G-----VA
Sequence 2 GEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVA

Sequence 1 GLPGKCGV--NIPYKISLSTNCATVK--------
           --P-KC------P--I-----C------------
Sequence 2 EVPKKCDIKTTLP-PITADFDCSKIQSTIFRGYY



Alignment 60
Sequence 1:
Sequence 2: Allergen Amb a 6, Sequence: O04004
Sequence identity: 32.76 (38/116)
Sequence 1 ---MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPT
           ------L--V----L-------M-A---TC--VQ--L-PC---L--TG--
Sequence 2 MDCIRILWSVAVGLLLVSWRPTMFAASPTCDTVQNILAPCAGFL--TGQE

Sequence 1 PPATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGK
           P---CC-GV---NN--KT-ADR---C-C-K----S-----P-----L--K
Sequence 2 PSKACCTGVNNLNNSRKTKADRVAVCNCIKELTKSI-AYDPKRMPLLSTK

Sequence 1 CGVNIPYK-ISLSTNCATVK-
           CGV------------C-----
Sequence 2 CGVKPDFPAVDKNLDCSKLPV



Alignment 61
Sequence 1:
Sequence 2: Allergen Par j 1, Sequence: Q40905
Sequence identity: 25.86 (30/116)
Sequence 1 -------------MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPC
           ------------------------------AP------TCG-V--AL-PC
Sequence 2 MRTVSARSSVALVVIVAAVLVWTSSASVAPAPAPGSEETCGTVVGALMPC

Sequence 1 LSYLKTTGPTPPATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLN
           L---------P---CC-G--------KT---R--AC-C---A--------
Sequence 2 LPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDID

Sequence 1 PTTVAGLPGKCGV---NIPYKISLSTNCATVK-------
           ---V---P--CG------P--I-----C-T---------
Sequence 2 GKLVSEVPKHCGIVDSKLP-PIDVNMDCKTLGVLHYKGN



Alignment 62
Sequence 1:
Sequence 2: Allergen Par j 1, Sequence: O04404
Sequence identity: 26.72 (31/116)
Sequence 1 --------------MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVP
           ----------------A--------------AP------TCG-V--AL-P
Sequence 2 MRTVSAPSAVALVVIVAAGLAWTSLASVAPPAPAPGSEETCGTVVRALMP

Sequence 1 CLSYLKTTGPTPPATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGL
           CL---------P---CC-G--------KT---R--AC-C---A-------
Sequence 2 CLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSDI

Sequence 1 NPTTVAGLPGKCGV---NIPYKISLSTNCATVK-----------------
           ----V---P--CG------P--I-----C-T-------------------
Sequence 2 DGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTLGVVPRQPQLPVSLRHGPV

Sequence 1 ---------------------------
           ---------------------------
Sequence 2 TGPSDPAHKARLERPQIRVPPPAPEKA



Alignment 63
Sequence 1:
Sequence 2: Allergen Par j 1, Sequence: P43217
Sequence identity: 24.14 (28/116)
Sequence 1 MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTPPA
           -------------------------TCG----AL-PCL---------P--
Sequence 2 -----------------------QETCGTMVRALMPCLPFVQGKEKEPSK

Sequence 1 TCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKCGV
           -CC-G--------KT---R--AC-C---A-----------V---P--CG-
Sequence 2 GCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGI

Sequence 1 ---NIPYKISLSTNCATVK-------------------------------
           -----P--I-----C-TV--------------------------------
Sequence 2 VDSKLP-PIDVNMDCKTVGVVPRQPQLPVSLRHGPVTGPSDPAHKARLER

Sequence 1 -------------
           -------------
Sequence 2 PQIRVPPPAPEKA



Alignment 64
Sequence 1:
Sequence 2: Allergen Par j 1.0103, Sequence: CAI94601
Sequence identity: 23.28 (27/116)
Sequence 1 MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTPPA
           -------------------------TCG----AL-PCL---------P--
Sequence 2 -----------------------QETCGTMVRALMPCLPFVQGKEKEPSK

Sequence 1 TCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKCGV
           -CC-G--------KT---R--AC-C---A-----------V---P--CG-
Sequence 2 GCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGI

Sequence 1 ---NIPYKISLSTNCATVK-------------------------------
           -----P--I-----C-T---------------------------------
Sequence 2 VDSKLP-PIDVNMDCKTLGVVPRQPQLPVSLRHGPVTGPSDPAHKARLER

Sequence 1 -------------
           -------------
Sequence 2 PQIRVPPPAPEKA



Alignment 65
Sequence 1:
Sequence 2: Allergen Par j 1.0101, Sequence: CAA54587
Sequence identity: 21.55 (25/116)
Sequence 1 MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTPPA
           --------------------------------AL-PCL---------P--
Sequence 2 -----------------------------MVRALMPCLPFVQGKEKEPSK

Sequence 1 TCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKCGV
           -CC-G--------KT---R--AC-C---A-----------V---P--CG-
Sequence 2 GCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGI

Sequence 1 ---NIPYKISLSTNCATVK-------------------------------
           -----P--I-----C-TV--------------------------------
Sequence 2 VDSKLP-PIDVNMDCKTVGVVPRQPQLPVSLRHGPVTGPSDPAHKARLER

Sequence 1 -------------
           -------------
Sequence 2 PQIRVPPPAPEKA



Alignment 66
Sequence 1:
Sequence 2: Allergen Cas s 8, Sequence: 10998016
Sequence identity: 17.24 (20/116)
Sequence 1 MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTPP-
           ------------------------ITC-QV---L-PCL-YLK--G--PP-
Sequence 2 -----------------------SITCTQVSKSLMPCLTYLKSNGGSPPP

Sequence 1 ATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKCG
           -TCC-GV-------------------------------------------
Sequence 2 GTCCQGVKL-----------------------------------------

Sequence 1 VNIPYKISLSTNCATVK
           -----------------
Sequence 2 -----------------



Alignment 67
Sequence 1:
Sequence 2: Allergen Art v 3.0101, Sequence: P0C088
Sequence identity: 16.38 (19/116)
Sequence 1 MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTPPA
           -----------------------A-TC--V-----PCLSYLK--G--P-A
Sequence 2 -----------------------ALTCSDVSNKISPCLSYLKQGGEVP-A

Sequence 1 TCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKCGV
           -CC-GV---N----------------------------------------
Sequence 2 DCCAGVKGLND---------------------------------------

Sequence 1 NIPYKISLSTNCATVK
           ----------------
Sequence 2 ----------------



Alignment 68
Sequence 1:
Sequence 2: Allergen Vit v 1, Sequence: P80274
Sequence identity: 13.79 (16/116)
Sequence 1 MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTPPA
           -------------------------TCGQV-SAL-PC--YL---G--P--
Sequence 2 -----------------------TVTCGQVASALSPCIDYLQKDGAVPAG

Sequence 1 TCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKCGV
           -CC-----------------------------------------------
Sequence 2 SCCXKXLSSA----------------------------------------

Sequence 1 NIPYKISLSTNCATVK
           ----------------
Sequence 2 ----------------



Alignment 69
Sequence 1:
Sequence 2: Allergen Jug r 8.0101, Sequence: XP_018816661
Sequence identity: 25.86 (30/116)
Sequence 1 MAALKMVSFLVLCMLVA-------APMTAQAITCGQVQSALVPCLSYLKT
           ----K-V----LC--VA-------AP--A-A-TC------L-PCL-----
Sequence 2 ---MKKVCCVLLCVVVAVAVLLSEAPLVAEAVTCNYTE--LSPCLAAI-V

Sequence 1 TGPTPPATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKG-LNPTTVA
           ----P-ATCC---R---------------C-C--------K---N-----
Sequence 2 SPAKPSATCCQKLR-----------EQKPCLCVYYKNPNLKQYINSPGAK

Sequence 1 GLPGKCGVNIPYKISLSTNCATVK
           -----CGV--P-------------
Sequence 2 KVASSCGVSLPKC-----------


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.