The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Tri a gliadin

Sequence 473876

Full FASTA alignment

Sequence name:
Query sequence:
MKTFLILALLAIVATTATTAVRVPVPQLQPQNPSQQQPQEQVPLVQQQQF
LGQQQPFPPQQPYPQPQPFPSQQPYLQLQPFLQPQLPYSQPQPFRPQQPY
PQPQPQYSQPQQPISQQQQQQQQQQQQQQQQQQQIIQQILQQQLIPCMDV
VLQQHNIVHGKSQVLQQSTYQLLQELCCQHLWQIPEQSQCQAIHNVVHAI
ILHQQQKQQQQPSSQVSFQQPLQQYPLGQGSFRPSQQNPQAQGSVQPQQL
PQFEEIRNLALQTLPAMCNVYIPPYCTIAPFGIFGTN

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Tri a gliadinAAA17741Go!287254.33.1e-69
2Tri a gliadinAAA34280Go!286247.34.1e-67
3Tri a gliadinCAA25261Go!286246.28.5e-67
4Tri a gliadinCAA26384Go!286245.91.0e-66
5Tri a gliadinCAA25593Go!286244.92.1e-66
6Tri a gliadinAAA34281Go!262230.73.5e-62
7Tri a gliadinAAA34276Go!291228.12.4e-61
8Tri a gliadinCAA26383Go!296224.14.0e-60
9Tri a gliadinAAA34290Go!296217.05.3e-58
10Tri a gliadinAAA34283Go!282208.42.0e-55
11Tri a gliadinAAA34282Go!297178.71.9e-46
12Tri a gliadinAAA34275Go!318177.16.1e-46
13Tri a gliadinAAA34278Go!319176.87.2e-46
14Tri a gliadinAAA34279Go!313174.73.2e-45
15Tri a gliadinCAA26385Go!313174.43.7e-45
16Tri a gliadinAAA34284Go!186160.72.9e-41
17Tri a gliadinCAA35238Go!307124.15.0e-30
18Tri a 21.0101CAY54134Go!281120.84.5e-29
19Tri a gliadinAAA34289Go!327110.56.8e-26
20Tri a gliadinAAA34274Go!291108.62.3e-25
21Tri a gliadinBAA11251Go!279102.61.4e-23
22Hor v 21P80198Go!28993.67.4e-21
23Tri a gluteninCAA31685Go!30793.49.0e-21
24Tri a gliadinAAA34272Go!30286.01.5e-18
25Tri a 36.0101AEH31546Go!36984.84.3e-18
26Tri a gliadinAAA34285Go!30483.67.8e-18
27Tri a gliadinAAA34288Go!25181.92.1e-17
28Tri a gluteninCAA30570Go!35681.05.5e-17
29Tri a gluteninCAA44473Go!28577.74.3e-16
30Tri a gluteninCAA59338Go!22977.15.6e-16
31Tri a gliadinAAA34287Go!24476.01.2e-15
32Tri a gluteninCAA36063Go!29575.71.8e-15
33Tri a gluteninCAA59340Go!27672.31.8e-14
34Tri a gliadinAAA34286Go!32365.52.4e-12
35Tri a gluteninCAA59339Go!26157.35.7e-10
36Tri a gluteninCAA31396Go!64845.74.3e-06
37Tri a gluteninCAA26847Go!66045.45.5e-06
38Tri a gluteninCAA27052Go!83845.09.1e-06
39Tri a gluteninCAA31395Go!83944.99.9e-06
40Tri a 26.0101P10388Go!83944.99.9e-06
41Tri a gluteninCAA43331Go!83042.94.0e-05
42Tri a gluteninAAB02788Go!81540.61.9e-04
43Tri a gluteninCAA43361Go!70538.47.4e-04
44Tri a gliadinCAA28208Go!15433.16.4e-03

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: AAA17741
Sequence identity: 100.00 (287/287)
Sequence 1 MKTFLILALLAIVATTATTAVRVPVPQLQPQNPSQQQPQEQVPLVQQQQF
           MKTFLILALLAIVATTATTAVRVPVPQLQPQNPSQQQPQEQVPLVQQQQF
Sequence 2 MKTFLILALLAIVATTATTAVRVPVPQLQPQNPSQQQPQEQVPLVQQQQF

Sequence 1 LGQQQPFPPQQPYPQPQPFPSQQPYLQLQPFLQPQLPYSQPQPFRPQQPY
           LGQQQPFPPQQPYPQPQPFPSQQPYLQLQPFLQPQLPYSQPQPFRPQQPY
Sequence 2 LGQQQPFPPQQPYPQPQPFPSQQPYLQLQPFLQPQLPYSQPQPFRPQQPY

Sequence 1 PQPQPQYSQPQQPISQQQQQQQQQQQQQQQQQQQIIQQILQQQLIPCMDV
           PQPQPQYSQPQQPISQQQQQQQQQQQQQQQQQQQIIQQILQQQLIPCMDV
Sequence 2 PQPQPQYSQPQQPISQQQQQQQQQQQQQQQQQQQIIQQILQQQLIPCMDV

Sequence 1 VLQQHNIVHGKSQVLQQSTYQLLQELCCQHLWQIPEQSQCQAIHNVVHAI
           VLQQHNIVHGKSQVLQQSTYQLLQELCCQHLWQIPEQSQCQAIHNVVHAI
Sequence 2 VLQQHNIVHGKSQVLQQSTYQLLQELCCQHLWQIPEQSQCQAIHNVVHAI

Sequence 1 ILHQQQKQQQQPSSQVSFQQPLQQYPLGQGSFRPSQQNPQAQGSVQPQQL
           ILHQQQKQQQQPSSQVSFQQPLQQYPLGQGSFRPSQQNPQAQGSVQPQQL
Sequence 2 ILHQQQKQQQQPSSQVSFQQPLQQYPLGQGSFRPSQQNPQAQGSVQPQQL

Sequence 1 PQFEEIRNLALQTLPAMCNVYIPPYCTIAPFGIFGTN
           PQFEEIRNLALQTLPAMCNVYIPPYCTIAPFGIFGTN
Sequence 2 PQFEEIRNLALQTLPAMCNVYIPPYCTIAPFGIFGTN



Alignment 2
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: AAA34280
Sequence identity: 97.21 (279/287)
Sequence 1 MKTFLILALLAIVATTATTAVRVPVPQLQPQNPSQQQPQEQVPLVQQQQF
           MKTFLIL-LLAIVATTATTAVR-PVPQLQPQNPSQQQPQEQVPLVQQQQF
Sequence 2 MKTFLILVLLAIVATTATTAVRFPVPQLQPQNPSQQQPQEQVPLVQQQQF

Sequence 1 LGQQQPFPPQQPYPQPQPFPSQQPYLQLQPFLQPQLPYSQPQPFRPQQPY
           LGQQQPFPPQQPYPQPQPFPSQ-PYLQLQPF-QPQLPYSQPQPFRPQQPY
Sequence 2 LGQQQPFPPQQPYPQPQPFPSQLPYLQLQPFPQPQLPYSQPQPFRPQQPY

Sequence 1 PQPQPQYSQPQQPISQQQQQQQQQQQQQQQQQQQIIQQILQQQLIPCMDV
           PQPQPQYSQPQQPISQQQQQQQQQQQQQQQQQQ-I-QQILQQQLIPCMDV
Sequence 2 PQPQPQYSQPQQPISQQQQQQQQQQQQQQQQQQ-ILQQILQQQLIPCMDV

Sequence 1 VLQQHNIVHGKSQVLQQSTYQLLQELCCQHLWQIPEQSQCQAIHNVVHAI
           VLQQHNI-HG-SQVLQQSTYQLLQELCCQHLWQIPEQSQCQAIHNVVHAI
Sequence 2 VLQQHNIAHGRSQVLQQSTYQLLQELCCQHLWQIPEQSQCQAIHNVVHAI

Sequence 1 ILHQQQKQQQQPSSQVSFQQPLQQYPLGQGSFRPSQQNPQAQGSVQPQQL
           ILHQQQKQQQQPSSQVSFQQPLQQYPLGQGSFRPSQQNPQAQGSVQPQQL
Sequence 2 ILHQQQKQQQQPSSQVSFQQPLQQYPLGQGSFRPSQQNPQAQGSVQPQQL

Sequence 1 PQFEEIRNLALQTLPAMCNVYIPPYCTIAPFGIFGTN
           PQFEEIRNLALQTLPAMCNVYIPPYCTIAPFGIFGTN
Sequence 2 PQFEEIRNLALQTLPAMCNVYIPPYCTIAPFGIFGTN



Alignment 3
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: CAA25261
Sequence identity: 96.86 (278/287)
Sequence 1 MKTFLILALLAIVATTATTAVRVPVPQLQPQNPSQQQPQEQVPLVQQQQF
           MKTFLIL-LLAIVATTATTAVR-PVPQLQPQNPSQQ-PQEQVPLVQQQQF
Sequence 2 MKTFLILVLLAIVATTATTAVRFPVPQLQPQNPSQQLPQEQVPLVQQQQF

Sequence 1 LGQQQPFPPQQPYPQPQPFPSQQPYLQLQPFLQPQLPYSQPQPFRPQQPY
           LGQQQPFPPQQPYPQPQPFPSQ-PYLQLQPF-QPQLPYSQPQPFRPQQPY
Sequence 2 LGQQQPFPPQQPYPQPQPFPSQLPYLQLQPFPQPQLPYSQPQPFRPQQPY

Sequence 1 PQPQPQYSQPQQPISQQQQQQQQQQQQQQQQQQQIIQQILQQQLIPCMDV
           PQPQPQYSQPQQPISQQQQQQQQQQQQQQQQQQ-I-QQILQQQLIPCMDV
Sequence 2 PQPQPQYSQPQQPISQQQQQQQQQQQQQQQQQQ-ILQQILQQQLIPCMDV

Sequence 1 VLQQHNIVHGKSQVLQQSTYQLLQELCCQHLWQIPEQSQCQAIHNVVHAI
           VLQQHNI-HG-SQVLQQSTYQLLQELCCQHLWQIPEQSQCQAIHNVVHAI
Sequence 2 VLQQHNIAHGRSQVLQQSTYQLLQELCCQHLWQIPEQSQCQAIHNVVHAI

Sequence 1 ILHQQQKQQQQPSSQVSFQQPLQQYPLGQGSFRPSQQNPQAQGSVQPQQL
           ILHQQQKQQQQPSSQVSFQQPLQQYPLGQGSFRPSQQNPQAQGSVQPQQL
Sequence 2 ILHQQQKQQQQPSSQVSFQQPLQQYPLGQGSFRPSQQNPQAQGSVQPQQL

Sequence 1 PQFEEIRNLALQTLPAMCNVYIPPYCTIAPFGIFGTN
           PQFEEIRNLALQTLPAMCNVYIPPYCTIAPFGIFGTN
Sequence 2 PQFEEIRNLALQTLPAMCNVYIPPYCTIAPFGIFGTN



Alignment 4
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: CAA26384
Sequence identity: 96.86 (278/287)
Sequence 1 MKTFLILALLAIVATTATTAVRVPVPQLQPQNPSQQQPQEQVPLVQQQQF
           MKTFLIL-LLAIVATTATTAVR-PVPQLQPQNPSQQQPQEQVPLVQQQQF
Sequence 2 MKTFLILVLLAIVATTATTAVRFPVPQLQPQNPSQQQPQEQVPLVQQQQF

Sequence 1 LGQQQPFPPQQPYPQPQPFPSQQPYLQLQPFLQPQLPYSQPQPFRPQQPY
           LGQQQPFPPQQPYPQPQPFPSQ-PYLQLQPF-QPQLPYSQPQ-FRPQQPY
Sequence 2 LGQQQPFPPQQPYPQPQPFPSQLPYLQLQPFPQPQLPYSQPQQFRPQQPY

Sequence 1 PQPQPQYSQPQQPISQQQQQQQQQQQQQQQQQQQIIQQILQQQLIPCMDV
           PQPQPQYSQPQQPISQQQQQQQQQQQQQQQQQQ-I-QQILQQQLIPCMDV
Sequence 2 PQPQPQYSQPQQPISQQQQQQQQQQQQQQQQQQ-ILQQILQQQLIPCMDV

Sequence 1 VLQQHNIVHGKSQVLQQSTYQLLQELCCQHLWQIPEQSQCQAIHNVVHAI
           VLQQHNI-HG-SQVLQQSTYQLLQELCCQHLWQIPEQSQCQAIHNVVHAI
Sequence 2 VLQQHNIAHGRSQVLQQSTYQLLQELCCQHLWQIPEQSQCQAIHNVVHAI

Sequence 1 ILHQQQKQQQQPSSQVSFQQPLQQYPLGQGSFRPSQQNPQAQGSVQPQQL
           ILHQQQKQQQQPSSQVSFQQPLQQYPLGQGSFRPSQQNPQAQGSVQPQQL
Sequence 2 ILHQQQKQQQQPSSQVSFQQPLQQYPLGQGSFRPSQQNPQAQGSVQPQQL

Sequence 1 PQFEEIRNLALQTLPAMCNVYIPPYCTIAPFGIFGTN
           PQFEEIRNLALQTLPAMCNVYIPPYCTIAPFGIFGTN
Sequence 2 PQFEEIRNLALQTLPAMCNVYIPPYCTIAPFGIFGTN



Alignment 5
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: CAA25593
Sequence identity: 96.52 (277/287)
Sequence 1 MKTFLILALLAIVATTATTAVRVPVPQLQPQNPSQQQPQEQVPLVQQQQF
           MKTFLIL-LLAIVATTATTAVR-PVPQLQPQNPSQQQPQEQVPLVQQQQF
Sequence 2 MKTFLILVLLAIVATTATTAVRFPVPQLQPQNPSQQQPQEQVPLVQQQQF

Sequence 1 LGQQQPFPPQQPYPQPQPFPSQQPYLQLQPFLQPQLPYSQPQPFRPQQPY
           LGQQQPFPPQQPYPQPQPFPSQ-PYLQLQPF-QPQLPYSQPQPFRPQQPY
Sequence 2 LGQQQPFPPQQPYPQPQPFPSQLPYLQLQPFPQPQLPYSQPQPFRPQQPY

Sequence 1 PQPQPQYSQPQQPISQQQQQQQQQQQQQQQQQQQIIQQILQQQLIPCMDV
           PQPQPQYSQPQQPISQQQQQQQQQQQQQQQQQQ-I-QQILQQQLIPCMDV
Sequence 2 PQPQPQYSQPQQPISQQQQQQQQQQQQQQQQQQ-ILQQILQQQLIPCMDV

Sequence 1 VLQQHNIVHGKSQVLQQSTYQLLQELCCQHLWQIPEQSQCQAIHNVVHAI
           VLQQHNI-HG-SQVLQQSTYQLLQELCCQHLWQIPEQSQCQAI--VVHAI
Sequence 2 VLQQHNIAHGRSQVLQQSTYQLLQELCCQHLWQIPEQSQCQAILKVVHAI

Sequence 1 ILHQQQKQQQQPSSQVSFQQPLQQYPLGQGSFRPSQQNPQAQGSVQPQQL
           ILHQQQKQQQQPSSQVSFQQPLQQYPLGQGSFRPSQQNPQAQGSVQPQQL
Sequence 2 ILHQQQKQQQQPSSQVSFQQPLQQYPLGQGSFRPSQQNPQAQGSVQPQQL

Sequence 1 PQFEEIRNLALQTLPAMCNVYIPPYCTIAPFGIFGTN
           PQFEEIRNLALQTLPAMCNVYIPPYCTIAPFGIFGTN
Sequence 2 PQFEEIRNLALQTLPAMCNVYIPPYCTIAPFGIFGTN



Alignment 6
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: AAA34281
Sequence identity: 90.59 (260/287)
Sequence 1 MKTFLILALLAIVATTATTAVRVPVPQLQPQNPSQQQPQEQVPLVQQQQF
           MKTFLILALLAIVATTATTAVRVPVPQLQPQNPSQQQPQEQVPLVQQQQF
Sequence 2 MKTFLILALLAIVATTATTAVRVPVPQLQPQNPSQQQPQEQVPLVQQQQF

Sequence 1 LGQQQPFPPQQPYPQPQPFPSQQPYLQLQPFLQPQLPYSQPQPFRPQQPY
           LGQQQPFPPQQPYPQPQPFPSQQPYLQLQPFLQPQLPYSQPQPFRPQQPY
Sequence 2 LGQQQPFPPQQPYPQPQPFPSQQPYLQLQPFLQPQLPYSQPQPFRPQQPY

Sequence 1 PQPQPQYSQPQQPISQQQQQQQQQQQQQQQQQQQIIQQILQQQLIPCMDV
           PQPQPQYSQPQQPISQQQQQQQQQQQQQQQQQQQIIQQILQQQLIPCMDV
Sequence 2 PQPQPQYSQPQQPISQQQQQQQQQQQQQQQQQQQIIQQILQQQLIPCMDV

Sequence 1 VLQQHNIVHGKSQVLQQSTYQLLQELCCQHLWQIPEQSQCQAIHNVVHAI
           VLQQHNIVHGKSQVLQQSTYQLLQELCCQHLWQIPEQSQCQAIHNVVHAI
Sequence 2 VLQQHNIVHGKSQVLQQSTYQLLQELCCQHLWQIPEQSQCQAIHNVVHAI

Sequence 1 ILHQQQKQQQQPSSQVSFQQPLQQYPLGQGSFRPSQQNPQAQGSVQPQQL
           ILHQQQKQQQQPSSQVSFQQPLQQYPLGQGSFRPSQQNPQAQGSVQPQQL
Sequence 2 ILHQQQKQQQQPSSQVSFQQPLQQYPLGQGSFRPSQQNPQAQGSVQPQQL

Sequence 1 PQFEEIRNLALQTLPAMCNVYIPPYCTIAPFGIFGTN
           PQFEEIRNLA---------------------------
Sequence 2 PQFEEIRNLARK-------------------------



Alignment 7
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: AAA34276
Sequence identity: 90.94 (261/287)
Sequence 1 MKTFLILALLAIVATTATTAVRVPVPQLQPQNPSQQQPQEQVPLVQQQQF
           MKTF-ILALLAIVATTATTAVRVPVPQLQ-QNPSQQQPQEQVPLVQ-QQF
Sequence 2 MKTFPILALLAIVATTATTAVRVPVPQLQLQNPSQQQPQEQVPLVQEQQF

Sequence 1 LGQQQPFPPQQPYPQPQPFPSQQPYLQLQPFLQPQLPYSQPQPFRPQQPY
           -GQQQPFPPQQPYPQPQPFPSQQPYLQLQPF-QPQLPY-QPQPFRPQQPY
Sequence 2 QGQQQPFPPQQPYPQPQPFPSQQPYLQLQPFPQPQLPYPQPQPFRPQQPY

Sequence 1 PQPQPQYSQPQQPISQQQQQQQQQQQQQQQQQQQIIQQILQQQLIPCMDV
           PQPQPQYSQPQQPISQQQQQQQQQQQQQQQ----I-QQILQQQLIPC-DV
Sequence 2 PQPQPQYSQPQQPISQQQQQQQQQQQQQQQ----ILQQILQQQLIPCRDV

Sequence 1 VLQQHNIVHGKSQVLQQSTYQLLQELCCQHLWQIPEQSQCQAIHNVVHAI
           VLQQHNI-HG-SQVLQ-STYQL-Q-LCCQ-LWQIPEQS-CQAIHNVVHAI
Sequence 2 VLQQHNIAHGSSQVLQESTYQLVQQLCCQQLWQIPEQSRCQAIHNVVHAI

Sequence 1 ILHQ--------QQKQQQQPSSQVSFQQPLQQYPLGQGSFRPSQQNPQAQ
           ILHQ--------QQ-QQQQP-SQVSFQQP-QQYP-GQG-F-PSQQNPQAQ
Sequence 2 ILHQQHHHHQQQQQQQQQQPLSQVSFQQPQQQYPSGQGFFQPSQQNPQAQ

Sequence 1 GSVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCTIAPFGIFGTN
           GS-QPQQLPQFEEIRNLALQTLPAMCNVYIPPYCTIAPFGIFGTN
Sequence 2 GSFQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCTIAPFGIFGTN



Alignment 8
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: CAA26383
Sequence identity: 90.59 (260/287)
Sequence 1 MKTFLILALLAIVATTATTAVRVPVPQLQPQNPSQQQPQEQVPLVQQQQF
           MKTFLILALLAIVATTATTAVRVPVPQ-QPQNPSQ-QPQ-QVPLVQQQQF
Sequence 2 MKTFLILALLAIVATTATTAVRVPVPQPQPQNPSQPQPQGQVPLVQQQQF

Sequence 1 LGQQQPFPPQQPYPQPQPFPSQQPYLQLQPFLQPQ-----LPYSQPQPFR
           -GQQQ-FPPQQPYPQPQPFPSQQPYLQLQPF-QPQ-----LPY-QP-PF-
Sequence 2 PGQQQQFPPQQPYPQPQPFPSQQPYLQLQPFPQPQPFPPQLPYPQPPPFS

Sequence 1 PQQPYPQPQPQYSQPQQPISQ---QQQQQQQQQQQQQQQQQQIIQQILQQ
           PQQPYPQPQPQY-QPQQPISQ---QQQQQQQQQQQQQQQQQQI-QQILQQ
Sequence 2 PQQPYPQPQPQYPQPQQPISQQQAQQQQQQQQQQQQQQQQQQILQQILQQ

Sequence 1 QLIPCMDVVLQQHNIVHGKSQVLQQSTYQLLQELCCQHLWQIPEQSQCQA
           QLIPC-DVVLQQHNI-H--SQVLQQSTYQ-LQ-LCCQ-LWQIPEQS-CQA
Sequence 2 QLIPCRDVVLQQHNIAHARSQVLQQSTYQPLQQLCCQQLWQIPEQSRCQA

Sequence 1 IHNVVHAIILHQQQKQQQQPSSQVSFQQPLQQYPLGQGSFRPSQQNPQAQ
           IHNVVHAIILHQQQ-QQQ-PSSQVS-QQP-QQYP-GQG-F-PSQQNPQAQ
Sequence 2 IHNVVHAIILHQQQRQQQ-PSSQVSLQQPQQQYPSGQGFFQPSQQNPQAQ

Sequence 1 GSVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYC--TIAPFGIFGTN
           GSVQPQQLPQFEEIRNLALQTLP-MCNVYIPPYC--TIAPFGIFGTN
Sequence 2 GSVQPQQLPQFEEIRNLALQTLPRMCNVYIPPYCSTTIAPFGIFGTN



Alignment 9
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: AAA34290
Sequence identity: 90.24 (259/287)
Sequence 1 MKTFLILALLAIVATTATTAVRVPVPQLQPQNPSQQQPQEQVPLVQQQQF
           MKTFLILALLAIVATTATTAVRVPVPQ-QPQNPSQ-QPQ-QVPLVQQQQF
Sequence 2 MKTFLILALLAIVATTATTAVRVPVPQPQPQNPSQPQPQRQVPLVQQQQF

Sequence 1 LGQQQPFPPQQPYPQPQPFPSQQPYLQLQPFLQPQ-----LPYSQPQPFR
           -GQQQ-FPPQQPYPQPQPFPSQQPYLQLQPF-QPQ-----LPY-QP-PF-
Sequence 2 PGQQQQFPPQQPYPQPQPFPSQQPYLQLQPFPQPQPFPPQLPYPQPPPFS

Sequence 1 PQQPYPQPQPQYSQPQQPISQ---QQQQQQQQQQQQQQQQQQIIQQILQQ
           PQQPYPQPQPQY-QPQQPISQ---QQQQQQQQQQQQQQQQQQI--QILQQ
Sequence 2 PQQPYPQPQPQYPQPQQPISQQQAQQQQQQQQQQQQQQQQQQILPQILQQ

Sequence 1 QLIPCMDVVLQQHNIVHGKSQVLQQSTYQLLQELCCQHLWQIPEQSQCQA
           QLIPC-DVVLQQHNI-H--SQVLQQSTYQ-LQ-LCCQ-LWQIPEQS-CQA
Sequence 2 QLIPCRDVVLQQHNIAHARSQVLQQSTYQPLQQLCCQQLWQIPEQSRCQA

Sequence 1 IHNVVHAIILHQQQKQQQQPSSQVSFQQPLQQYPLGQGSFRPSQQNPQAQ
           IHNVVHAIILHQQQ-QQQQPSSQVS-QQP-QQYP-GQG-F-PSQQNPQAQ
Sequence 2 IHNVVHAIILHQQQ-QQQQPSSQVSLQQPQQQYPSGQGFFQPSQQNPQAQ

Sequence 1 GSVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYC--TIAPFGIFGTN
           GSVQPQQLPQFEEIRNLALQTLP-MCNVYIPPYC--T-APFGIFGTN
Sequence 2 GSVQPQQLPQFEEIRNLALQTLPRMCNVYIPPYCSTTTAPFGIFGTN



Alignment 10
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: AAA34283
Sequence identity: 83.97 (241/287)
Sequence 1 MKTFLILALLAIVATTATTAVRVPVPQLQPQNPSQQQPQEQVPLVQQQQ-
           MKTFLILALLAIVATTAT-AVRVPVPQLQPQNPSQQQPQEQVPL-QQQQ-
Sequence 2 MKTFLILALLAIVATTATSAVRVPVPQLQPQNPSQQQPQEQVPLMQQQQQ

Sequence 1 FLGQQQPFPPQQPYPQPQPFPSQQPYLQLQPFLQPQLPYSQPQPFRPQQP
           F-GQQ--FPPQQPYP--QPFPSQQPY-Q-QPF--PQLPY-Q-QPF-PQQP
Sequence 2 FPGQQEQFPPQQPYPHQQPFPSQQPYPQPQPF-PPQLPYPQTQPFPPQQP

Sequence 1 YPQPQPQYSQPQQPISQQQQQQQQQQQQQQQQQQQIIQQILQQQLIPCMD
           YPQPQPQY-QPQQPISQQQ-QQQQQQQQ---------QQILQQQLIPC-D
Sequence 2 YPQPQPQYPQPQQPISQQQAQQQQQQQQT-------LQQILQQQLIPCRD

Sequence 1 VVLQQHNIVHGKSQVLQQSTYQLLQELCCQHLWQIPEQSQCQAIHNVVHA
           VVLQQHNI-H--SQVLQQS-YQ-LQ-LCCQ-L-QIPEQS-CQAIHNVVHA
Sequence 2 VVLQQHNIAHASSQVLQQSSYQQLQQLCCQQLFQIPEQSRCQAIHNVVHA

Sequence 1 IILHQQQKQQQQPSSQVSFQQPLQQYPLGQGSFRPSQQNPQAQGSVQPQQ
           IILH--Q-QQQQPSSQVS-QQP--QYP-GQ-SF--SQQNPQAQGSVQPQQ
Sequence 2 IILHHHQQQQQQPSSQVSYQQPQEQYPSGQVSFQSSQQNPQAQGSVQPQQ

Sequence 1 LPQFEEIRNLALQTLPAMCNVYIPPYC--TIAPFGIFGTN
           LPQF-EIRNLALQTLPAMCNVYIPPYC--TIAPFGIFGTN
Sequence 2 LPQFQEIRNLALQTLPAMCNVYIPPYCSTTIAPFGIFGTN



Alignment 11
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: AAA34282
Sequence identity: 88.85 (255/287)
Sequence 1 MKTFLILALLAIVATTATTAVRVPVPQLQPQNPSQQQPQEQVPLVQQQQF
           MKTFLILAL-AIVATTAT-AVRVPVPQLQPQNPSQQQPQ-QVPLVQQQQF
Sequence 2 MKTFLILALRAIVATTATIAVRVPVPQLQPQNPSQQQPQKQVPLVQQQQF

Sequence 1 LGQQQPFPPQQPYPQPQPFPSQQPYLQLQPFLQPQLPYSQPQ-------P
           -GQQQPFPPQQPYPQ-QPFPSQQPY-QLQPF-QPQLPY-QPQ-------P
Sequence 2 PGQQQPFPPQQPYPQQQPFPSQQPYMQLQPFPQPQLPYPQPQLPYPQPQP

Sequence 1 FRPQQPYPQPQPQYSQPQQPISQQQQQQQQQQQQQQQQQQQIIQQILQQQ
           FRPQQ-YPQPQPQYSQPQQPISQQQQQQQQQQQQQQQ----I-QQILQQQ
Sequence 2 FRPQQSYPQPQPQYSQPQQPISQQQQQQQQQQQQQQQ----ILQQILQQQ

Sequence 1 LIPCMDVVLQQHNIVHGKSQVLQQSTYQLLQELCCQHLWQIPEQSQCQAI
           LIPC-DVVLQQH-I-HG-SQVLQQSTYQL-Q--CCQ-LWQIPEQS-CQAI
Sequence 2 LIPCRDVVLQQHSIAHGSSQVLQQSTYQLVQQFCCQQLWQIPEQSRCQAI

Sequence 1 HNVVHAIILHQQQKQQQQ-------PSSQVSFQQPLQQYPLGQGSFRPSQ
           HNVVHAIILHQQQ-QQQQ-------P-SQV-FQQ--QQYP-GQGSF-PSQ
Sequence 2 HNVVHAIILHQQQQQQQQQQQQQQQPLSQVCFQQSQQQYPSGQGSFQPSQ

Sequence 1 QNPQAQGSVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCTIAPFGIFGT
           QNPQAQGSVQPQQLPQFEEIRNLAL-TLPAMCNVYIPPYCTIAP-GIFGT
Sequence 2 QNPQAQGSVQPQQLPQFEEIRNLALETLPAMCNVYIPPYCTIAPVGIFGT

Sequence 1 N
           N
Sequence 2 N



Alignment 12
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: AAA34275
Sequence identity: 89.90 (258/287)
Sequence 1 MKTFLILALLAIVATTATTAVRVPVPQLQPQNPSQQQPQEQVPLVQQQQF
           MKTFLILALLAIVATTATTAVRVPVPQLQPQNPSQQQPQEQVPLVQQQQF
Sequence 2 MKTFLILALLAIVATTATTAVRVPVPQLQPQNPSQQQPQEQVPLVQQQQF

Sequence 1 LGQQQPFPPQQPYPQPQPFPSQQPYLQLQPFLQPQ----LPYSQPQPFRP
           -GQQQ-FPPQQPYPQPQPFPSQQPYLQLQPF-QPQ----LPY-QPQ-F-P
Sequence 2 PGQQQQFPPQQPYPQPQPFPSQQPYLQLQPFPQPQPFPPLPYPQPQSFPP

Sequence 1 QQPYPQPQPQYSQPQQPISQQQQQQQQQQQQQQQQQQQIIQQILQQQLIP
           QQPYPQ-QPQY-QPQQPISQQQ-QQQQQQQQQQQQQQQI-QQILQQQLIP
Sequence 2 QQPYPQQQPQYLQPQQPISQQQAQQQQQQQQQQQQQQQILQQILQQQLIP

Sequence 1 CMDVVLQQHNIVHGKSQVLQQSTYQLLQELCCQHLWQIPEQSQCQAIHNV
           C-DVVLQQHNI-H--SQVLQQSTYQLLQ-LCCQ-L-QIPEQSQCQAIHNV
Sequence 2 CRDVVLQQHNIAHASSQVLQQSTYQLLQQLCCQQLLQIPEQSQCQAIHNV

Sequence 1 VHAIILHQQQKQQ-------------------------QQPSSQVSFQQP
           -HAII-HQQQ-QQ-------------------------QQPSSQVSFQQP
Sequence 2 AHAIIMHQQQQQQQEQKQQLQQQQQQQQQLQQQQQQQQQQPSSQVSFQQP

Sequence 1 LQQYPLGQGSFRPSQQNPQAQGSVQPQQLPQFEEIRNLALQTLPAMCNVY
           -QQYP--Q-SF-PSQ-NPQAQGSVQPQQLPQF-EIRNLALQTLPAMCNVY
Sequence 2 QQQYPSSQVSFQPSQLNPQAQGSVQPQQLPQFAEIRNLALQTLPAMCNVY

Sequence 1 IPPYC--TIAPFGIFGTN
           IPP-C--TIAPFGI-GTN
Sequence 2 IPPHCSTTIAPFGISGTN



Alignment 13
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: AAA34278
Sequence identity: 89.90 (258/287)
Sequence 1 MKTFLILALLAIVATTATTAVRVPVPQLQPQNPSQQQPQEQVPLVQQQQF
           MKTFLILALLAIVATTATTAVRVPVPQLQPQNPSQQQPQEQVPLVQQQQF
Sequence 2 MKTFLILALLAIVATTATTAVRVPVPQLQPQNPSQQQPQEQVPLVQQQQF

Sequence 1 LGQQQPFPPQQPYPQPQPFPSQQPYLQLQPFLQP-----QLPYSQPQPFR
           -GQQQ-FPPQQPYPQPQPFPSQQPYLQLQPF-QP-----QLPY-QPQ-F-
Sequence 2 PGQQQQFPPQQPYPQPQPFPSQQPYLQLQPFPQPQPFPPQLPYPQPQSFP

Sequence 1 PQQPYPQPQPQYSQPQQPISQQQQQQQQQQQQQQQQQQQIIQQILQQQLI
           PQQPYPQ-QPQY-QPQQPISQQQ-QQQQQQQQQQQQQQQI-QQILQQQLI
Sequence 2 PQQPYPQQQPQYLQPQQPISQQQAQQQQQQQQQQQQQQQILQQILQQQLI

Sequence 1 PCMDVVLQQHNIVHGKSQVLQQSTYQLLQELCCQHLWQIPEQSQCQAIHN
           PC-DVVLQQHNI-H--SQVLQQSTYQLLQ-LCCQ-L-QIPEQSQCQAIHN
Sequence 2 PCRDVVLQQHNIAHASSQVLQQSTYQLLQQLCCQQLLQIPEQSQCQAIHN

Sequence 1 VVHAIILHQQQKQQ-------------------------QQPSSQVSFQQ
           V-HAII-HQQQ-QQ-------------------------QQPSSQVSFQQ
Sequence 2 VAHAIIMHQQQQQQQEQKQQLQQQQQQQQQLQQQQQQQQQQPSSQVSFQQ

Sequence 1 PLQQYPLGQGSFRPSQQNPQAQGSVQPQQLPQFEEIRNLALQTLPAMCNV
           P-QQYP--Q-SF-PSQ-NPQAQGSVQPQQLPQF-EIRNLALQTLPAMCNV
Sequence 2 PQQQYPSSQVSFQPSQLNPQAQGSVQPQQLPQFAEIRNLALQTLPAMCNV

Sequence 1 YIPPYC--TIAPFGIFGTN
           YIPP-C--TIAPFGI-GTN
Sequence 2 YIPPHCSTTIAPFGISGTN



Alignment 14
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: AAA34279
Sequence identity: 89.20 (256/287)
Sequence 1 MKTFLILALLAIVATTATTAVRVPVPQLQPQNPSQQQPQEQVPLVQQQQF
           MKTFLILAL---VATTATTAVRVPVPQLQP-NPSQQQPQEQVPLVQQQQF
Sequence 2 MKTFLILAL---VATTATTAVRVPVPQLQPKNPSQQQPQEQVPLVQQQQF

Sequence 1 LGQQQPFPPQQPYPQPQPFPSQQPYLQLQPFLQPQ-----LPYSQPQPFR
           -GQQQ-FPPQQPYPQPQPFPSQQPYLQLQPF-QPQ-----LPY-QPQ-F-
Sequence 2 PGQQQQFPPQQPYPQPQPFPSQQPYLQLQPFPQPQPFLPQLPYPQPQSFP

Sequence 1 PQQPYPQPQPQYSQPQQPISQQ--QQQQQQQQQQQQQQQQQIIQQILQQQ
           PQQPYPQ--P-Y-QPQQPISQQ--QQQQQQQQQQQQQQQQQI-QQILQQQ
Sequence 2 PQQPYPQQRPKYLQPQQPISQQQAQQQQQQQQQQQQQQQQQILQQILQQQ

Sequence 1 LIPCMDVVLQQHNIVHGKSQVLQQSTYQLLQELCCQHLWQIPEQSQCQAI
           LIPC-DVVLQQHNI-H--SQVLQQSTYQLLQ-LCCQ-L-QIPEQS-CQAI
Sequence 2 LIPCRDVVLQQHNIAHASSQVLQQSTYQLLQQLCCQQLLQIPEQSRCQAI

Sequence 1 HNVVHAIILHQQ--------------------QKQQQQPSSQVSFQQPLQ
           HNVVHAII-HQQ--------------------Q-QQQQPSSQVSFQQP-Q
Sequence 2 HNVVHAIIMHQQEQQQQLQQQQQQQLQQQQQQQQQQQQPSSQVSFQQPQQ

Sequence 1 QYPLGQGSFRPSQQNPQAQGSVQPQQLPQFEEIRNLALQTLPAMCNVYIP
           QYP--QGSF-PSQQNPQAQGSVQPQQLPQF-EIRNLALQTLPAMCNVYIP
Sequence 2 QYPSSQGSFQPSQQNPQAQGSVQPQQLPQFAEIRNLALQTLPAMCNVYIP

Sequence 1 PYC--TIAPFGIFGTN
           P-C--TIAPFGIFGTN
Sequence 2 PHCSTTIAPFGIFGTN



Alignment 15
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: CAA26385
Sequence identity: 89.20 (256/287)
Sequence 1 MKTFLILALLAIVATTATTAVRVPVPQLQPQNPSQQQPQEQVPLVQQQQF
           MKTFLILAL---VATTATTAVRVPVPQLQP-NPSQQQPQEQVPLVQQQQF
Sequence 2 MKTFLILAL---VATTATTAVRVPVPQLQPKNPSQQQPQEQVPLVQQQQF

Sequence 1 LGQQQPFPPQQPYPQPQPFPSQQPYLQLQPFLQPQ-----LPYSQPQPFR
           -GQQQ-FPPQQPYPQPQPFPSQQPYLQLQPF-QPQ-----LPY-QPQ-F-
Sequence 2 PGQQQQFPPQQPYPQPQPFPSQQPYLQLQPFPQPQPFLPQLPYPQPQSFP

Sequence 1 PQQPYPQPQPQYSQPQQPISQQ--QQQQQQQQQQQQQQQQQIIQQILQQQ
           PQQPYPQ--P-Y-QPQQPISQQ--QQQQQQQQQQQQQQQQQI-QQILQQQ
Sequence 2 PQQPYPQQRPMYLQPQQPISQQQAQQQQQQQQQQQQQQQQQILQQILQQQ

Sequence 1 LIPCMDVVLQQHNIVHGKSQVLQQSTYQLLQELCCQHLWQIPEQSQCQAI
           LIPC-DVVLQQHNI-H--SQVLQQSTYQLLQ-LCCQ-L-QIPEQS-CQAI
Sequence 2 LIPCRDVVLQQHNIAHASSQVLQQSTYQLLQQLCCQQLLQIPEQSRCQAI

Sequence 1 HNVVHAIILHQQ--------------------QKQQQQPSSQVSFQQPLQ
           HNVVHAII-HQQ--------------------Q-QQQQPSSQVSFQQP-Q
Sequence 2 HNVVHAIIMHQQEQQQQLQQQQQQQLQQQQQQQQQQQQPSSQVSFQQPQQ

Sequence 1 QYPLGQGSFRPSQQNPQAQGSVQPQQLPQFEEIRNLALQTLPAMCNVYIP
           QYP--QGSF-PSQQNPQAQGSVQPQQLPQF-EIRNLALQTLPAMCNVYIP
Sequence 2 QYPSSQGSFQPSQQNPQAQGSVQPQQLPQFAEIRNLALQTLPAMCNVYIP

Sequence 1 PYC--TIAPFGIFGTN
           P-C--TIAPFGIFGTN
Sequence 2 PHCSTTIAPFGIFGTN



Alignment 16
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: AAA34284
Sequence identity: 62.72 (180/287)
Sequence 1 MKTFLILALLAIVATTATTAVRVPVPQLQPQNPSQQQPQEQVPLVQQQQF
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LGQQQPFPPQQPYPQPQPFPSQQPYLQLQPFLQPQLPYSQPQPFRPQQPY
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PQPQPQYSQPQQPISQQQQQQQQQQQQQQQQQQQIIQQILQQQLIPCMDV
           PQPQPQYSQPQQPISQQQQQQQQQQQQQQQ-QQ-I-QQILQQQLIPCMDV
Sequence 2 PQPQPQYSQPQQPISQQQQQQQQQQQQQQQEQQ-ILQQILQQQLIPCMDV

Sequence 1 VLQQHNIVHGKSQVLQQSTYQLLQELCCQHLWQIPEQSQCQAIHNVVHAI
           VLQQHNI-HG-SQVLQQSTYQLLQELCCQHLWQIPEQSQCQAIHNVVHAI
Sequence 2 VLQQHNIAHGRSQVLQQSTYQLLQELCCQHLWQIPEQSQCQAIHNVVHAI

Sequence 1 ILHQQQ-KQQQQPSSQVSFQQPLQQYPLGQGSFRPSQQNPQAQGSVQPQQ
           ILHQQQ-KQQQQPSSQ-SFQQPLQQYPLGQGSFRPSQQNPQAQGSVQPQQ
Sequence 2 ILHQQQQKQQQQPSSQFSFQQPLQQYPLGQGSFRPSQQNPQAQGSVQPQQ

Sequence 1 LPQFEEIRNLALQTLPAMCNVYIPPYCTIAPFGIFGTN
           LPQFE-IRNLALQTLPAMCNVYIPPYCTIAPFGIFGTN
Sequence 2 LPQFE-IRNLALQTLPAMCNVYIPPYCTIAPFGIFGTN



Alignment 17
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: CAA35238
Sequence identity: 91.99 (264/287)
Sequence 1 MKTFLILALLAIVATTATTAVRVPVPQLQPQNPSQQQPQEQVPLVQQQQF
           MKTFLILALLAIVATTA--AVRVPVPQLQPQNPSQQQPQEQVPLVQQQQF
Sequence 2 MKTFLILALLAIVATTARIAVRVPVPQLQPQNPSQQQPQEQVPLVQQQQF

Sequence 1 LGQQQPFPPQQPYPQPQPFPSQQPYLQLQPF--------------LQPQL
           -GQQQPFPPQQPYPQPQPFPSQQPYLQLQPF---------------QPQL
Sequence 2 PGQQQPFPPQQPYPQPQPFPSQQPYLQLQPFPQPQLPYPQPQLPYPQPQL

Sequence 1 PYSQPQPFRPQQPYPQPQPQYSQPQQPISQQQQQQQQQQQQ--QQQQQQQ
           PY-QPQPFRPQQPYPQ-QPQYSQPQQPISQQQQQQQQQQQQ--QQQQQQQ
Sequence 2 PYPQPQPFRPQQPYPQSQPQYSQPQQPISQQQQQQQQQQQQKQQQQQQQQ

Sequence 1 IIQQILQQQLIPCMDVVLQQHNIVHGKSQVLQQSTYQLLQELCCQHLWQI
           I-QQILQQQLIPC-DVVLQQH-I--G-SQVLQQSTYQL-Q-LCCQ-LWQI
Sequence 2 ILQQILQQQLIPCRDVVLQQHSIAYGSSQVLQQSTYQLVQQLCCQQLWQI

Sequence 1 PEQSQCQAIHNVVHAIILHQQQKQQQ----QPSSQVSFQQPLQQYPLGQG
           PEQS-CQAIHNVVHAIILHQQQ-QQQ----QP-SQVSFQQP-QQYP-GQG
Sequence 2 PEQSRCQAIHNVVHAIILHQQQQQQQQQQQQPLSQVSFQQPQQQYPSGQG

Sequence 1 SFRPSQQNPQAQGSVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCTIAP
           SF-PSQQNPQAQGSVQPQQLPQFEEIRNLAL-TLPAMCNVYIPPYCTIAP
Sequence 2 SFQPSQQNPQAQGSVQPQQLPQFEEIRNLALETLPAMCNVYIPPYCTIAP

Sequence 1 FGIFGTN
           -GIFGTN
Sequence 2 VGIFGTN



Alignment 18
Sequence 1:
Sequence 2: Allergen Tri a 21.0101, Sequence: CAY54134
Sequence identity: 79.09 (227/287)
Sequence 1 MKTFLILALLAIVATTATTAVRVPVPQLQPQNPSQQQPQEQVPLVQQQQF
           --------------------VRVPVPQLQPQNPSQQQPQEQVPLVQQQQF
Sequence 2 --------------------VRVPVPQLQPQNPSQQQPQEQVPLVQQQQF

Sequence 1 LGQQQP-FPPQQPYPQPQPFPSQQPYLQLQPFLQPQLPYSQPQPFRPQQP
           LGQQQ--FP-QQ-----QPFP-QQPY-Q-QPFL-PQLPY-QPQPF-PQQ-
Sequence 2 LGQQQQHFPGQQ-----QPFPPQQPYPQPQPFL-PQLPYPQPQPFPPQQS

Sequence 1 YPQPQPQYSQPQQPISQQQQQQQQQQQQQQQQQQQIIQQILQQQLIPCMD
           YPQPQPQY-QPQQPISQQQ-Q-QQQQQQQQQQ---I-QQILQQQLIPC-D
Sequence 2 YPQPQPQYPQPQQPISQQQAQLQQQQQQQQQQ---ILQQILQQQLIPCRD

Sequence 1 VVLQQHNIVHGKSQVLQQSTYQLLQELCCQHLWQIPEQSQCQAIHNVVHA
           VVLQQ-NI-H--SQV-QQS-YQLLQ-LCCQ-LWQ-PEQS-CQAIHNV-HA
Sequence 2 VVLQQPNIAHASSQVSQQS-YQLLQQLCCQQLWQTPEQSRCQAIHNVIHA

Sequence 1 IILH---------------------QQQKQQQQPSSQVSFQQPLQQYPLG
           IILH---------------------QQQ-QQQQPSSQVS-QQP-QQYP-G
Sequence 2 IILHHQQQQQQQQQQQQQQQQQQQQQQQQQQQQPSSQVSYQQPQQQYPSG

Sequence 1 QGSFRPSQQNPQAQGSVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYC--
           QGSF-PSQQNPQAQG-VQPQQLPQFEEIRNLALQTLPAMCNVYIPPYC--
Sequence 2 QGSFQPSQQNPQAQGFVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCST

Sequence 1 TIAPFGIFGTN
           TIAPFGIF-TN
Sequence 2 TIAPFGIFSTN



Alignment 19
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: AAA34289
Sequence identity: 57.14 (164/287)
Sequence 1 MKTFLILALLAIVATTATTAVRV-P-----------VPQLQ------PQ-
           MKT-LIL--LA---T--T----V-P-----------VPQLQ------PQ-
Sequence 2 MKTLLILTILAMAITIGTANIQVDPSGQVQWLQQQLVPQLQQPLSQQPQQ

Sequence 1 ---NPSQ---QQPQEQVPLVQQQQ--FLGQQQPFP--PQQPYPQ---PQ-
           ----P-Q----QPQ-QVP--QQ-Q--FL--QQPFP--PQQP-PQ---PQ-
Sequence 2 TFPQPQQTFPHQPQQQVPQPQQPQQPFLQPQQPFPQQPQQPFPQTQQPQQ

Sequence 1 PFPSQQPYLQLQPFLQPQLPYSQPQPFRPQQPYPQ---PQ---PQYSQPQ
           PFP-QQP----QPF-Q-Q-P--QP-P--PQQP-PQ---PQ---PQ--QPQ
Sequence 2 PFP-QQPQ---QPFPQTQQP-QQPFPQQPQQPFPQTQQPQQPFPQLQQPQ

Sequence 1 QPISQQQQQQQQQQQQQQ---QQQQQIIQQILQQQLIPCMDVVLQQHN--
           QP--Q-QQQ--Q-QQ-QQ---QQQ---IQ--LQQQL-PC----LQQ----
Sequence 2 QPFPQPQQQLPQPQQPQQSFPQQQRPFIQPSLQQQLNPCKNILLQQSKPA

Sequence 1 --IVHGKSQVLQQSTYQLLQELCCQHLWQIPEQSQCQAIHNVVHAIILHQ
           -------S----QS--Q-----CCQ-L-QIP-Q-QC-AIH-VVH-II--Q
Sequence 2 SLVSSLWSIIWPQSDCQVMRQQCCQQLAQIPQQLQCAAIHSVVHSIIMQQ

Sequence 1 QQKQQQQPSSQVSFQQPLQQYP-LGQGSFRPSQQNPQAQGSVQPQQLPQF
           QQ-QQQQ---------PL-Q----GQGS--------Q-QG--QPQQ--Q-
Sequence 2 QQQQQQQQGIDIFL--PLSQHEQVGQGSLV------QGQGIIQPQQPAQL

Sequence 1 EEIRNLALQTLPAMCNVYIPPYCTI--APFGIFGTN----
           E-IR-L-LQTLP-MCNVY-PP-C-I--APF----------
Sequence 2 EAIRSLVLQTLPSMCNVYVPPECSIMRAPFASIVAGIGGQ



Alignment 20
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: AAA34274
Sequence identity: 52.26 (150/287)
Sequence 1 MKTFLILALLAIVATTATTAVRVPVPQLQPQNPSQQQP--QEQVPLVQQ-
           MKT-LIL--LA---T-AT-------P--Q-Q-P-QQQP--Q---P--QQ-
Sequence 2 MKTLLILTILAMAITIATANMQAD-PSGQVQWP-QQQPFLQPHQPFSQQP

Sequence 1 QQFLGQ-QQPFP--PQQPYPQPQPFPSQQPYLQLQPFLQPQLPYSQPQPF
           QQ---Q-QQ-FP--PQQ--PQPQ--P-QQ-----QPF--PQ-P--QP-P-
Sequence 2 QQIFPQPQQTFPHQPQQQFPQPQQ-PQQQFLQPRQPF--PQQP-QQPYPQ

Sequence 1 RPQQPYPQPQPQYSQPQQPISQQQQQQQ---QQQQQQQ---QQQQQIIQQ
           -PQQP-PQ-Q----QPQQP--Q--Q-QQ---Q-QQ-QQ---QQQ---IQQ
Sequence 2 QPQQPFPQTQ----QPQQPFPQSKQPQQPFPQPQQPQQSFPQQQPSLIQQ

Sequence 1 ILQQQLIPCMDVVLQQHNIVHGKSQ----VLQQSTYQLLQELCCQHLWQI
           -LQQQL-PC----LQQ---V---S------L--S--Q-----CCQ-L-QI
Sequence 2 SLQQQLNPCKNFLLQQCKPVSLVSSLWSIILPPSDCQVMRQQCCQQLAQI

Sequence 1 PEQSQCQAIHNVVHAIILHQQQKQQQQPSSQVSFQQPL-QQYPLGQGSFR
           P-Q-QC-AIH-VVH-II--Q-Q--Q-Q----V----PL-QQ---GQG---
Sequence 2 PQQLQCAAIHSVVHSIIMQQEQQEQLQG---VQILVPLSQQQQVGQGILV

Sequence 1 PSQQNPQAQGSVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCTI--APF
           ------Q-QG--QPQQ--Q-E-IR-L-LQTLP-MCNVY-PPYC----APF
Sequence 2 ------QGQGIIQPQQPAQLEVIRSLVLQTLPTMCNVYVPPYCSTIRAPF

Sequence 1 GIFGTN----
           ----------
Sequence 2 ASIVASIGGQ



Alignment 21
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: BAA11251
Sequence identity: 47.04 (135/287)
Sequence 1 MKTFLILALLAIVATTATTAVRVPVPQLQPQNPSQQQPQEQVPLVQQQQF
           ----------------------------------Q--P--QV---QQQ-F
Sequence 2 --------------------------------NIQVDPSGQVQWPQQQPF

Sequence 1 LGQQQPFP--PQQPYPQPQP-FPSQ------QPYLQLQPFLQPQLPY-SQ
           ----QPF---PQQ--PQPQ--FP-Q------QP----Q-F-QPQ-P---Q
Sequence 2 PQPHQPFSQQPQQTFPQPQQTFPHQPQQQFSQPQQPQQQFIQPQQPFPQQ

Sequence 1 PQ---PFRPQQPYPQ---PQ---PQYSQPQQPISQQQQQQQQQQQQQQ--
           PQ---P-RPQQP-PQ---PQ---PQ--QPQQP--Q-QQQ--Q-QQ-QQ--
Sequence 2 PQQTYPQRPQQPFPQTQQPQQPFPQSQQPQQPFPQPQQQFPQPQQPQQSF

Sequence 1 -QQQQQIIQQILQQQLIPCMDVVLQQHNIVHGK----SQVLQQSTYQLLQ
           -QQQ---IQQ-LQQQL-PC----LQQ---V-------S--L--S--Q---
Sequence 2 PQQQPSLIQQSLQQQLNPCKNFLLQQCKPVSLVSSLWSMILPRSDCQVMR

Sequence 1 ELCCQHLWQIPEQSQCQAIHNVVHAIILHQQQKQQQQPSSQVSFQQPL-Q
           --CCQ-L-QIP-Q-QC-AIH--VH-II--Q-Q--Q-Q----V----PL-Q
Sequence 2 QQCCQQLAQIPQQLQCAAIHSIVHSIIMQQEQQEQRQG---VQILVPLSQ

Sequence 1 QYPLGQGSFRPSQQNPQAQGSVQPQQLPQFEEIRNLALQTLPAMCNVYIP
           Q---GQG---------Q-QG--QPQQ--Q-E-IR---LQTL--MCNVY-P
Sequence 2 QQQVGQGTLV------QGQGIIQPQQPAQLEVIRSSVLQTLATMCNVYVP

Sequence 1 PYCTI--APFGIFGTN----
           PYC----APF----------
Sequence 2 PYCSTIRAPFASIVAGIGGQ



Alignment 22
Sequence 1:
Sequence 2: Allergen Hor v 21, Sequence: P80198
Sequence identity: 42.86 (123/287)
Sequence 1 MKTFLILALLAIVATTATTAVRVPVPQLQ--PQNPS--QQQPQEQVPLVQ
           -------------------------PQ-Q--PQ-P---QQ-P----P---
Sequence 2 ---ITTTTMQFNPSGLELERPQQLFPQWQPLPQQPPFLQQEPEQPYP---

Sequence 1 QQQFLGQQQPFPPQQPYPQPQPFPSQQPYLQL--QPFLQPQLPYSQPQPF
           QQQ-L-QQQPFP-Q---P----FP-Q-P--Q---Q--LQPQ----Q--P-
Sequence 2 QQQPLPQQQPFPQQPQLPHQHQFPQQLPQQQFPQQMPLQPQQQFPQQMPL

Sequence 1 RPQQ-P-YPQPQP--QYSQP--QQPISQQQQQQQQQQQQQQQQQQQIIQQ
           -PQQ-P--PQ--P--QY-QP--QQP--QQQ---QQQ-----Q-Q------
Sequence 2 QPQQQPQFPQQKPFGQYQQPLTQQPYPQQQPLAQQQPSIEEQHQLNLCKE

Sequence 1 ILQQQLIPCMDVVLQQHNIVHGKSQVLQQSTYQLLQELCCQHLWQIPEQS
           -L-QQ------V-L-Q--I--------QQ---QL----CCQ-L--I-EQS
Sequence 2 FLLQQCTLDEKVPLLQSVISFLRPHISQQNSCQLKRQQCCQQLANINEQS

Sequence 1 QCQAIHNVVHAIILHQQQKQQQQPSSQVSFQQPLQQYPLGQGSFRPSQQN
           -C-AI---VHAI---QQQ-QQQ-----V--Q--LQQ--LGQG-----QQ-
Sequence 2 RCPAIQTIVHAIVM-QQQVQQQVGHGFV--QSQLQQ--LGQGMPIQLQQQ

Sequence 1 PQAQGSVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCTIAPFGIFGTN-
           P--Q--V-PQQ--QF-----L--QTLP--CNV--PPYC---PFG---T--
Sequence 2 P-GQAFVLPQQQAQFKVVGSLVIQTLPMLCNVHVPPYCS--PFGSMATGS

Sequence 1 ---
           ---
Sequence 2 GGQ



Alignment 23
Sequence 1:
Sequence 2: Allergen Tri a glutenin, Sequence: CAA31685
Sequence identity: 48.43 (139/287)
Sequence 1 MKTFLILALLAIVATTATTAVRVP-VP------QLQPQNPSQQQPQEQVP
           MKTFL--ALLA--AT-A---------P------Q-QP--P-Q--PQ---P
Sequence 2 MKTFLVFALLAVAATSAIAQMETRCIPGLERPWQQQPLPPQQTFPQQ--P

Sequence 1 LVQQQQFLGQQQPFPPQQPYPQPQP-FPSQQP-YLQLQPFLQPQLPYSQP
           L--QQQ---QQQ-FP-Q----Q-QP-F--QQP---Q-QP-L--Q-P-SQ-
Sequence 2 LFSQQQ---QQQLFPQQPSFSQQQPPFWQQQPPFSQQQPILPQQPPFSQQ

Sequence 1 QPFRPQQPYPQPQPQYSQPQQPISQQQQ----QQQQQQQQQQQQQQQIIQ
           Q----Q---PQ-QP--SQ-QQP----QQ----QQQQQ-QQ--QQQ----Q
Sequence 2 Q----QLVLPQ-QPPFSQQQQPVLPPQQSPFPQQQQQHQQLVQQQIPVVQ

Sequence 1 QILQQQLIPCMDVVLQQHNIVH-----GKSQVLQQSTYQLLQELCCQHLW
           ----QQL-PC-----QQ---V--------SQ-LQQS-----Q--CCQ-L-
Sequence 2 PSILQQLNPCKVFLQQQCSPVAMPQRLARSQMLQQSSCHVMQQQCCQQLP

Sequence 1 QIPEQSQCQAIHNVVHAIILHQQQK-------QQQQPSSQ---VSFQQPL
           QIP-QS---AI------IIL--QQ--------QQQQP------VS--Q--
Sequence 2 QIPQQSRYEAIRAIIYSIILQEQQQVQGSIQSQQQQPQQLGQCVSQPQQQ

Sequence 1 QQYPLGQGSFRPSQQNPQAQGS-VQPQQLPQFEEIRNLALQTLPAMCNVY
           -Q--LGQ----P-QQ---AQG---QP-Q--Q-E-----AL--LP-MC-V-
Sequence 2 SQQQLGQ---QPQQQQ-LAQGTFLQPHQIAQLEVMTSIALRILPTMCSVN

Sequence 1 IPPY--CTIAPFGIFGTN----
           -P-Y---T--PFG--GT-----
Sequence 2 VPLYRTTTSVPFGV-GTGVGAY



Alignment 24
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: AAA34272
Sequence identity: 50.52 (145/287)
Sequence 1 MKTFLILALLAIVATTATTAVRV-PVPQLQ---------PQNPSQQQPQE
           MKT-LIL--LA---T-AT----V-P--Q-Q---------PQ-P--QQPQ-
Sequence 2 MKTLLILTILAMATTIATANMQVDPSGQVQWPQQQPFPQPQQPFCQQPQR

Sequence 1 QVPLVQQQQFLGQQQPFP-PQQPYP-QPQP-FP-SQQPYLQLQPFLQPQL
           --P---Q------QQ-FP-PQQ-YP-QPQ--FP--QQP----QPF-QPQ-
Sequence 2 TIPQPHQTFHHQPQQTFPQPQQTYPHQPQQQFPQTQQPQ---QPFPQPQQ

Sequence 1 PY-SQPQ-PF--RPQQPYPQPQ------PQYSQPQQPISQQQQQQQQQQQ
           ----QPQ-PF---PQQP-PQPQ------PQ--QPQQP--Q-QQQ--Q-QQ
Sequence 2 TFPQQPQLPFPQQPQQPFPQPQQPQQPFPQSQQPQQPFPQPQQQFPQPQQ

Sequence 1 QQQ---QQQQQIIQQILQQQLIPCMDVVLQQHNIVHGKSQ----VLQQST
           -QQ---QQQQ--IQ--LQQQ--PC----LQQ-N-V---S------L--S-
Sequence 2 PQQSFPQQQQPAIQSFLQQQMNPCKNFLLQQCNHVSLVSSLVSIILPRSD

Sequence 1 YQLLQELCCQHLWQIPEQSQCQAIHNVVHAIILHQQQKQQQQPSSQVSFQ
           -Q--Q--CCQ-L-QIP-Q-QC-AIH-V-H-II--Q-Q-Q-----------
Sequence 2 CQVMQQQCCQQLAQIPQQLQCAAIHSVAHSIIMQQEQQQ-----------

Sequence 1 QPLQQYPLGQGSFRPSQQNPQAQGSVQPQQLPQFEEIRNLALQTLPAMCN
           --------G----RP--Q--Q--G--QPQQ--Q-E-IR-L-L-TLP-MCN
Sequence 2 --------GVPILRPLFQLAQGLGIIQPQQPAQLEGIRSLVLKTLPTMCN

Sequence 1 VYIPPYCTIAPFGIFGTN------
           VY-PP-C-----------------
Sequence 2 VYVPPDCSTINVPYANIDAGIGGQ



Alignment 25
Sequence 1:
Sequence 2: Allergen Tri a 36.0101, Sequence: AEH31546
Sequence identity: 56.79 (163/287)
Sequence 1 MKTFLILALLAIVATTATTAV-------------RVPVP-----------
           MKTFLI-ALLAIVAT-A-------------------P-P-----------
Sequence 2 MKTFLIFALLAIVATSAIAQMENSHIPGLERPSQQQPLPPQQTLSHHQQQ

Sequence 1 ---QLQPQNPSQQQP---QEQVPLVQQQQ--FLGQQQPFPPQQPYP----
           ---Q-QPQ--SQQQP---Q-Q-PL-QQQQ--F--QQ-PF--QQ--P----
Sequence 2 QPIQQQPQPFSQQQPCSQQQQQPLSQQQQPPFSQQQPPFSQQQQQPLSQQ

Sequence 1 QPQPFPSQQP-YLQLQ--PFLQPQLPYSQPQ-PFRPQQP-YPQPQ-PQYS
           Q--PF--QQP---Q-Q--PF-Q-Q-P-SQ-Q-P--PQQP---Q-Q-P--S
Sequence 2 QQPPFSQQQPPFSQQQQPPFSQQQPPFSQQQQPVLPQQPSFSQQQLPPFS

Sequence 1 QPQQPISQQQQ---QQQ----QQQQ----QQ---QQQQQQII---QQI--
           Q-Q-P-SQQQQ---QQQ----QQQQ----QQ----QQQQQ-----QQI--
Sequence 2 QQQSPFSQQQQIVLQQQPPFLQQQQPSLPQQPPFSQQQQQLVLPQQQIPF

Sequence 1 ----LQQQLIPCMDVVLQQHNIVH-----GKSQVLQQSTYQLLQELCCQH
           ------QQL-PC-----QQ---V--------SQ-LQQS-----Q--CCQ-
Sequence 2 VHPSILQQLNPCKVFLQQQCSPVAMPQSLARSQMLQQSSCHVMQQQCCQQ

Sequence 1 LWQIPEQSQCQAIHNVVHAIILHQQQKQQQQPSSQVSFQQPLQQYPLGQG
           L-QIP-QS---AI------IIL--Q--QQ-Q-S-Q---QQP-Q---LGQ-
Sequence 2 LPQIPQQSRYEAIRAIIYSIIL--QEQQQVQGSIQTPQQQPQQ---LGQC

Sequence 1 SFRPSQQN-------PQ----AQGS-VQPQQLPQFEEIRNLALQTLPAMC
           ---P-QQ--------PQ----AQG---QP-Q--Q-E-----AL-TLP-MC
Sequence 2 VSQPQQQSQQQLGQQPQQQQLAQGTFLQPHQIAQLEVMTSIALRTLPTMC

Sequence 1 NVYIPPY--CTIAPFGIFGTN----
           -V--P-Y---T--PFG--GT-----
Sequence 2 RVNVPLYRTTTSVPFGV-GTGVGSY



Alignment 26
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: AAA34285
Sequence identity: 48.08 (138/287)
Sequence 1 MKTFLILALLAIVATTATTAVRVPVPQLQPQNPSQ-QQPQEQVPLVQQQQ
           MKTFL--AL-A-VAT-A---------Q------S----P--Q-PL--QQ-
Sequence 2 MKTFLVFALIAVVATSA-------IAQMETSCISGLERPWQQQPLPPQQS

Sequence 1 FLGQQQPFPPQQPYPQPQPFPSQQPYLQLQPFLQPQLPYSQPQPFRPQQP
           F--QQ-PF--QQ-----QP-P-Q----Q-QP------P-SQ-QP---QQP
Sequence 2 F-SQQPPFSQQQQ----QPLPQQPSFSQQQP------PFSQQQPILSQQP

Sequence 1 YPQPQPQYSQPQQ-PISQQQQ---QQQQQQQQQQQQQQQIIQQILQQQLI
           ----Q-Q---PQQ-P-SQQQQ-----QQQQQQ--QQQ--I-Q----QQL-
Sequence 2 PFSQQQQPVLPQQSPFSQQQQLVLPPQQQQQQLVQQQIPIVQPSVLQQLN

Sequence 1 PCMDVVLQQHNIVH-----GKSQVLQQSTYQLLQELCCQHLWQIPEQSQC
           PC-----QQ---V--------SQ--QQS-----Q--CCQ-L-QIPEQS--
Sequence 2 PCKVFLQQQCSPVAMPQRLARSQMWQQSSCHVMQQQCCQQLQQIPEQSRY

Sequence 1 QAIHNVVHAIILHQQQK-----QQQQP--SSQ-VSFQQPLQQYPLGQGSF
           -AI------IIL--QQ------QQQQP--S-Q-VS--Q---Q--LGQ-SF
Sequence 2 EAIRAIIYSIILQEQQQGFVQPQQQQPQQSGQGVSQSQQQSQQQLGQCSF

Sequence 1 R-PSQQ---NPQAQ-------GS-VQPQQLPQFEEIRNLALQTLPAMCNV
           --P-QQ----PQ-Q-------G---QP-Q----E-----AL-TLP-MC-V
Sequence 2 QQPQQQLGQQPQQQQQQQVLQGTFLQPHQIAHLEAVTSIALRTLPTMCSV

Sequence 1 YIPPY--CTIAPFGIFGTN----
           --P-Y---T--PFG--GT-----
Sequence 2 NVPLYSATTSVPFGV-GTGVGAY



Alignment 27
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: AAA34288
Sequence identity: 42.86 (123/287)
Sequence 1 MKTFLILALLAIVATTATTAVRVPVPQLQPQNPSQQQ-PQEQVPLVQQ-Q
           MKT-LIL--LA---T--T----V--P--Q-Q-P-QQ--PQ---P--QQ-Q
Sequence 2 MKTLLILTILAMAITIGTANMQVD-PSSQVQWPQQQPVPQPHQPFSQQPQ

Sequence 1 QFLGQ-QQPFP--PQQPYPQPQPFPSQQPYLQLQPFLQPQLPYSQPQPFR
           Q---Q-QQ-FP--PQQ--PQPQ--P-QQ-----QPF--PQ-P--QP-P--
Sequence 2 QTFPQPQQTFPHQPQQQFPQPQQ-PQQQFLQPQQPF--PQQP-QQPYPQQ

Sequence 1 PQQPYP---QPQ---PQYSQPQQPISQQQQQQQQQQQQQQ---QQQQQII
           PQQP-P---QPQ---PQ--QPQQ--SQ-QQQ--Q-QQ-QQ---QQQ---I
Sequence 2 PQQPFPQTQQPQQLFPQSQQPQQQFSQPQQQFPQPQQPQQSFPQQQPPFI

Sequence 1 QQILQQQLIPCMDVVLQQHNIVHGKSQ----VLQQSTYQLLQELCCQHLW
           Q--LQQQ--PC----LQQ---V---S--------QS--Q-----CCQ-L-
Sequence 2 QPSLQQQVNPCKNFLLQQCKPVSLVSSLWSMIWPQSDCQVMRQQCCQQLA

Sequence 1 QIPEQSQCQAIHNVVHAIILHQQQKQQQQPSSQVSFQQPL-QQYPLGQGS
           QIP-Q-QC-AIH---H-II--Q-Q--QQQ---------PL-QQ---GQG-
Sequence 2 QIPQQLQCAAIHTIIHSIIMQQEQQEQQQG---MHILLPLYQQQQVGQGT

Sequence 1 FRPSQQNPQAQGSVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCTIAPF
           --------Q-QG--Q-----------------------------------
Sequence 2 LV------QGQGIIQ-----------------------------------

Sequence 1 GIFGTN
           ------
Sequence 2 ------



Alignment 28
Sequence 1:
Sequence 2: Allergen Tri a glutenin, Sequence: CAA30570
Sequence identity: 54.01 (155/287)
Sequence 1 MKTFLILALLAIVATTATTAVRVPVPQLQPQNPSQQQP----QEQVPLVQ
           MKTFL--ALLA--A--A---------Q--P----QQQP----Q-Q-P--Q
Sequence 2 MKTFLVFALLALAAASAVA--QISQQQQAPPFSQQQQPPFSQQQQPPFSQ

Sequence 1 QQQF-LGQQQPFPPQQPYPQPQPFPSQQPYLQLQ--PFLQPQLP-YSQPQ
           QQQ----QQQ--PP-----QP-PF--Q-P--Q-Q--PF-Q-Q-P--SQ-Q
Sequence 2 QQQSPFSQQQQQPPFAQQQQP-PFSQQPPISQQQQPPFSQQQQPQFSQQQ

Sequence 1 --PFRPQQ--PYPQPQ-PQYSQPQQP-ISQQQQQ----QQQQQQQQQQ--
           --P---QQ--PY-Q-Q-P--SQ-QQP--SQQQQQ----QQQQQQQQQQ--
Sequence 2 QPPYSQQQQPPYSQQQQPPFSQQQQPPFSQQQQQPPFTQQQQQQQQQQPF

Sequence 1 -QQQQ--------IIQQ----ILQQQ--------------------LIPC
           -QQQQ--------I-QQ-----LQQQ--------------------L-PC
Sequence 2 TQQQQPPFSQQPPISQQQQPPFLQQQRPPFSRQQQIPVIHPSVLQQLNPC

Sequence 1 MDVVLQQHNI------VHGKSQVLQQSTYQLLQELCCQHLWQIPEQSQCQ
           --V-LQQ--I----------SQ-LQQS-----Q--CCQ-L-QIPEQS---
Sequence 2 -KVFLQQQCIPVAMQRCLARSQMLQQSICHVMQQQCCQQLRQIPEQSRHE

Sequence 1 AIHNVVHAIILHQQQKQQQQPSSQ--VSFQQPLQQYP--LGQGSFRPSQQ
           -I------IIL-QQQ-QQQQ---Q---S--Q--QQ-P--LGQ----P-QQ
Sequence 2 SIRAIIYSIILQQQQQQQQQQQQQQGQSIIQYQQQQPQQLGQCVSQPLQQ

Sequence 1 NPQAQGSVQPQQ------LPQFEEIRNLALQTLPAMCNVYIPPYCTIA--
           --Q--G--QPQQ--------Q-E-----AL-TLP-MCNV--P-Y-T----
Sequence 2 LQQQLGQ-QPQQQQLAHQIAQLEVMTSIALRTLPTMCNVNVPLYETTTSV

Sequence 1 PFGIFGTN---
           P-G--------
Sequence 2 PLGVGIGVGVY



Alignment 29
Sequence 1:
Sequence 2: Allergen Tri a glutenin, Sequence: CAA44473
Sequence identity: 48.43 (139/287)
Sequence 1 MKTFLILALLAIVATTATTAVRVPVPQLQPQN-PSQQQPQEQVPLVQQQQ
           MKTFL--ALLA-VAT-A---------Q------P----P-----------
Sequence 2 MKTFLVFALLAVVATSA-------IAQMDTSCIPGLERPW----------

Sequence 1 FLGQQQPFPPQQPYPQPQPFPSQQPYLQLQPFLQPQLP-YSQPQPFRPQ-
           ---QQQP-PPQQ--PQ--PF--QQ---Q-QPF--PQ-P--SQ-QP--PQ-
Sequence 2 ---QQQPLPPQQTFPQQPPFSQQQ---QQQPF--PQQPSFSQQQPILPQG

Sequence 1 QPYPQPQPQYSQPQQ-PISQQQQQ--QQQQQQQQQQQQQQIIQQILQQQL
           -P-PQ-Q-Q---PQQ-P-SQQQQ-----QQQQQ--QQQ--I-Q----QQL
Sequence 2 PPFPQ-QTQPVLPQQSPFSQQQQLILPPQQQQQLPQQQISIVQPSVLQQL

Sequence 1 IPCMDVVLQQHNIVH-----GKSQVLQQSTYQLLQELCCQHLWQIPEQSQ
           -PC-----QQ---V--------SQ--QQS-----Q--CCQ-L-QIPEQS-
Sequence 2 NPCKVFLQQQCSPVAIPQRLARSQMWQQSSCHVMQQQCCQQLSQIPEQSR

Sequence 1 CQAIHNVVHAIILHQQQK---QQQQP--SSQ-VSFQQPLQQYPLGQGSFR
           --AI------IIL--QQ----QQQQP--S-Q-VS--Q---Q--LGQ-SF-
Sequence 2 YDAIRAITYSIILQEQQQGQSQQQQPQQSGQGVSQSQQQSQQQLGQCSFQ

Sequence 1 -PSQ---QNPQA----QGS-VQPQQLPQFEEIRNLALQTLPAMCNVYIPP
           -P-Q---Q-PQ-----QG---QP-Q----E-----AL-TLP-MC-V--P-
Sequence 2 QPQQQLGQQPQQQQVQQGTFLQPHQIAHLEVMTSIALRTLPTMCSVNVPL

Sequence 1 YC--TIAPFGIFGTN
           Y---T--PFG-----
Sequence 2 YSSTTSVPFGV----



Alignment 30
Sequence 1:
Sequence 2: Allergen Tri a glutenin, Sequence: CAA59338
Sequence identity: 37.28 (107/287)
Sequence 1 MKTFLILALLAIVATTATTAVRVPVPQLQPQN-PSQQQPQEQVPLVQQQQ
           -------AL-A-VAT-----------Q------P----P--Q-PL--QQ-
Sequence 2 ------FALIAVVATST-------IAQMETSCIPGLERPWQQQPLPPQQT

Sequence 1 FLGQQQPFPPQQPYPQPQPFPSQQPYLQLQPFLQPQLPYSQPQPFRPQQP
           ---QQQPFP-QQP-----PF--QQP------F-Q-Q-P-SQ-QP--P--P
Sequence 2 LFPQQQPFPQQQP-----PFSQQQP-----SFSQQQPPFSQQQPILPEPP

Sequence 1 YP-QPQPQYSQPQQPISQQQQ-QQQQQQQQQQQQQQQIIQQILQQQLIPC
           ---Q-QP---Q-Q-P-SQQQ-----QQQQQ--QQQ--I-Q----QQL-PC
Sequence 2 FSLQQQPVLPQ-QSPFSQQQLVLPPQQQQQLPQQQISIVQPSVLQQLNPC

Sequence 1 MDVVLQQHNIVH-----GKSQVLQQSTYQLLQELCCQHLWQIPEQSQCQA
           -----QQ---V--------SQ--QQS-----Q--CCQ-L-QIPEQS---A
Sequence 2 KVFLQQQCSPVAMPQRLARSQMWQQSRCHVMQQQCCQQLSQIPEQSRYDA

Sequence 1 IHNVVHAIILHQQQK-----QQQQP--SSQ-VSFQQPLQQYPLGQGSFRP
           I------IIL--QQ------QQQQP--S-Q-VS--Q---Q--LGQ-SF--
Sequence 2 ICAITYSIILQEQQQGFVQAQQQQPQQSGQGVSQSQQQSQQQLGQCSFQQ

Sequence 1 SQQNPQAQGSVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCTIAPFGIF
           -QQ-----------------------------------------------
Sequence 2 PQQ-----------------------------------------------

Sequence 1 GTN
           ---
Sequence 2 ---



Alignment 31
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: AAA34287
Sequence identity: 36.93 (106/287)
Sequence 1 MKTFLILALLAIVATTATTAVRVPVPQLQPQNPSQQQPQEQVPLVQQQQF
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LGQQQPFPPQQPYP-QPQP---FPSQQPYLQLQPFLQPQLPYSQPQPFRP
           --------PQQP-P-QPQ------SQQP-LQ-----QPQ-P--QPQ----
Sequence 2 --------PQQPFPLQPQQSFLWQSQQPFLQ-----QPQQPSPQPQQVV-

Sequence 1 QQPYPQPQPQYSQPQQPISQQQQQQQQQQQQQQQQQQQIIQQILQQQLIP
           Q---P-----------P-S----QQQQQ-QQ--QQQ----Q----QQL-P
Sequence 2 QIISPATPTTIPSAGKPTSAPFPQQQQQHQQLAQQQIPVVQPSILQQLNP

Sequence 1 CMDVVLQQHNIVH-----GKSQVLQQSTYQLLQELCCQHLWQIPEQSQCQ
           C-----QQ---V--------SQ-LQQS-----Q--CCQ-L-QIP-QS--Q
Sequence 2 CKVFLQQQCSPVAMPQRLARSQMLQQSSCHVMQQQCCQQLPQIPQQSRYQ

Sequence 1 AIHNVVHAIILHQQQK-------QQQQPSSQ---VSFQQPLQQYPLGQGS
           AI------IIL--QQ--------QQQQP------VS--Q---Q--LGQ--
Sequence 2 AIRAIIYSIILQEQQQVQGSIQSQQQQPQQLGQCVSQPQQQSQQQLGQ--

Sequence 1 FRPSQQNPQAQGS-VQPQQLPQFEEIRNLALQTLPAMCNVYIPPY--CTI
           --P-QQ---AQG---QP-Q--Q-E-----AL--LP-MC-V--P-Y---T-
Sequence 2 -QPQQQQ-LAQGTFLQPHQIAQLEVMTSIALRILPTMCSVNVPLYRTTTS

Sequence 1 APFGIFGTN----
           -PFG--GT-----
Sequence 2 VPFGV-GTGVGAY



Alignment 32
Sequence 1:
Sequence 2: Allergen Tri a glutenin, Sequence: CAA36063
Sequence identity: 47.74 (137/287)
Sequence 1 MKTFLILALLAIVATTATTAVRVPVPQLQPQN-PSQQQPQEQVPLVQQQQ
           MKTFL--ALLA-VAT-----------Q------P----P----PL--Q--
Sequence 2 MKTFLVFALLAVVATST-------IAQMETSCIPGLERPWQEQPLPPQHT

Sequence 1 FLGQQQPFPPQQPYPQPQPFPSQQP-YLQLQPFLQPQLPYSQPQPFRPQQ
           ---QQQPFP-QQ---QP-PF--QQP--LQ-QP-L-PQLP-SQ-Q-----Q
Sequence 2 LFPQQQPFPQQQ---QP-PFSQQQPSFLQQQPIL-PQLPFSQQQ-----Q

Sequence 1 PYPQPQPQYSQPQQPISQQQQ--QQQQQQQQQQQQQQQIIQQILQQQLIP
           P---PQ------Q-P-SQQQ-----QQQ-QQ--QQQ--I-Q----QQL-P
Sequence 2 PV-LPQ------QSPFSQQQLVLPPQQQYQQVLQQQIPIVQPSVLQQLNP

Sequence 1 CMDVVLQQHNIVH-----GKSQVLQQSTYQLLQELCCQHLWQIPEQSQCQ
           C-----QQ-N-V--------SQ-LQQS-----Q--CCQ-L-QIPEQS---
Sequence 2 CKVFLQQQCNPVAMPQRLARSQMLQQSSCHVMQQQCCQQLPQIPEQSRYD

Sequence 1 AIHNVVHAIILHQQQK-----QQQQPSS---QVSFQQPLQQYPLGQGSFR
           -I------IIL--QQ------QQQQP------VS--Q---Q--LGQ-SF-
Sequence 2 VIRAITYSIILQEQQQGFVQAQQQQPQQLGQGVSQSQQQSQQQLGQCSFQ

Sequence 1 -PSQQ---NPQAQ----GS-VQPQQLPQFEEIRNLALQTLPAMCNVYIPP
           -P-QQ----PQ-Q----G---QP-Q----E-----AL-TLP-MC-V--P-
Sequence 2 QPQQQLGQQPQQQQVLQGTFLQPHQIAHLEVMTSIALRTLPTMCSVNVPL

Sequence 1 Y--CTIAPFGIFGTN-----
           Y---T--PF---GT------
Sequence 2 YSSTTSVPFSV-GTGVGAYL



Alignment 33
Sequence 1:
Sequence 2: Allergen Tri a glutenin, Sequence: CAA59340
Sequence identity: 37.98 (109/287)
Sequence 1 ----------MKTFLILALLAIVATTATTAVRVPVPQLQPQNPSQQQP--
           -------------------L-------------P-PQ-QP----QQQP--
Sequence 2 HIPSLEKPSQQQPLPLQQILWYHQQQPIQQQPQPFPQ-QPPCSQQQQPPL

Sequence 1 --QEQVPLVQQQQFLGQQQ-PFPPQQP----YPQPQPFPSQQPY-LQLQP
           --Q-Q-P--QQQ----QQ--P--PQQP------QPQ----QQP---Q-QP
Sequence 2 SQQQQPPFSQQQPPFSQQELPILPQQPPFSQQQQPQFSQQQQPFPQQQQP

Sequence 1 FLQPQLPYSQPQPFRPQQPYPQPQPQYSQPQQP-ISQQQQQQQQQQQQ--
           -L--Q-P-SQ--P-----P--Q-Q-Q---PQQP--SQQQQQQ----QQ--
Sequence 2 LLLQQPPFSQQRP-----PFSQQQQQPVLPQQPPFSQQQQQQPILPQQPP

Sequence 1 ----QQ----QQQQQIIQQILQQQLIPCMDVVLQQHNIVH-----GKSQV
           ----QQ----QQQ----Q----QQL-PC-----QQ---V--------SQ-
Sequence 2 FSLHQQPVLPQQQIPYVQPSILQQLNPCKVFLQQQCSPVAMPQSLARSQM

Sequence 1 LQQSTYQLLQELCCQHLWQIPEQSQCQAIHNVVHAIILHQQQKQQQQPSS
           L-QS-----Q--CCQ-L--IPEQS---AI------I-L--QQ--Q-----
Sequence 2 LWQSSCHVMQQQCCQQLPRIPEQSRYDAIRAIIYSIVLQEQQHGQ-----

Sequence 1 QVSFQQPLQQYPLG--QGSFRPSQQNPQ-AQGSVQ-PQQLPQFEEIRNLA
           ---F-QP-QQ-P----QG---P-QQ--Q--Q-S-Q-PQQ-----------
Sequence 2 --GFNQPQQQQPQQSVQGVSQPQQQQKQLGQCSFQQPQQ-----------

Sequence 1 LQTLPAMCNVYIPPYCTIAPFGIFGTN
           ---------------------------
Sequence 2 ---------------------------



Alignment 34
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: AAA34286
Sequence identity: 39.37 (113/287)
Sequence 1 --------------------MKTFLILALLAIVATTATTAVRVPVPQLQP
           ---------------------------------------------P----
Sequence 2 TITRTFPIPTISSNNNHHFRSNSNHHFHSNNNQFYRNNNSPGHNNPLNNN

Sequence 1 QNPSQQQPQEQVPLVQQQQFLGQQQPFPPQQPYPQPQPFPSQQPYLQLQP
           --P----P-----------F-----P-------P-------QQP-----P
Sequence 2 NSPNNNSPSNHHNNSPNNNFQYHTHP-SNHKNLPHTNNIQQQQP-----P

Sequence 1 FLQPQLPYSQPQPFRPQQPYPQPQPQYSQPQQPISQQQQ---QQQQQQQQ
           F-Q-Q-P-----PF--QQ-----QP---Q-Q-P-SQQQQ-----QQQQQQ
Sequence 2 FSQQQQP-----PFSQQQ-----QPVLPQ-QSPFSQQQQLVLPPQQQQQQ

Sequence 1 QQQQQQQIIQQILQQQLIPCMDVVLQQHNIVH-----GKSQVLQQSTYQL
           --QQQ--I-Q----QQL-PC-----QQ---V--------SQ--QQS----
Sequence 2 LVQQQIPIVQPSVLQQLNPCKVFLQQQCSPVAMPQRLARSQMWQQSSCHV

Sequence 1 LQELCCQHLWQIPEQSQCQAIHNVVHAIILHQQQK-----QQQQP--SSQ
           -Q--CCQ-L-QIPEQS---AI------IIL--QQ------QQQQP--S-Q
Sequence 2 MQQQCCQQLQQIPEQSRYEAIRAIIYSIILQEQQQGFVQPQQQQPQQSGQ

Sequence 1 -VSFQQPLQQYPLGQGSFR-PSQQ---NPQAQ-------GS-VQPQQLPQ
           -VS--Q---Q--LGQ-SF--P-QQ----PQ-Q-------G---QP-Q---
Sequence 2 GVSQSQQQSQQQLGQCSFQQPQQQLGQQPQQQQQQQVLQGTFLQPHQIAH

Sequence 1 FEEIRNLALQTLPAMCNVYIPPYC--TIAPFGIFGTN----
           -E-----AL-TLP-MC-V--P-Y---T--PFG--GT-----
Sequence 2 LEAVTSIALRTLPTMCSVNVPLYSATTSVPFGV-GTGVGAY



Alignment 35
Sequence 1:
Sequence 2: Allergen Tri a glutenin, Sequence: CAA59339
Sequence identity: 39.02 (112/287)
Sequence 1 MKTFLILALLAIVATTATTAVRVPVPQL---QPQNPSQQQPQ---EQVPL
           -----------------------P--Q----Q-Q-P-QQQPQ----Q-P-
Sequence 2 ---------HIPSLEKPLQQQPLPLQQILWYQQQQPIQQQPQPFPQQPPC

Sequence 1 VQQQQF-LGQQQ--PFPPQQP--YPQPQPFPSQQPYLQLQPFLQPQLPYS
           -QQQQ--L-QQQ--PF--QQP----Q-QP---QQP----Q---Q-Q-P--
Sequence 2 SQQQQPPLSQQQQPPFSQQQPPFSQQQQPILPQQPPFSQQ---QQQFPQQ

Sequence 1 QPQPFRPQQP-YPQPQPQYSQPQQ--PISQQQQQ----QQ---QQQQQQQ
           Q-QP--PQQP---Q-QP--SQ-QQ--P-SQQQQQ----QQ----Q-QQ--
Sequence 2 Q-QPLLPQQPPFSQQQPPFSQQQQQPPFSQQQQQPILLQQPPFSQHQQPV

Sequence 1 QQQQQI--IQQILQQQLIPCMDVVLQQHNIVH-----GKSQVLQQSTYQL
           --QQQI---Q----QQL-PC-----QQ---V--------SQ-L-QS----
Sequence 2 LPQQQIPSVQPSILQQLNPCKVFLQQQCSPVAMPQSLARSQMLWQSSCHV

Sequence 1 LQELCCQHLWQIPEQSQCQAIHNVVHAIILHQQQK-------QQQQPSSQ
           -Q--CC--L-QIPEQS---AI------I-L--QQ--------QQQQP---
Sequence 2 MQQQCCRQLPQIPEQSRYDAIRAIIYSIVLQEQQHGQGLNQPQQQQPQQS

Sequence 1 VS-FQQPLQQYP-LGQGSFRPSQQNPQAQGSVQPQQLPQFEEIRNLALQT
           V----QP-QQ---LGQ-SF---QQ--------------------------
Sequence 2 VQGVSQPQQQQKQLGQCSFQQPQQ--------------------------

Sequence 1 LPAMCNVYIPPYCTIAPFGIFGTN
           ------------------------
Sequence 2 ------------------------



Alignment 36
Sequence 1:
Sequence 2: Allergen Tri a glutenin, Sequence: CAA31396
Sequence identity: 31.71 (91/287)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MAKRLVLFAAVVIALVALTTAEGEASRQLQCERELQESSLEACRQVVDQQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 LAGRLPWSTGLQMRCCQQLRDVSAKCRSVAVSQVARQYEQTVVPPKGGSF

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 YPGETTPLQQLQQGIFWGTSSQTVQGYYPGVTSPRQGSYYPGQASPQQPG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QGQQPGKWQEPGQGQQWYYPTSLQQPGQGQQIGKGQQGYYPTSLQQPGQG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QQGYYPTSLQHTGQRQQPVQGQQPEQGQQPGQWQQGYYPTSPQQLGQGQQ

Sequence 1 -------------------------------------MKTFLILALLAIV
           --------------------------------------------------
Sequence 2 PRQWQQSGQGQQGHYPTSLQQPGQGQQGHYLASQQQPGQGQQGHYPASQQ

Sequence 1 ATTATTAVRVPVPQLQP------QNP-SQQQP----QEQVPLVQQQQFLG
           ----------P--Q-QP--------P-SQQ-P----Q-Q-P--QQQ---G
Sequence 2 QPGQGQQGHYPASQQQPGQGQQGHYPASQQEPGQGQQGQIPASQQQPGQG

Sequence 1 QQQPFPP--QQP-YPQPQPFP-SQQPYLQLQPFLQP---QLPYSQPQPFR
           QQ---P---QQP---Q----P-S-Q---Q-Q---QP---Q-P----Q---
Sequence 2 QQGHYPASLQQPGQGQQGHYPTSLQQLGQGQQTGQPGQKQQPGQGQQTGQ

Sequence 1 PQQPYPQPQPQYSQPQQPISQQQQQQQQQQQQQQQQQQQIIQQILQQQLI
           -QQP----QP---Q-QQ-------QQ--Q-QQQ-Q-QQ------LQQ---
Sequence 2 GQQPEQEQQP--GQGQQGYYPTSLQQPGQGQQQGQGQQGYYPTSLQQ---

Sequence 1 PCMDVVLQQHNIVHGKSQVLQQSTYQLLQELCCQHLWQ--IPEQSQCQAI
           P------QQ--------Q--Q----Q--Q----QH--Q---P-Q-Q----
Sequence 2 PGQG---QQGHYPASLQQPGQGQPGQRQQPGQGQHPEQGKQPGQGQQGYY

Sequence 1 HNVVHAIILHQQQKQQQQPSSQVSFQQPLQ-QYP-LGQGSFRPS--QQNP
           ----------QQ--Q-QQ-----S-QQP-Q-Q-P--GQ----P---QQ--
Sequence 2 PTSPQQPGQGQQLGQGQQGYYPTSPQQPGQGQQPGQGQQGHCPTSPQQSG

Sequence 1 QAQGSVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCTIAPFGIFGTN--
           QAQ---Q-QQ--Q------------P------------------------
Sequence 2 QAQQPGQGQQIGQVQQPGQGQQGYYPTSVQQPGQGQQSGQGQQSGQGHQP

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 GQGQQSGQEQQGYDSPYHVSAEQQAASPMVAKAQQPATQLPTVCRMEGGD

Sequence 1 ------
           ------
Sequence 2 ALSASQ



Alignment 37
Sequence 1:
Sequence 2: Allergen Tri a glutenin, Sequence: CAA26847
Sequence identity: 31.01 (89/287)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MAKRLVLFAAVVIALVALTTAEGEASRQLQCERELQESSLEACRQVVDQQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 LAGRLPWSTGLQMRCCQQLRDVSAKCRSVAVSQVARQYEQTVVPPKGGSF

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 YPGETTPLQQLQQGIFWGTSSQTVQGYYPSVTSPRQGSYYPGQASPQQPG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QGQQPGKWQEPGQGQQWYYPTSLQQPGQGQQIGKGKQGYYPTSLQQPGQG

Sequence 1 ---------------------MKTFLILALLAIVATTATTAVRVPVPQLQ
           --------------------------------------------------
Sequence 2 QQIGQGQQGYYPTSPQHTGQRQQPVQGQQIGQGQQPEQGQQPGQWQQGYY

Sequence 1 PQNPSQQQPQEQVPLVQQQQFLGQQQPFPP--QQPYP--QPQPFPSQQPY
           P--P-QQ--Q-Q-P---QQ---GQQ---P---QQP----Q-----SQQ--
Sequence 2 PTSP-QQLGQGQQPGQWQQSGQGQQGHYPTSLQQPGQGQQGHYLASQQQP

Sequence 1 LQLQPFLQPQLPYSQPQPFRPQQP-YPQPQPQYSQPQQ---PISQQQQQQ
           -Q-Q---Q---P-SQ-QP---QQ--YP--Q-Q--Q-QQ---P-SQQ---Q
Sequence 2 AQGQ---QGHYPASQQQPGQGQQGHYPASQQQPGQGQQGHYPASQQEPGQ

Sequence 1 QQQ-----QQQQQQQQQQ-----IIQQILQQQLIPCMDVVLQQHNIVHGK
           -QQ------QQQ--Q-QQ-------QQ--QQ---P-----L-Q-------
Sequence 2 GQQGQIPASQQQPGQGQQGHYPASLQQPGQQGHYPTSLQQLGQGQQIGQP

Sequence 1 SQVLQQSTYQLLQELCCQHLWQIPEQSQCQAIHNVVHAIILHQQQKQQQQ
           -Q--Q----Q-----------Q-P-Q-Q--------------QQQ-Q-QQ
Sequence 2 GQKQQPGQGQQTGQGQQPEQEQQPGQGQQGYYPTSLQQPGQGQQQGQGQQ

Sequence 1 PSSQVSFQQPLQ----QYPL-----GQGSFRPSQQNPQAQGSVQPQQLPQ
           -----S-QQP-Q-----YP------GQG---P-Q-----QG---P-Q--Q
Sequence 2 GYYPTSLQQPGQGQQGHYPASLQQPGQGQGQPGQRQQPGQGQ-HPEQGQQ

Sequence 1 FEEIRNLALQTLPAMCNVYIPPYCTIAPFGIFGTN---------------
           ----------T-P-------------------------------------
Sequence 2 PGQGQQGYYPTSPQQPGQGQQLGQGQQGYYPTSPQQPGQGQQPGQGQQGH

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 CPMSPQQTGQAQQLGQGQQIGQVQQPGQGQQGYYPTSLQQPGQGQQSGQG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QQSGQGHQPGQGQQSGQEKQGYDSPYHVSAEQQAASPMVAKAQQPATQLP

Sequence 1 ---------------
           ---------------
Sequence 2 TVCRMEGGDALSASQ



Alignment 38
Sequence 1:
Sequence 2: Allergen Tri a glutenin, Sequence: CAA27052
Sequence identity: 31.71 (91/287)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MAKRLVLFVAVVVALVALTVAEGEASEQLQCERELQELQERELKACQQVM

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 DQQLRDISPECHPVVVSPVAGQYEQQIVVPKGGSFYPGETTPPQQLQQRI

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 FWGIPALLKRYYPSVTSPQQVSYYPGQASPQRPGQGQQPGQGQQSGQGQQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 GYYPTSPQQPGQWQQPEQGQPGYYPTSPQQPGQLQQPAQGQQPGQGQQGR

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QPGQGQPGYYPTSSQLQPGQLQQPAQGQQGQQPGQGQQGQQPGQGQQPGQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 GQQGQQPGQGQQPGQGQQGQQLGQGQQGYYPTSLQQSGQGQPGYYPTSLQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QLGQGQSGYYPTSPQQPGQGQQPGQLQQPAQGQQPEQGQQGQQPGQGQQG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QQPGQGQQPGQGQPGYYPTSPQQSGQGQPGYYPTSSQQPTQSQQPGQGQQ

Sequence 1 -------------------------------------------MKTFLIL
           --------------------------------------------------
Sequence 2 GQQVGQGQQAQQPGQGQQPGQGQPGYYPTSPLQSGQGQPGYYLTSPQQSG

Sequence 1 ALLAIVATTATTAVRVPVPQLQPQNPSQQQPQEQVPLVQQQQFLGQQQP-
           ---------------------Q-Q-P-Q-Q---Q----QQ-Q--GQ-QP-
Sequence 2 QGQQPGQLQQSAQGQKGQQPGQGQQPGQGQQGQQPGQGQQGQQPGQGQPG

Sequence 1 -FP--PQQPYPQPQPFPSQQPYLQLQPFLQPQLPY----SQP--QPFRPQ
           --P--PQQ-----QP---QQP--Q-QP---P--P------QP---P--PQ
Sequence 2 YYPTSPQQSGQGQQPGQWQQPG-QGQPGYYPTSPLQPGQGQPGYDPTSPQ

Sequence 1 QPYPQPQP-QYSQPQQPISQQQQQQQQQQQQQQQQQQQIIQQILQQQLIP
           QP----QP-Q--QP-Q---QQ-QQ--Q-QQ-QQ--Q-Q--QQ--Q-Q---
Sequence 2 QPGQGQQPGQLQQPAQ--GQQGQQLAQGQQGQQPAQVQQGQQPAQGQQGQ

Sequence 1 CMDVVLQQHNIVHGKSQVLQQSTYQLLQELCCQH--LWQIPEQSQCQAIH
           ------Q------G------Q---Q--Q----Q-----Q-P-Q-Q-----
Sequence 2 QLGQGQQGQQPGQGQQPAQGQQGQQPGQGQQGQQPGQGQQPGQGQPWYYP

Sequence 1 NVVHAIILHQQQKQQQQPSSQVSFQQPLQQYP---------LGQG--SFR
           ---------QQ--Q-QQP------QQP-Q--P---------LGQG-----
Sequence 2 TSPQESGQGQQPGQWQQPGQ---WQQPGQGQPGYYLTSPLQLGQGQQGYY

Sequence 1 PSQQNPQAQGSVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCTIAPFGI
           P-------QG--QP-Q--Q----------T-P--------P-----P---
Sequence 2 PTSLQQPGQGQ-QPGQWQQSGQGQHGYYPTSPQLSGQGQRPGQWLQPGQG

Sequence 1 FGTN----------------------------------------------
           --------------------------------------------------
Sequence 2 QQGYYPTSPQQSGQGQQLGQWLQPGQGQQGYYPTSLQQTGQGQQSGQGQQ

Sequence 1 ---------------------------------------------
           ---------------------------------------------
Sequence 2 GYYSSYHVSVEHQAASLKVAKAQQLAAQLPAMCRLEGGDALSASQ



Alignment 39
Sequence 1:
Sequence 2: Allergen Tri a glutenin, Sequence: CAA31395
Sequence identity: 33.45 (96/287)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MAKRLVLFVAVVVALVALTVAEGEASEQLQCERELQELQERELKACQQVM

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 DQQLRDISPECHPVVVSPVAGQYEQQIVVPPKGGSFYPGETTPPQQLQQR

Sequence 1 -MKTFLILALLAIVATTATTAVRVPVPQLQPQNPSQ-QQPQE--------
           -------L--------T----V-----Q--PQ-P-Q-QQP----------
Sequence 2 IFWGIPALLKRYYPSVTCPQQVSYYPGQASPQRPGQGQQPGQGQQGYYPT

Sequence 1 --QVPLVQQQQFLGQQQPFP--PQQPYPQPQPFPSQQPYLQLQPFLQP--
           --Q-P---QQ---GQQ---P--PQQP----QP---QQP--Q-Q---QP--
Sequence 2 SPQQPGQWQQPEQGQQGYYPTSPQQPGQLQQPAQGQQPG-QGQQGQQPGQ

Sequence 1 -QLPY----SQPQPFRPQQP---YPQPQP-QYSQPQQPISQQQ----QQQ
           -Q--Y----SQ-QP---QQP-------QP-Q--Q-QQP---QQ----QQ-
Sequence 2 GQPGYYPTSSQLQPGQLQQPAQGQQGQQPGQAQQGQQPGQGQQPGQGQQG

Sequence 1 QQQQQQQQQQQQQIIQQILQQQLIPCMDVVLQQHNIVHGKSQVLQQSTYQ
           QQ--Q-QQ--Q-Q--QQ--Q-Q--------LQQ-----G-------S--Q
Sequence 2 QQPGQGQQPGQGQQGQQLGQGQQ-GYYPTSLQQSG--QGQPGYYPTSLQQ

Sequence 1 LLQELCCQHLWQIPEQSQCQAIHNVVHAIILHQ--QQKQQQQPSSQVSFQ
           L-Q--------------Q-Q------------Q--Q--Q-QQP------Q
Sequence 2 LGQGQSGYYPTSPQQPGQGQQPGQLQQPAQGQQPGQGQQGQQPGQGQQGQ

Sequence 1 QPLQ-QYP-LGQGSFRPSQQNPQAQGSVQPQQLPQFEEIRNLALQTLPAM
           QP-Q-Q-P--GQ----P----PQ--G--QP---P----------Q-----
Sequence 2 QPGQGQQPGQGQPGYYPT--SPQQSGQGQPGYYPTSSQQPTQSQQPGQGQ

Sequence 1 CNVYIPPYCTIAPFGIFGTN------------------------------
           --------------G-----------------------------------
Sequence 2 QGQQVGQGQQAQQPGQGQQPGQGQPGYYPTSPQQSGQGQPGYYLTSPQQS

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 GQGQQPGQLQQSAQGQKGQQPGQGQQPGQGQQGQQPGQGQQGQQPGQGQP

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 GYYPTSPQQSGQGQQPGQWQQPGQGQPGYYPTSPLQPGQGQPGYDPTSPQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QPGQGQQPGQLQQPAQGQQGQQLAQGQQGQQPAQVQQGQQPAQGQQGQQL

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 GQGQQGQQPGQGQQGQQPAQGQQGQQPGQGQHGQQPGQGQQGQQPGQGQQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 PGQGQPWYYPTSPQESGQGQQPGQWQQPGQGQPGYYLTFSVAARTGQQGY

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 YPTSLQQPGQGQQPGQWQQSGQGQHWYYPTSPKLSGQGQRPGQWLQPGQG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QQGYYPTSPQQPPQGQQLGQWLQPGQGQQGYYPTSLQQTGQGQQSGQGQQ

Sequence 1 ---------------------------------------------
           ---------------------------------------------
Sequence 2 GYYSSYHVSVEHQAASLKVAKAQQLAAQLPAMCRLEGGDALSASQ



Alignment 40
Sequence 1:
Sequence 2: Allergen Tri a 26.0101, Sequence: P10388
Sequence identity: 30.66 (88/287)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MAKRLVLFVAVVVALVALTVAEGEASEQLQCERELQELQERELKACQQVM

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 DQQLRDISPECHPVVVSPVAGQYEQQIVVPPKGGSFYPGETTPPQQLQQR

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 IFWGIPALLKRYYPSVTCPQQVSYYPGQASPQRPGQGQQPGQGQQGYYPT

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 SPQQPGQWEEPEQGQQGYYPTSPQQPGQLQQPAQGQQPGQGQQGQQPGQG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QPGYYPTSSQLQPGQLQQPAQGQQGQQPGQAQQGQQPGQGQQPGQGQQGQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QPGQGQQPGQGQQGQQLGQGQQGYYPTSLQQSGQGQPGYYPTSLQQLGQG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QSGYYPTSPQQPGQGQQPGQLQQPAQGQQPGQGQQGQQPGQGQQGQQPGQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 GQQPGQGQPGYYPTSPQQSGQGQPGYYPTSSQQPTQSQQPGQGQQGQQVG

Sequence 1 --------------------------------------MKTFLILALLAI
           --------------------------------------------------
Sequence 2 QGQQAQQPGQGQQPGQGQPGYYPTSPQQSGQGQPGYYLTSPQQSGQGQQP

Sequence 1 VATTATTAVRVPVPQLQPQNPSQQQPQEQVPLVQQQQFLGQQQP--FP--
           ----------------Q-Q-P-Q-Q---Q----QQ-Q--GQ-QP---P--
Sequence 2 GQLQQSAQGQKGQQPGQGQQPGQGQQGQQPGQGQQGQQPGQGQPGYYPTS

Sequence 1 PQQPYPQPQPFPSQQPYLQLQPFLQPQLPYS----QP--QPFRPQQPYPQ
           PQQ-----QP---QQP--Q-QP---P--P------QP---P--PQQP---
Sequence 2 PQQSGQGQQPGQWQQPG-QGQPGYYPTSPLQPGQGQPGYDPTSPQQPGQG

Sequence 1 PQP-QYSQPQQPISQQQQQQQQQQQQQQQQQQQIIQQILQQQLIPCMDVV
           -QP-Q--QP-Q---QQ-QQ--Q-QQ-QQ--Q-Q--QQ--Q-Q--------
Sequence 2 QQPGQLQQPAQ--GQQGQQLAQGQQGQQPAQVQQGQQPAQGQ--QGQQLG

Sequence 1 LQQHNIVHGKSQVLQQST--YQLLQELCCQHLWQIPEQSQCQAIHNVVHA
           --Q-----G--Q--QQ-----Q--Q----QH--Q-P-Q-Q-Q--------
Sequence 2 QGQQGQQPGQGQQGQQPAQGQQGQQPGQGQHGQQ-PGQGQ-QG-------

Sequence 1 IILHQQQKQQQQPSSQVSFQQPLQQYPLGQGSFRPSQQNPQAQGSVQPQQ
           ----QQ--Q-QQP--------P------GQG---P-Q-----QG--QP--
Sequence 2 ----QQPGQGQQPGQGQPWYYPTSPQESGQGQ-QPGQWQQPGQG--QPGY

Sequence 1 LPQFEEIRNLALQTLPAMCNVYIPPYCTIAPFGIFGTN------------
           ---F--------Q----------------------G--------------
Sequence 2 YLTFSVAARTGQQGYYPTSLQQPGQGQQPGQWQQSGQGQHWYYPTSPKLS

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 GQGQRPGQWLQPGQGQQGYYPTSPQQPPQGQQLGQWLQPGQGQQGYYPTS

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 LQQTGQGQQSGQGQQGYYSSYHVSVEHQAASLKVAKAQQLAAQLPAMCRL

Sequence 1 ----------
           ----------
Sequence 2 EGGDALSASQ



Alignment 41
Sequence 1:
Sequence 2: Allergen Tri a glutenin, Sequence: CAA43331
Sequence identity: 31.01 (89/287)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 GIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQPGQGQQEYYLTSPQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QSGQWQQPGQGQAGYYPTSPQQSGQEQPGYYPTSPWQPEQLQQPTQGQQR

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQQPGQLQQLAQGQQGQQPER

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 GQQGQQSGQGQQLGQGQQGQQPGQKQQSGQGQQGYYPISPQQLGQGQQSG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QGQLGYYPTSPQQSGQGQSGYYPTSAQQPGQLQQSTQEQQLGQEQQDQQS

Sequence 1 ------------------MKTFLILALLAIVATTATTAVRVPVPQLQPQN
           ---------------------------------T---------P---P--
Sequence 2 GQGRQGQQSGQRQQDQQSGQGQQPGQRQPGYYSTSPQQLGQGQPRYYPTS

Sequence 1 PSQQQPQEQVPLVQQQQFLGQQ--QPFPPQQPYPQPQPFPSQQPYLQLQP
           P-QQ--QEQ-P---QQ---GQQ--QP---QQ-----Q----QQP--Q-Q-
Sequence 2 P-QQPGQEQQPRQLQQPEQGQQGQQPEQGQQGQQPGQGEQGQQPG-QGQQ

Sequence 1 FLQPQLPYSQPQPFRPQQ-----P--YPQPQPQYSQPQQPISQQQ--QQQ
           --QP--------P--PQQ-----P--YP----Q--Q-QQP---QQ--Q-Q
Sequence 2 GQQPGQGQPGYYPTSPQQSGQGQPGYYPTSPQQSGQLQQPAQGQQPGQEQ

Sequence 1 QQQQQQQQQQQQQIIQQILQQQLIPCMDVVLQQHNIVHGKSQVLQQSTYQ
           Q-QQ--Q-QQ-QQ--Q-----Q--P-------Q-----------QQS---
Sequence 2 QGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSPQQSGQEQQLEQWQQSGQG

Sequence 1 LLQELCCQHLWQIPEQSQCQAIHNVVHAIILHQQQKQQQQPSSQVSFQQP
           ---------L---P-Q-Q----------I---QQ--Q-QQP------QQP
Sequence 2 QPGHYPTSPLQ--PGQGQPGYYPTSPQQIGQGQQPGQLQQPTQGQQGQQP

Sequence 1 LQ----QYP-LGQGSFRPSQ-QNP-QAQGSVQPQQLPQFEEIRNLALQTL
           -Q----Q-P--GQ----P-Q-Q-P-Q-Q----P--L-Q------------
Sequence 2 GQGQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSLQQSGQGQQPGQWQQ

Sequence 1 PAMCNVYIPPYCTIAPFGIFGTN---------------------------
           P--------P-----P----------------------------------
Sequence 2 PGQGLPGYYPTSSLQPEQGQQGYYPTSQQQPGQGPQPGQWQQSGQGQQGY

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 YPTSPQQSGQGQQPGQWLQPGQWLQSGYYLTSPQQLGQGQQPRQWLQPRQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 GQQGYYPTSPQQSGQGQQLGQGQQGYYPTSPQQSGQGQQGYDSPYHVSAE

Sequence 1 ----------------------------------
           ----------------------------------
Sequence 2 HQAASLKVAKAQQLAAQLPAMCRLEGGDALLASQ



Alignment 42
Sequence 1:
Sequence 2: Allergen Tri a glutenin, Sequence: AAB02788
Sequence identity: 30.66 (88/287)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 GIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQEYYLTSPQQSGQWQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QPGQGQSGYYPTSPQQSGQKQPGYYPTSPWQPEQLQQPTQGQQRQQPGQG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QQLRQGQQGQQSGQGQPRYYPTSSQQPGQLQQLAQGQQGQQPERGQQGQQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 SGQGQQLGQGQQGQQPGQKQQSGQGQQGYYPISPQQLGQGQQSGQGQLGY

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 YPTSPQQSGQGQSGYYPTSAQQPGQLQQSTQEQQLGQEQQDQQSGQGRQG

Sequence 1 ------------MKTFLILALLAIVATTATTAVRVPVPQLQPQNPSQQQP
           ---------------------------T---------P---P--P-QQ--
Sequence 2 QQSGQRQQDQQSGQGQQPGQRQPGYYSTSPQQLGQGQPRYYPTSP-QQPG

Sequence 1 QEQVPLVQQQQFLGQ--QQPFPPQQPYPQPQPFPSQQPYLQLQPFLQPQL
           QEQ-P---QQ---GQ--QQP---QQ---Q-Q----QQP--Q-Q---QP--
Sequence 2 QEQQPRQLQQPEQGQQGQQPEQGQQGQQQRQGEQGQQPG-QGQQGQQPGQ

Sequence 1 PYSQPQPFRPQQPYPQPQPQY--SQPQQPISQQQQQQQQQQQQQQQQQQQ
           ------P--PQQ---Q-QP-Y----PQQ---Q-QQ--Q-QQ--Q-QQ-QQ
Sequence 2 GQPGYYPTSPQQS-GQGQPGYYPTSPQQS-GQLQQPAQGQQPGQEQQGQQ

Sequence 1 IIQQILQQQLIPCMDVVLQQHNIVHGKSQVLQQSTYQLLQELCCQHLWQI
           --Q-----Q--P-------Q-----------QQS------------L---
Sequence 2 PGQGQQPGQGQPGYYPTSPQQSGQEQQLEQWQQSGQGQPGHYPTSPLQ--

Sequence 1 PEQSQCQAIHNVVHAIILHQQQKQQQQPSSQVSFQQPLQ----QYP-LGQ
           P-Q-Q----------I---QQ--Q-QQP------QQP-Q----Q-P--GQ
Sequence 2 PGQGQPGYYPTSPQQIGQGQQPGQLQQPTQGQQGQQPGQGQQGQQPGEGQ

Sequence 1 GSFRPSQ-QNP-QAQGSVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCT
           ----P-Q-Q-P-Q-Q----P--L-Q------------P--------P---
Sequence 2 QGQQPGQGQQPGQGQPGYYPTSLQQSGQGQQPGQWQQPGQGQPGYYPTSS

Sequence 1 IAPFGIFGTN----------------------------------------
           --P-----------------------------------------------
Sequence 2 LQPEQGQQGYYPTSQQQPGQGPQPGQWQQSGQGQQGYYPTSPQQSGQGQQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 PGQWLQPGQWLQSGYYLTSPQQLGQGQQPRQWLQPRQGQQGYYPTSPQQS

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 GQGQQLGQGQQGYYPTSPQQSGQGQQGYDSPYHVSAEHQAASLKVAKAQQ

Sequence 1 ---------------------
           ---------------------
Sequence 2 LAAQLPAMCRLEGGDALLASQ



Alignment 43
Sequence 1:
Sequence 2: Allergen Tri a glutenin, Sequence: CAA43361
Sequence identity: 28.22 (81/287)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MAKRLVLFATVVITLVALTAAEGEASRQLQCERELQESSLEACRQVVDQQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 LAGRLPWSTGLQMRCCQQLRDVSAKCRPVAVSQVVRQYEQTVVPPKGGSF

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 YPGETTPLQQLQQVIFWGTSSQTVQGYYPSVSSPQQGPYYPGQASPQQPG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QGQQPGKWQELGQGQQGYYPTSLHQSGQGQQGYYPSSLQQPGQGQQIGQG

Sequence 1 ------------------------------------------MKTFLILA
           --------------------------------------------------
Sequence 2 QQGYYPTSLQQPGQGQQIGQGQQGYYPTSPQHPGQRQQPGQGQQIGQGQQ

Sequence 1 LLAIVATTATTAVRVPVPQLQPQNPSQQQPQEQVPLVQQQQFLGQQQPFP
           L--------------------P--P-QQ--Q-Q-P---QQ---GQQ---P
Sequence 2 LGQGRQIGQGQQSGQGQQGYYPTSP-QQLGQGQQPGQWQQSGQGQQGYYP

Sequence 1 PQQPYPQPQPFPSQQPYLQLQPF--LQPQLPYSQPQPFRPQQ-PYPQPQP
           --Q--P--Q----Q-P--Q-QP----Q-Q-P-SQ-QP---QQ--YP--Q-
Sequence 2 TSQQQPG-QGQQGQYPASQQQPGQGQQGQYPASQQQPGQGQQGQYPASQQ

Sequence 1 QYSQPQQPISQQQQQQQQQQQQQQQQQQQIIQQILQQQLIPCMDVVLQQH
           Q--Q-QQ--------QQQ--Q-QQ-------QQ--Q-Q--------LQQ-
Sequence 2 QPGQGQQ--GHYLASQQQPGQGQQRHYPASLQQPGQGQQ-GHYTASLQQP

Sequence 1 NIVHGKSQVLQQSTYQLLQELCCQHLWQIPEQSQCQAIHNVVHAIILHQ-
           ----G-------S--Q--Q----Q---Q-----Q------------L-Q-
Sequence 2 G--QGQQGHYPASLQQVGQG---QQIGQLGQRQQPGQGQQTRQGQQLEQG

Sequence 1 QQKQQQQPSSQVSFQQPLQQYPLGQGSFRPS--QQNPQAQGSVQPQQLPQ
           QQ--Q-Q---Q-------QQ---GQ----P---QQ--Q-Q---Q-QQ--Q
Sequence 2 QQPGQGQQTRQGQQLEQGQQPGQGQQGYYPTSPQQSGQGQQPGQSQQPGQ

Sequence 1 FEEIRNLALQTLPAMCNVYIPPYCTIAPFGIFGTN---------------
           ------------P--------P-----P----------------------
Sequence 2 GQQGYYSSSLQQPGQGLQGHYPASLQQPGQGHPGQRQQPGQGQQPEQGQQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 PGQGQQGYYPTSPQQPGQGKQLGQGQQGYYPTSPQQPGQGQQPGQGQQGH

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 CPTSPQQTGQAQQPGQGQQIGQVQQPGQGQQGYYPISLQQSGQGQQSGQG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QQSGQGHQLGQGQQSGQEQQGYDNPYHVNTEQQTASPKVAKVQQPATQLP

Sequence 1 ---------------
           ---------------
Sequence 2 IMCRMEGGDALSASQ



Alignment 44
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: CAA28208
Sequence identity: 16.03 (46/287)
Sequence 1 MKTFLILALLAIVATTATTAVRVPVPQLQPQNPSQQQPQEQVPLVQQQQF
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LGQQQPFPPQQPYPQPQPFPSQQPYLQLQPFLQPQLPYSQPQPFRPQQPY
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PQPQPQYSQPQQPISQQQQQQQQQQQQQQQQQQQIIQQILQQQLIPCMDV
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 VLQQHNIVHGKSQVLQQ-STYQLLQELCCQHLWQIPEQSQ-----CQAIH
           ------------Q--Q-------L-E---Q-----P-Q-------C-A--
Sequence 2 -VCALRGAAVPTQTIQPLRPFFFLPEQRNQQTCPLPPQQRGVLLSC-AFQ

Sequence 1 NVVHAIILHQQQKQQQQPSSQ------VSFQQPLQQYPLGQGSFRPSQQN
           N---------Q--QQQ----Q-------S--QP-QQ----Q----P-QQ-
Sequence 2 NQQQQVVFFEQITQQQISTFQPLQIFILSVSQPQQQQSQQQLGQQPQQQQ

Sequence 1 PQAQ-GS-VQPQQLPQFEEIRNLALQTLPAMCNVYIP--PYCTIAPFGIF
           --AQ-G---QPQQ--Q-E-----AL-TLP-MC-V--P-----T--PFG--
Sequence 2 QLAQQGTFLQPQQVAQLELMTSIALRTLPSMCRVNVPLSRTTTSVPFGGG

Sequence 1 GTN---
           ------
Sequence 2 AVGAYR


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.