The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

AALLVALLFVANAAAFRTTITTMEIDEDIDNPRRRGEGCREQIQRQQNLNHCQYYLRQQS
RSGGYDEDNQRQHFRQCCQQLSQMDEQCQCEGLRQVVRRQQQQQGLRGEEMEEMVQSARD
LPNECGISSQRCEIRRSWF
Sequence Info Allergen Name Length Opt Bits Score E Value
AAB41308 Jug r 1 139 970 75.9 4.4e-16
AAM54365 Jug n 1 161 941 74.3 1.6e-15
AAO32314 Car i 1.0101 143 861 69.0 5.4e-14
ACO56333 Cor a 14.0101 147 623 53.9 2e-09
CAA38363 Ber e 1 154 449 42.8 4.4e-06
AAA33010 Ber e 1 146 389 38.9 6.2e-05
P04403 Ber e 1 146 389 38.9 6.2e-05
Q39649 Cuc ma 5.0101 141 365 37.4 0.00018
AAL91665 Ana o 3 138 364 37.3 0.00019
DQ631675 Pis v 1.0101 149 362 37.2 0.00021
P01089 Ric c 1 258 357 37.6 0.00029
AAK15088 Ses i 1 153 300 33.3 0.0032
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Jug r 1 Sequence ID: AAB41308

 Score = 75.9 bits 970,  Expect = 4e-16
 Identities = 139/139 100%, Positives = 139/139 100%, Gaps = 0/139 0%
Query  1    AALLVALLFVANAAAFRTTITTMEIDEDIDNPRRRGEGCREQIQRQQNLNHCQYYLRQQS 60
            AALLVALLFVANAAAFRTTITTMEIDEDIDNPRRRGEGCREQIQRQQNLNHCQYYLRQQS
Sbjct  1    AALLVALLFVANAAAFRTTITTMEIDEDIDNPRRRGEGCREQIQRQQNLNHCQYYLRQQS 60
Query  61   RSGGYDEDNQRQHFRQCCQQLSQMDEQCQCEGLRQVVRRQQQQQGLRGEEMEEMVQSARD 120
            RSGGYDEDNQRQHFRQCCQQLSQMDEQCQCEGLRQVVRRQQQQQGLRGEEMEEMVQSARD
Sbjct  61   RSGGYDEDNQRQHFRQCCQQLSQMDEQCQCEGLRQVVRRQQQQQGLRGEEMEEMVQSARD 120
Query  121  LPNECGISSQRCEIRRSWF 139
            LPNECGISSQRCEIRRSWF
Sbjct  121  LPNECGISSQRCEIRRSWF 139

Sequence Alignment: 2. Allergen Name: Jug n 1 Sequence ID: AAM54365

 Score = 74.3 bits 941,  Expect = 2e-15
 Identities = 134/139 96%, Positives = 137/139 98%, Gaps = 0/139 0%
Query  1    AALLVALLFVANAAAFRTTITTMEIDEDIDNPRRRGEGCREQIQRQQNLNHCQYYLRQQS 60
            AALLVALLFVANAAAFRTTITTMEIDEDIDNPRRRGEGC+EQIQRQQNLNHCQYYLRQQS
Sbjct  23   AALLVALLFVANAAAFRTTITTMEIDEDIDNPRRRGEGCQEQIQRQQNLNHCQYYLRQQS 82
Query  61   RSGGYDEDNQRQHFRQCCQQLSQMDEQCQCEGLRQVVRRQQQQQGLRGEEMEEMVQSARD 120
            RSGGYDEDNQRQHFRQCCQQLSQ++EQCQCEGLRQ VRRQQQQQGLRGEEMEEMVQSARD
Sbjct  83   RSGGYDEDNQRQHFRQCCQQLSQIEEQCQCEGLRQAVRRQQQQQGLRGEEMEEMVQSARD 142
Query  121  LPNECGISSQRCEIRRSWF 139
            LP ECGISSQRCEIRRSWF
Sbjct  143  LPKECGISSQRCEIRRSWF 161

Sequence Alignment: 3. Allergen Name: Car i 1.0101 Sequence ID: AAO32314

 Score = 69.0 bits 861,  Expect = 5e-14
 Identities = 123/139 88%, Positives = 129/139 92%, Gaps = 0/139 0%
Query  1    AALLVALLFVANAAAFRTTITTMEIDEDIDNPRRRGEGCREQIQRQQNLNHCQYYLRQQS 60
            AALLVALLFVANAAAFRTTITTMEIDEDIDNPRRRGE CREQIQRQQ LN CQ YLRQQ 
Sbjct  5    AALLVALLFVANAAAFRTTITTMEIDEDIDNPRRRGESCREQIQRQQYLNRCQDYLRQQC 64
Query  61   RSGGYDEDNQRQHFRQCCQQLSQMDEQCQCEGLRQVVRRQQQQQGLRGEEMEEMVQSARD 120
            RSGGYDEDNQRQHFRQCCQQLSQM+EQCQCEGLRQ VR+QQQ++G+RGEEMEEMVQ A D
Sbjct  65   RSGGYDEDNQRQHFRQCCQQLSQMEEQCQCEGLRQAVRQQQQEEGIRGEEMEEMVQCASD 124
Query  121  LPNECGISSQRCEIRRSWF 139
            LP ECGISS+ CEIRRSWF
Sbjct  125  LPKECGISSRSCEIRRSWF 143

Sequence Alignment: 4. Allergen Name: Cor a 14.0101 Sequence ID: ACO56333

 Score = 53.9 bits 623,  Expect = 2e-09
 Identities = 93/137 67%, Positives = 116/137 84%, Gaps = 5/137 3%
Query  1    AALLVALLFVANAAAFRTTITTMEIDEDIDNPR-RRGEGCREQIQRQQNLNHCQYYLRQQ 59
            AAL+ ALL+VA+AAAFRTTITT+++DEDI N + RRGE CREQ QRQQNLN+CQ Y+RQQ
Sbjct  8    AALFAALLLVAHAAAFRTTITTVDVDEDIVNQQGRRGESCREQAQRQQNLNQCQRYMRQQ 67
Query  60   SRSGGYDEDNQRQH--FRQCCQQLSQMDEQCQCEGLRQVVRRQQQQQGLRGEEMEEMVQS 117
            S+ G YD  NQ+Q+  + QCCQQL QMDE+C+CEGLRQ V   QQQ  +RGEEM E++++
Sbjct  68   SQYGSYDGSNQQQQQELEQCCQQLRQMDERCRCEGLRQAV--MQQQGEMRGEEMREVMET 125
Query  118  ARDLPNECGISSQRCEIRRSWF 139
            ARDLPN+C +S QRCEIR + F
Sbjct  126  ARDLPNQCRLSPQRCEIRSARF 147

Sequence Alignment: 5. Allergen Name: Ber e 1 Sequence ID: CAA38363

 Score = 42.8 bits 449,  Expect = 4e-06
 Identities = 66/139 47%, Positives = 97/139 69%, Gaps = 8/139 5%
Query  1    AALLVALLFVANAAAFRTTITTMEIDEDIDNPRRRGEG-CREQIQRQQNLNHCQYYLRQQ 59
            AA L+ALL +  A AFRTT+TT   +E  +NPR R E  CREQ++RQQ LNHC+ YLRQQ
Sbjct  8    AAALLALLVLGQATAFRTTVTTTLEEEQEENPRGRSEQQCREQMERQQQLNHCRMYLRQQ 67
Query  60   SRSGGYDED-----NQRQHFRQCCQQLSQMDEQCQCEGLRQVVRRQQQQQGLRGEEMEEM 114
                 Y         +  H+ +CC+QL +MDE C+CEGLR ++RRQ+++  L+GE+M+ +
Sbjct  68   MEESPYQNPRPLRRGEEPHLDECCEQLERMDEMCRCEGLRMMLRRQREEMELQGEQMQRI 127
Query  115  VQSARDLPNECGISSQRCEI--RRSWF 139
            ++ A +L + C +S QRC +    +W+
Sbjct  128  MRKAENLLSRCNLSPQRCPMGGYTAWL 154

Sequence Alignment: 6. Allergen Name: Ber e 1 Sequence ID: AAA33010

 Score = 38.9 bits 389,  Expect = 6e-05
 Identities = 58/128 45%, Positives = 86/128 67%, Gaps = 10/128 7%
Query  1    AALLVALLFVANAAAFRTTITTMEIDEDIDNPRRRGEGCREQIQRQQNLNHCQYYLRQQS 60
            AA L+ L+ + +A AFR T+TT  ++E+        E CREQ+QRQQ L+HC+ Y+RQQ 
Sbjct  8    AAALLVLMALGHATAFRATVTTTVVEEENQ------EECREQMQRQQMLSHCRMYMRQQM 61
Query  61   RSGGYDEDNQR---QHFRQCCQQLSQMDEQCQCEGLRQVVRRQQQQQGL-RGEEMEEMVQ 116
                Y    +R    H  +CC+QL  MDE C+CEGLR ++ R QQ++   RGE+M  M++
Sbjct  62   EESPYQTMPRRGMEPHMSECCEQLEGMDESCRCEGLRMMMMRMQQEEMQPRGEQMRRMMR 121
Query  117  SARDLPNECGISSQRCEI 134
             A ++P+ C +S  RC +
Sbjct  122  LAENIPSRCNLSPMRCPM 139

Sequence Alignment: 7. Allergen Name: Ber e 1 Sequence ID: P04403

 Score = 38.9 bits 389,  Expect = 6e-05
 Identities = 58/128 45%, Positives = 86/128 67%, Gaps = 10/128 7%
Query  1    AALLVALLFVANAAAFRTTITTMEIDEDIDNPRRRGEGCREQIQRQQNLNHCQYYLRQQS 60
            AA L+ L+ + +A AFR T+TT  ++E+        E CREQ+QRQQ L+HC+ Y+RQQ 
Sbjct  8    AAALLVLMALGHATAFRATVTTTVVEEENQ------EECREQMQRQQMLSHCRMYMRQQM 61
Query  61   RSGGYDEDNQR---QHFRQCCQQLSQMDEQCQCEGLRQVVRRQQQQQGL-RGEEMEEMVQ 116
                Y    +R    H  +CC+QL  MDE C+CEGLR ++ R QQ++   RGE+M  M++
Sbjct  62   EESPYQTMPRRGMEPHMSECCEQLEGMDESCRCEGLRMMMMRMQQEEMQPRGEQMRRMMR 121
Query  117  SARDLPNECGISSQRCEI 134
             A ++P+ C +S  RC +
Sbjct  122  LAENIPSRCNLSPMRCPM 139

Sequence Alignment: 8. Allergen Name: Cuc ma 5.0101 Sequence ID: Q39649

 Score = 37.4 bits 365,  Expect = 0.0002
 Identities = 59/126 46%, Positives = 91/126 72%, Gaps = 12/126 9%
Query  2    ALLVALLFVANAAAFRTTITTMEIDEDIDNPRRRGEGCREQIQRQQNLNHCQYYLRQQSR 61
            AL+   L+VA+A A+RTTITT+E++E   N + R E CR Q+  ++ L  C+ YLRQQSR
Sbjct  9    ALFAVALLVADAYAYRTTITTVEVEE---NRQGREERCR-QMSAREELRSCEQYLRQQSR 64
Query  62   S----GGYDEDNQRQ--HFRQCCQQLSQMDEQCQCEGLRQVVRRQQQQQGLRGEEMEEMV 115
                  G +   +R+   F +CC++L  +DE+C+C+ L ++ R +Q+Q   RG+E  +M+
Sbjct  65   DVLQMRGIENPWRREGGSFDECCRELKNVDEECRCDMLEEIAREEQRQA--RGQEGRQML 122
Query  116  QSARDLPNECGISSQRCE 133
            Q AR+LP+ CGI  QRC+
Sbjct  123  QKARNLPSMCGIRPQRCD 140

Sequence Alignment: 9. Allergen Name: Ana o 3 Sequence ID: AAL91665

 Score = 37.3 bits 364,  Expect = 0.0002
 Identities = 54/126 42%, Positives = 91/126 72%, Gaps = 11/126 8%
Query  4    LVALLFVANAAAFRTTITTMEIDEDIDNPRRRGEGCREQIQRQQNLNHCQYYLRQQSRSG 63
            +  LL+VANA+ +R  +   E++ED      R + C+ Q + QQ + +CQ Y++Q+ + G
Sbjct  11   FAVLLLVANASIYRAIV---EVEEDSG----REQSCQRQFEEQQRFRNCQRYVKQEVQRG 63
Query  64   GYDEDNQRQH-FRQCCQQLSQMDEQCQCEGLRQVVRRQQQQQGLRGEEMEEMVQSARDLP 122
            G    NQRQ  +R+CCQ+L ++D +C+C+ L Q+VR+ QQQ+ ++GEE+ E+ ++A +LP
Sbjct  64   G--RYNQRQESLRECCQELQEVDRRCRCQNLEQMVRQLQQQEQIKGEEVRELYETASELP 121
Query  123  NECGIS-SQRCEIRRSW 138
              C IS SQ C+ + S+
Sbjct  122  RICSISPSQGCQFQSSY 138

Sequence Alignment: 10. Allergen Name: Pis v 1.0101 Sequence ID: DQ631675

 Score = 37.2 bits 362,  Expect = 0.0002
 Identities = 54/120 45%, Positives = 92/120 76%, Gaps = 15/120 12%
Query  7    LLFVANAAAFRTTITTMEID-EDIDNPRRRGEGCREQIQRQQNLNHCQYYLRQ--QSRSG 63
            L++ ANA+ +R T+   E++ E++ +    G+ C++Q + QQ + HCQ Y++Q  Q    
Sbjct  14   LILAANASIYRATV---EVEGENLSS----GQSCQKQFEEQQKFKHCQMYVQQEVQKSQD 66
Query  64   GYDED---NQRQH-FRQCCQQLSQMDEQCQCEGLRQVVRRQQQQQGLRGEEMEEMVQSAR 119
            G+      NQRQ+ F+QCCQ+L ++D++C+C+ L Q+V+RQQQQ  +RGE+++E+ ++A 
Sbjct  67   GHSLTARINQRQQCFKQCCQELQEVDKKCRCQNLEQMVKRQQQQGQFRGEKLQELYETAS 126
Query  120  DLPNECGIS-SQRCE 133
            +LP  C IS SQ C+
Sbjct  127  ELPRMCNISPSQGCQ 141

Sequence Alignment: 11. Allergen Name: Ric c 1 Sequence ID: P01089

 Score = 37.6 bits 357,  Expect = 0.0003
 Identities = 49/100 49%, Positives = 69/100 69%, Gaps = 3/100 3%
Query  31   NPRRRGEGCREQIQRQQNLNHCQYYLRQQ-SRSGGYDEDNQRQHFRQCCQQLSQMDEQCQ 89
            NP +  +GCR QIQ QQNL +CQ Y++QQ S  G    DNQ + +R CC +L QM  QC+
Sbjct  156  NPSQ--QGCRGQIQEQQNLRQCQEYIKQQVSGQGPRRSDNQERSLRGCCDHLKQMQSQCR 213
Query  90   CEGLRQVVRRQQQQQGLRGEEMEEMVQSARDLPNECGISSQRC 132
            CEGLRQ + +QQ Q  L+G+++ E  ++A +LP+ CG+S   C
Sbjct  214  CEGLRQAIEQQQSQGQLQGQDVFEAFRTAANLPSMCGVSPTEC 256

Sequence Alignment: 12. Allergen Name: Ses i 1 Sequence ID: AAK15088

 Score = 33.3 bits 300,  Expect = 0.003
 Identities = 59/131 45%, Positives = 89/131 67%, Gaps = 14/131 10%
Query  1    AALLVALLFVANAAAFRTTITTMEIDEDIDNPRRRGEGCREQIQRQQNLNHCQYYLRQQS 60
            A LLVA++ +A+A  + TT+TT  ID   D   ++ + CR+Q+Q +Q +  CQ YL Q  
Sbjct  9    AVLLVAMVALASATTYTTTVTTTAID---DEANQQSQQCRQQLQGRQ-FRSCQRYLSQGR 64
Query  61   RSGGYDED--------NQR--QHFRQCCQQLSQMDEQCQCEGLRQVVRRQQQQQGLRGEE 110
               G +ED        NQ+  Q +R CCQQL  +DE+C+CE +RQ VR+QQQ+ G +  +
Sbjct  65   SPYGGEEDEVLEMSTGNQQSEQSLRDCCQQLRNVDERCRCEAIRQAVRQQQQEGGYQEGQ 124
Query  111  MEEMVQSARDLPNECGISSQRCEIR 135
             +++ Q ARDLP  C +  Q+C+ R
Sbjct  125  SQQVYQRARDLPRRCNMRPQQCQFR 149

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.