The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

ACAHLCKEADLKTALEACKAADSFNFKTFFHTLGFASKXXDDVKKXXXVLDQDASGFLEV
EELKLFLQNFCPKXXXLTDAETKAFLKAGDADGDGMLGLDEFAVLVKQ
Sequence Info Allergen Name Length Opt Bits Score E Value
P86431 Onc m 1.0101 108 651 102.3 3e-24
Q91482 Sal s 1 109 623 98.4 4.5e-23
FM177701 Sar sa 1.0101 109 441 73.0 2e-15
QCY53440 Cten i 1.0101 109 431 71.6 5.3e-15
CAQ72970 Clu h 1.0101 109 429 71.3 6.4e-15
CAC83659 Cyp c 1.02 109 429 71.3 6.4e-15
CAC83658 Cyp c 1.01 109 428 71.2 7e-15
Q5IRB2 Lat c 1.0101 109 422 70.4 1.3e-14
CAQ72971 Clu h 1.0201 110 422 70.4 1.3e-14
Q91483 Sal s 1 107 419 69.9 1.7e-14
CAA66404 Sal s 1 108 419 69.9 1.7e-14
CAQ72967 Thu a 1.0101 109 419 70.0 1.7e-14
CAQ72972 Clu h 1.0301 109 409 68.6 4.4e-14
Q90YK7 The c 1 109 408 68.4 4.9e-14
A0A1B1V0G7 Ras k 1.0101 109 406 68.1 5.9e-14
P59747 Sco j 1 109 405 68.0 6.5e-14
FM202668 Xip g 1.0101 109 402 67.6 8.7e-14
XP_026772003 Pan h 1.0101 109 395 66.6 1.7e-13
AAK63086 Gad m 1.0101 109 395 66.6 1.7e-13
P86432 Onc m 1.0201 107 394 66.4 1.9e-13
CAQ72969 Seb m 1.0201 110 393 66.3 2.1e-13
CAQ72968 Seb m 1.0101 109 392 66.2 2.3e-13
XP_019397705 Cro p 1.0101 109 391 66.0 2.5e-13
CAM56785 Gad m 1.0102 109 389 65.8 3.1e-13
CAM56786 Gad m 1.0202 109 379 64.4 8.1e-13
Q90YK9 Gad m 1.0201 109 378 64.2 8.9e-13
AAK63087 Gad m 1.0201 109 378 64.2 8.9e-13
Q6ITU9 Lat c 1.0201 109 376 63.9 1.1e-12
CAC95152 Ran e 2 109 367 62.7 2.6e-12
AM904681 Lep w 1.0101 109 355 61.0 8.2e-12
C1L370 Gal d 8.0101 110 340 58.9 3.5e-11
XP_019400389 Cro p 2.0101 110 328 57.3 1.1e-10
XP_026803769 Pan h 1.0201 109 325 56.8 1.5e-10
CAC83046 Ran e 1 110 307 54.3 8.6e-10
P02622 Gad c 1 113 307 54.3 8.7e-10
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Onc m 1.0101 Sequence ID: P86431

 Score = 102.3 bits 651,  Expect = 3e-24
 Identities = 108/108 100%, Positives = 100/108 92%, Gaps = 0/108 0%
Query  1    ACAHLCKEADLKTALEACKAADSFNFKTFFHTLGFASKXXDDVKKXXXVLDQDASGFLEV 60
            ACAHLCKEADLKTALEACKAADSFNFKTFFHTLGFASKXXDDVKKXXXVLDQDASGFLEV
Sbjct  1    ACAHLCKEADLKTALEACKAADSFNFKTFFHTLGFASKXXDDVKKXXXVLDQDASGFLEV 60
Query  61   EELKLFLQNFCPKXXXLTDAETKAFLKAGDADGDGMLGLDEFAVLVKQ 108
            EELKLFLQNFCPKXXXLTDAETKAFLKAGDADGDGMLGLDEFAVLVKQ
Sbjct  61   EELKLFLQNFCPKXXXLTDAETKAFLKAGDADGDGMLGLDEFAVLVKQ 108

Sequence Alignment: 2. Allergen Name: Sal s 1 Sequence ID: Q91482

 Score = 98.4 bits 623,  Expect = 4e-23
 Identities = 92/108 85%, Positives = 100/108 92%, Gaps = 0/108 0%
Query  1    ACAHLCKEADLKTALEACKAADSFNFKTFFHTLGFASKXXDDVKKXXXVLDQDASGFLEV 60
            ACAHLCKEAD+KTALEACKAAD+F+FKTFFHT+GFASK  DDVKK   V+DQDASGF+EV
Sbjct  2    ACAHLCKEADIKTALEACKAADTFSFKTFFHTIGFASKSADDVKKAFKVIDQDASGFIEV 61
Query  61   EELKLFLQNFCPKXXXLTDAETKAFLKAGDADGDGMLGLDEFAVLVKQ 108
            EELKLFLQNFCPK   LTDAETKAFLKAGDADGDGM+G+DEFAVLVKQ
Sbjct  62   EELKLFLQNFCPKARELTDAETKAFLKAGDADGDGMIGIDEFAVLVKQ 109

Sequence Alignment: 3. Allergen Name: Sar sa 1.0101 Sequence ID: FM177701

 Score = 73.0 bits 441,  Expect = 2e-15
 Identities = 68/108 62%, Positives = 80/108 74%, Gaps = 0/108 0%
Query  1    ACAHLCKEADLKTALEACKAADSFNFKTFFHTLGFASKXXDDVKKXXXVLDQDASGFLEV 60
            A A L KEAD+  ALEACKAADSF+ K FFH +G + K  D++KK   ++DQD SGF+E 
Sbjct  2    ALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAIIDQDKSGFIEE 61
Query  61   EELKLFLQNFCPKXXXLTDAETKAFLKAGDADGDGMLGLDEFAVLVKQ 108
            EELKLFLQNFC K   LTD ETK FLKAGD  GDG +G+DEF  LVK+
Sbjct  62   EELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGIDEFNHLVKH 109

Sequence Alignment: 4. Allergen Name: Cten i 1.0101 Sequence ID: QCY53440

 Score = 71.6 bits 431,  Expect = 5e-15
 Identities = 67/107 62%, Positives = 81/107 75%, Gaps = 0/107 0%
Query  1    ACAHLCKEADLKTALEACKAADSFNFKTFFHTLGFASKXXDDVKKXXXVLDQDASGFLEV 60
            A A +  +AD+  ALEACKAADSFN K FF  +G+++K  DDVKK   ++DQD SGF+E 
Sbjct  2    AFAGILNDADIAAALEACKAADSFNHKAFFAKVGLSAKSGDDVKKAFAIIDQDKSGFIEE 61
Query  61   EELKLFLQNFCPKXXXLTDAETKAFLKAGDADGDGMLGLDEFAVLVK 107
            +ELKLFLQNF      LTDAETK FLKAGD+DGDG +G+DEFA LVK
Sbjct  62   DELKLFLQNFKADARALTDAETKIFLKAGDSDGDGKIGVDEFAALVK 108

Sequence Alignment: 5. Allergen Name: Clu h 1.0101 Sequence ID: CAQ72970

 Score = 71.3 bits 429,  Expect = 6e-15
 Identities = 67/107 62%, Positives = 81/107 75%, Gaps = 0/107 0%
Query  1    ACAHLCKEADLKTALEACKAADSFNFKTFFHTLGFASKXXDDVKKXXXVLDQDASGFLEV 60
            A A L K AD+  AL+AC+A DSF  K FF  +G+A+K   D+KK   ++DQD SGF+E 
Sbjct  2    ALASLLKGADIDAALKACEAKDSFKHKDFFAKIGLATKSAADLKKAFEIIDQDKSGFIEE 61
Query  61   EELKLFLQNFCPKXXXLTDAETKAFLKAGDADGDGMLGLDEFAVLVK 107
            EELKLFLQNF      LTDAETKAFLKAGDADGDGM+G+DEFAV++K
Sbjct  62   EELKLFLQNFKAGARALTDAETKAFLKAGDADGDGMIGVDEFAVMIK 108

Sequence Alignment: 6. Allergen Name: Cyp c 1.02 Sequence ID: CAC83659

 Score = 71.3 bits 429,  Expect = 6e-15
 Identities = 67/107 62%, Positives = 79/107 73%, Gaps = 0/107 0%
Query  1    ACAHLCKEADLKTALEACKAADSFNFKTFFHTLGFASKXXDDVKKXXXVLDQDASGFLEV 60
            A A +  +AD+  ALEACKAADSFN KTFF  +G+ SK  DDVKK   ++DQD SGF+E 
Sbjct  2    AFAGVLNDADITAALEACKAADSFNHKTFFAKVGLTSKSADDVKKAFAIIDQDKSGFIEE 61
Query  61   EELKLFLQNFCPKXXXLTDAETKAFLKAGDADGDGMLGLDEFAVLVK 107
            +ELKLFLQNF      LTD ETK FLKAGD+DGDG +G+DEF  LVK
Sbjct  62   DELKLFLQNFKAGARALTDGETKTFLKAGDSDGDGKIGVDEFTALVK 108

Sequence Alignment: 7. Allergen Name: Cyp c 1.01 Sequence ID: CAC83658

 Score = 71.2 bits 428,  Expect = 7e-15
 Identities = 64/107 59%, Positives = 83/107 77%, Gaps = 0/107 0%
Query  1    ACAHLCKEADLKTALEACKAADSFNFKTFFHTLGFASKXXDDVKKXXXVLDQDASGFLEV 60
            A A +  +AD+  AL+ C+AADSF++K+FF  +G+++K  DD+KK   V+DQD SGF+E 
Sbjct  2    AFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIEE 61
Query  61   EELKLFLQNFCPKXXXLTDAETKAFLKAGDADGDGMLGLDEFAVLVK 107
            +ELKLFLQNF      LTDAETKAFLKAGD+DGDG +G+DEFA LVK
Sbjct  62   DELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALVK 108

Sequence Alignment: 8. Allergen Name: Lat c 1.0101 Sequence ID: Q5IRB2

 Score = 70.4 bits 422,  Expect = 1e-14
 Identities = 67/107 62%, Positives = 78/107 72%, Gaps = 0/107 0%
Query  1    ACAHLCKEADLKTALEACKAADSFNFKTFFHTLGFASKXXDDVKKXXXVLDQDASGFLEV 60
            A A +  EAD+  AL AC+AADSF  K FF  +G+A K  DDVKK   V+DQD SGF+E 
Sbjct  2    AFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIEE 61
Query  61   EELKLFLQNFCPKXXXLTDAETKAFLKAGDADGDGMLGLDEFAVLVK 107
            +ELKLFLQNF      LTDAETK FLKAGD+DGDG +G+DEFA LVK
Sbjct  62   DELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALVK 108

Sequence Alignment: 9. Allergen Name: Clu h 1.0201 Sequence ID: CAQ72971

 Score = 70.4 bits 422,  Expect = 1e-14
 Identities = 65/107 60%, Positives = 80/107 74%, Gaps = 0/107 0%
Query  1    ACAHLCKEADLKTALEACKAADSFNFKTFFHTLGFASKXXDDVKKXXXVLDQDASGFLEV 60
            A A L  +AD+  AL AC AAD+F+ K+FF  +G++ K  DDVKK   ++DQD SGF+E 
Sbjct  2    AFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFIEE 61
Query  61   EELKLFLQNFCPKXXXLTDAETKAFLKAGDADGDGMLGLDEFAVLVK 107
            EELKLFLQNF      L+D ETKAFL AGDADGDGM+G+DEFAV+VK
Sbjct  62   EELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMVK 108

Sequence Alignment: 10. Allergen Name: Sal s 1 Sequence ID: Q91483

 Score = 69.9 bits 419,  Expect = 2e-14
 Identities = 64/100 64%, Positives = 75/100 75%, Gaps = 0/100 0%
Query  8    EADLKTALEACKAADSFNFKTFFHTLGFASKXXDDVKKXXXVLDQDASGFLEVEELKLFL 67
            +AD+  AL AC AADSFN K FF  +G+ASK  DDVKK   V+DQD SGF+E +ELKLFL
Sbjct  7    DADVAAALAACTAADSFNHKAFFAKVGLASKSSDDVKKAFYVIDQDKSGFIEEDELKLFL 66
Query  68   QNFCPKXXXLTDAETKAFLKAGDADGDGMLGLDEFAVLVK 107
            QNF      LTDAETKAFL  GD DGDGM+G+DEFA ++K
Sbjct  67   QNFSASARALTDAETKAFLADGDKDGDGMIGVDEFAAMIK 106

Sequence Alignment: 11. Allergen Name: Sal s 1 Sequence ID: CAA66404

 Score = 69.9 bits 419,  Expect = 2e-14
 Identities = 64/100 64%, Positives = 75/100 75%, Gaps = 0/100 0%
Query  8    EADLKTALEACKAADSFNFKTFFHTLGFASKXXDDVKKXXXVLDQDASGFLEVEELKLFL 67
            +AD+  AL AC AADSFN K FF  +G+ASK  DDVKK   V+DQD SGF+E +ELKLFL
Sbjct  8    DADVAAALAACTAADSFNHKAFFAKVGLASKSSDDVKKAFYVIDQDKSGFIEEDELKLFL 67
Query  68   QNFCPKXXXLTDAETKAFLKAGDADGDGMLGLDEFAVLVK 107
            QNF      LTDAETKAFL  GD DGDGM+G+DEFA ++K
Sbjct  68   QNFSASARALTDAETKAFLADGDKDGDGMIGVDEFAAMIK 107

Sequence Alignment: 12. Allergen Name: Thu a 1.0101 Sequence ID: CAQ72967

 Score = 70.0 bits 419,  Expect = 2e-14
 Identities = 65/107 60%, Positives = 80/107 74%, Gaps = 0/107 0%
Query  1    ACAHLCKEADLKTALEACKAADSFNFKTFFHTLGFASKXXDDVKKXXXVLDQDASGFLEV 60
            A A +  EAD+  AL AC+AADSF +K FF  +G+A+K  +D+KK   V+DQD SGF+E 
Sbjct  2    AFAGILTEADITAALAACQAADSFKYKDFFTKVGLAAKTPEDIKKAFAVIDQDKSGFIEE 61
Query  61   EELKLFLQNFCPKXXXLTDAETKAFLKAGDADGDGMLGLDEFAVLVK 107
            +ELKLFLQNF      LTDAETKAFL AGD+DGDG +G+DEFA LVK
Sbjct  62   DELKLFLQNFSAGARALTDAETKAFLMAGDSDGDGKIGIDEFAALVK 108

Sequence Alignment: 13. Allergen Name: Clu h 1.0301 Sequence ID: CAQ72972

 Score = 68.6 bits 409,  Expect = 4e-14
 Identities = 62/108 57%, Positives = 77/108 71%, Gaps = 0/108 0%
Query  1    ACAHLCKEADLKTALEACKAADSFNFKTFFHTLGFASKXXDDVKKXXXVLDQDASGFLEV 60
            A A + KEAD+  AL ACK ADSF+ K FF  +G+  K  D++KK   ++DQD SGF+E 
Sbjct  2    AFAAFLKEADITAALGACKGADSFDHKAFFAKVGLKGKSGDELKKAFEIIDQDKSGFIEE 61
Query  61   EELKLFLQNFCPKXXXLTDAETKAFLKAGDADGDGMLGLDEFAVLVKQ 108
            EELKLFLQNFC     LTD ETK FLKAGD+D DG +G+DEFA L+ +
Sbjct  62   EELKLFLQNFCKGARALTDGETKKFLKAGDSDNDGKIGIDEFAALINH 109

Sequence Alignment: 14. Allergen Name: The c 1 Sequence ID: Q90YK7

 Score = 68.4 bits 408,  Expect = 5e-14
 Identities = 63/107 58%, Positives = 79/107 73%, Gaps = 0/107 0%
Query  1    ACAHLCKEADLKTALEACKAADSFNFKTFFHTLGFASKXXDDVKKXXXVLDQDASGFLEV 60
            A A + K+A++  ALEACK+A SF+   FF + G+A K  DDVKK   ++DQD S F+E 
Sbjct  2    AFAGILKDAEVAAALEACKSAGSFDHTKFFKSCGLAGKSSDDVKKAFGIIDQDQSDFIEE 61
Query  61   EELKLFLQNFCPKXXXLTDAETKAFLKAGDADGDGMLGLDEFAVLVK 107
            EELKLFLQNF      L+DAETKAFLKAGD+DGDG +G+DEFA +VK
Sbjct  62   EELKLFLQNFSASARALSDAETKAFLKAGDSDGDGKIGVDEFAAMVK 108

Sequence Alignment: 15. Allergen Name: Ras k 1.0101 Sequence ID: A0A1B1V0G7

 Score = 68.1 bits 406,  Expect = 6e-14
 Identities = 62/107 57%, Positives = 77/107 71%, Gaps = 0/107 0%
Query  1    ACAHLCKEADLKTALEACKAADSFNFKTFFHTLGFASKXXDDVKKXXXVLDQDASGFLEV 60
            A A + K+A++  AL+ CKA  SF+ K FF   G+A K  DDVKK   ++DQD SGF+E 
Sbjct  2    AFASVLKDAEITAALDGCKADGSFDHKKFFKACGLAGKSGDDVKKAFAIIDQDKSGFIEE 61
Query  61   EELKLFLQNFCPKXXXLTDAETKAFLKAGDADGDGMLGLDEFAVLVK 107
            EELKLFLQNF      L+DAETKAFLKAGD DGDG +G+DEFA ++K
Sbjct  62   EELKLFLQNFKAGARTLSDAETKAFLKAGDTDGDGKIGVDEFAAMIK 108

Sequence Alignment: 16. Allergen Name: Sco j 1 Sequence ID: P59747

 Score = 68.0 bits 405,  Expect = 7e-14
 Identities = 61/107 57%, Positives = 79/107 73%, Gaps = 0/107 0%
Query  1    ACAHLCKEADLKTALEACKAADSFNFKTFFHTLGFASKXXDDVKKXXXVLDQDASGFLEV 60
            A A + K+A++  AL+ CKAA SF+ K FF   G++ K  D+VKK   ++DQD SGF+E 
Sbjct  2    AFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIEE 61
Query  61   EELKLFLQNFCPKXXXLTDAETKAFLKAGDADGDGMLGLDEFAVLVK 107
            EELKLFLQNF      L+DAETKAFLKAGD+DGDG +G+DEFA ++K
Sbjct  62   EELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGIDEFAAMIK 108

Sequence Alignment: 17. Allergen Name: Xip g 1.0101 Sequence ID: FM202668

 Score = 67.6 bits 402,  Expect = 9e-14
 Identities = 62/106 58%, Positives = 79/106 74%, Gaps = 0/106 0%
Query  1    ACAHLCKEADLKTALEACKAADSFNFKTFFHTLGFASKXXDDVKKXXXVLDQDASGFLEV 60
            A A +  +AD+  ALEACK A +F++K FF + G+A+K  DDVKK   ++DQD SGF+E 
Sbjct  2    AFAGVLSDADVAAALEACKDAGTFDYKKFFKSCGLAAKSTDDVKKAFAIIDQDKSGFIEE 61
Query  61   EELKLFLQNFCPKXXXLTDAETKAFLKAGDADGDGMLGLDEFAVLV 106
            +ELKLFLQNF      LTDAET+AFLKAGD+DGDG +G +EFA LV
Sbjct  62   DELKLFLQNFKAAARPLTDAETEAFLKAGDSDGDGKIGAEEFAALV 107

Sequence Alignment: 18. Allergen Name: Pan h 1.0101 Sequence ID: XP_026772003

 Score = 66.6 bits 395,  Expect = 2e-13
 Identities = 62/107 57%, Positives = 75/107 70%, Gaps = 0/107 0%
Query  1    ACAHLCKEADLKTALEACKAADSFNFKTFFHTLGFASKXXDDVKKXXXVLDQDASGFLEV 60
            A A +  +AD+  AL+ACKA  SF+ K FF  +G+  K  DDVKK   ++DQD SGF+E 
Sbjct  2    AFAGVLNDADIAAALDACKADGSFDHKAFFTKVGLTGKSADDVKKAFSIIDQDKSGFIEE 61
Query  61   EELKLFLQNFCPKXXXLTDAETKAFLKAGDADGDGMLGLDEFAVLVK 107
            +ELKLFLQNF      LTD ETK FLKAGD DGDG +G+DEFA LVK
Sbjct  62   DELKLFLQNFKSDARALTDNETKIFLKAGDTDGDGKIGVDEFASLVK 108

Sequence Alignment: 19. Allergen Name: Gad m 1.0101 Sequence ID: AAK63086

 Score = 66.6 bits 395,  Expect = 2e-13
 Identities = 62/107 57%, Positives = 80/107 74%, Gaps = 0/107 0%
Query  1    ACAHLCKEADLKTALEACKAADSFNFKTFFHTLGFASKXXDDVKKXXXVLDQDASGFLEV 60
            A A +  +AD   A++AC+AA+SF++K FF   G++ K  DD+KK   V+DQD SGF+E 
Sbjct  2    AFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIEE 61
Query  61   EELKLFLQNFCPKXXXLTDAETKAFLKAGDADGDGMLGLDEFAVLVK 107
            +ELKLFLQ F      LTDAETKAFLKAGD+DGDG +G+DE+AVLVK
Sbjct  62   DELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLVK 108

Sequence Alignment: 20. Allergen Name: Onc m 1.0201 Sequence ID: P86432

 Score = 66.4 bits 394,  Expect = 2e-13
 Identities = 68/101 67%, Positives = 69/101 68%, Gaps = 0/101 0%
Query  8    EADLKTALEACKAADSFNFKTFFHTLGFASKXXDDVKKXXXVLDQDASGFLEVEELKLFL 67
            +AD+  AL AC AADSFN K FF          DD+KKXXX LDQD SGFLE +ELKLFL
Sbjct  7    DADVAAALAACAAADSFNHKAFFAKXXXXXXSPDDLKKXXXXLDQDKSGFLEEDELKLFL 66
Query  68   QNFCPKXXXLTDAETKAFLKAGDADGDGMLGLDEFAVLVKQ 108
            QNF      LTDAETK    AGDADGDGMLGLDEFAVLVKQ
Sbjct  67   QNFSASARALTDAETKXXXXAGDADGDGMLGLDEFAVLVKQ 107

Sequence Alignment: 21. Allergen Name: Seb m 1.0201 Sequence ID: CAQ72969

 Score = 66.3 bits 393,  Expect = 2e-13
 Identities = 60/102 58%, Positives = 74/102 72%, Gaps = 0/102 0%
Query  7    KEADLKTALEACKAADSFNFKTFFHTLGFASKXXDDVKKXXXVLDQDASGFLEVEELKLF 66
            K+AD+  AL+ CK A  FN KTFF T G++ K  D+VKK   ++DQD SGF+E EELKLF
Sbjct  9    KDADIAAALDGCKDAGKFNHKTFFKTCGLSGKSSDEVKKAFAIIDQDISGFIEEEELKLF 68
Query  67   LQNFCPKXXXLTDAETKAFLKAGDADGDGMLGLDEFAVLVKQ 108
            LQ F      L+DAETK FLKAGD+DGDG +G DE+A +VKQ
Sbjct  69   LQTFKAGARALSDAETKEFLKAGDSDGDGKIGADEWAAMVKQ 110

Sequence Alignment: 22. Allergen Name: Seb m 1.0101 Sequence ID: CAQ72968

 Score = 66.2 bits 392,  Expect = 2e-13
 Identities = 58/99 58%, Positives = 72/99 72%, Gaps = 0/99 0%
Query  9    ADLKTALEACKAADSFNFKTFFHTLGFASKXXDDVKKXXXVLDQDASGFLEVEELKLFLQ 68
            AD+  AL AC   D+F  K FF  +G+++K  DD+K    V+DQD SGF+E EELKLFLQ
Sbjct  10   ADITAALAACSGVDTFKHKDFFGKVGLSAKSADDIKNAFKVIDQDKSGFIEEEELKLFLQ 69
Query  69   NFCPKXXXLTDAETKAFLKAGDADGDGMLGLDEFAVLVK 107
            NF      LT+AET AFLKAGD+DGDGM+G+DEFA +VK
Sbjct  70   NFSATARALTEAETTAFLKAGDSDGDGMIGMDEFAAMVK 108

Sequence Alignment: 23. Allergen Name: Cro p 1.0101 Sequence ID: XP_019397705

 Score = 66.0 bits 391,  Expect = 3e-13
 Identities = 58/98 59%, Positives = 74/98 75%, Gaps = 0/98 0%
Query  10   DLKTALEACKAADSFNFKTFFHTLGFASKXXDDVKKXXXVLDQDASGFLEVEELKLFLQN 69
            D++ AL +C+AA+SFN+K+FF T+G+  K  D VKK   +LDQD SGF+E +EL+LFL+N
Sbjct  11   DIEAALSSCQAAESFNYKSFFSTVGLKGKSADQVKKVFGILDQDKSGFIEEDELQLFLKN 70
Query  70   FCPKXXXLTDAETKAFLKAGDADGDGMLGLDEFAVLVK 107
            F      LTDAETKAFL AGD DGDG +G+DEF  LVK
Sbjct  71   FSSSARALTDAETKAFLAAGDTDGDGKIGVDEFQALVK 108

Sequence Alignment: 24. Allergen Name: Gad m 1.0102 Sequence ID: CAM56785

 Score = 65.8 bits 389,  Expect = 3e-13
 Identities = 61/107 57%, Positives = 80/107 74%, Gaps = 0/107 0%
Query  1    ACAHLCKEADLKTALEACKAADSFNFKTFFHTLGFASKXXDDVKKXXXVLDQDASGFLEV 60
            A A +  +AD   A++AC+AA+SF++K FF   G++ K  DD+KK   V+DQD SGF+E 
Sbjct  2    AFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIEE 61
Query  61   EELKLFLQNFCPKXXXLTDAETKAFLKAGDADGDGMLGLDEFAVLVK 107
            +ELKLFLQ F      LTDAETKAFLKAGD+DGDG +G++E+AVLVK
Sbjct  62   DELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVEEWAVLVK 108

Sequence Alignment: 25. Allergen Name: Gad m 1.0202 Sequence ID: CAM56786

 Score = 64.4 bits 379,  Expect = 8e-13
 Identities = 57/107 53%, Positives = 75/107 70%, Gaps = 0/107 0%
Query  1    ACAHLCKEADLKTALEACKAADSFNFKTFFHTLGFASKXXDDVKKXXXVLDQDASGFLEV 60
            A A +  +AD+  AL ACKA  SF+ K FF  +G+A+K   D+KK   ++DQD S F+E 
Sbjct  2    AFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSSADIKKVFEIIDQDKSDFVEE 61
Query  61   EELKLFLQNFCPKXXXLTDAETKAFLKAGDADGDGMLGLDEFAVLVK 107
            +ELKLFLQNF      L+DAETK FLKAGD+DGDG +G+DEF  ++K
Sbjct  62   DELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIK 108

Sequence Alignment: 26. Allergen Name: Gad m 1.0201 Sequence ID: Q90YK9

 Score = 64.2 bits 378,  Expect = 9e-13
 Identities = 57/107 53%, Positives = 75/107 70%, Gaps = 0/107 0%
Query  1    ACAHLCKEADLKTALEACKAADSFNFKTFFHTLGFASKXXDDVKKXXXVLDQDASGFLEV 60
            A A +  +AD+  AL ACKA  SF+ K FF  +G+A+K   D+KK   ++DQD S F+E 
Sbjct  2    AFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSPADIKKVFEIIDQDKSDFVEE 61
Query  61   EELKLFLQNFCPKXXXLTDAETKAFLKAGDADGDGMLGLDEFAVLVK 107
            +ELKLFLQNF      L+DAETK FLKAGD+DGDG +G+DEF  ++K
Sbjct  62   DELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIK 108

Sequence Alignment: 27. Allergen Name: Gad m 1.0201 Sequence ID: AAK63087

 Score = 64.2 bits 378,  Expect = 9e-13
 Identities = 57/107 53%, Positives = 75/107 70%, Gaps = 0/107 0%
Query  1    ACAHLCKEADLKTALEACKAADSFNFKTFFHTLGFASKXXDDVKKXXXVLDQDASGFLEV 60
            A A +  +AD+  AL ACKA  SF+ K FF  +G+A+K   D+KK   ++DQD S F+E 
Sbjct  2    AFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSPADIKKVFEIIDQDKSDFVEE 61
Query  61   EELKLFLQNFCPKXXXLTDAETKAFLKAGDADGDGMLGLDEFAVLVK 107
            +ELKLFLQNF      L+DAETK FLKAGD+DGDG +G+DEF  ++K
Sbjct  62   DELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIK 108

Sequence Alignment: 28. Allergen Name: Lat c 1.0201 Sequence ID: Q6ITU9

 Score = 63.9 bits 376,  Expect = 1e-12
 Identities = 57/107 53%, Positives = 73/107 68%, Gaps = 0/107 0%
Query  1    ACAHLCKEADLKTALEACKAADSFNFKTFFHTLGFASKXXDDVKKXXXVLDQDASGFLEV 60
            A +++  ++D+  AL+ CK A +F+ K FF   G+++K  DDVKK   ++DQD SGF+E 
Sbjct  2    AFSNVLSDSDVAAALDGCKDAGTFDHKKFFSACGLSNKTSDDVKKAFAIIDQDKSGFIEE 61
Query  61   EELKLFLQNFCPKXXXLTDAETKAFLKAGDADGDGMLGLDEFAVLVK 107
            EELKLFLQNF      LTD ET  FLKAGD DGDG +G DEF  LVK
Sbjct  62   EELKLFLQNFKADARVLTDVETSTFLKAGDTDGDGKIGADEFTALVK 108

Sequence Alignment: 29. Allergen Name: Ran e 2 Sequence ID: CAC95152

 Score = 62.7 bits 367,  Expect = 3e-12
 Identities = 57/103 55%, Positives = 73/103 70%, Gaps = 0/103 0%
Query  5    LCKEADLKTALEACKAADSFNFKTFFHTLGFASKXXDDVKKXXXVLDQDASGFLEVEELK 64
            +  E D+  ALE+ KAA SFN+K FF+ +G+A K   D KK   +LD+D SGF+E +EL 
Sbjct  6    IVSEKDIDAALESVKAAGSFNYKIFFQKVGLAGKSAADAKKVFEILDRDKSGFIEQDELG 65
Query  65   LFLQNFCPKXXXLTDAETKAFLKAGDADGDGMLGLDEFAVLVK 107
            LFLQNF      L+DAET AFLKAGD+DGDG +G++EF  LVK
Sbjct  66   LFLQNFRASARVLSDAETSAFLKAGDSDGDGKIGVEEFQALVK 108

Sequence Alignment: 30. Allergen Name: Lep w 1.0101 Sequence ID: AM904681

 Score = 61.0 bits 355,  Expect = 8e-12
 Identities = 54/99 54%, Positives = 69/99 69%, Gaps = 0/99 0%
Query  9    ADLKTALEACKAADSFNFKTFFHTLGFASKXXDDVKKXXXVLDQDASGFLEVEELKLFLQ 68
            A++K AL+ C AADSF++K FF   G+A K  ++VK     +DQD SGF+E +ELKLFLQ
Sbjct  9    AEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIEEDELKLFLQ 68
Query  69   NFCPKXXXLTDAETKAFLKAGDADGDGMLGLDEFAVLVK 107
            NF      LTD ET  FLKAGD DGDG +G++EF  LV+
Sbjct  69   NFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLVR 107

Sequence Alignment: 31. Allergen Name: Gal d 8.0101 Sequence ID: C1L370

 Score = 58.9 bits 340,  Expect = 4e-11
 Identities = 52/99 52%, Positives = 69/99 69%, Gaps = 0/99 0%
Query  10   DLKTALEACKAADSFNFKTFFHTLGFASKXXDDVKKXXXVLDQDASGFLEVEELKLFLQN 69
            D+K A+ A  AA+SFN+K FF  +G+  K  +DVKK   +LD+D SGF+E EELK+ L+ 
Sbjct  11   DIKKAVGAFSAAESFNYKKFFEMVGLKKKSPEDVKKVFHILDKDRSGFIEEEELKFVLKG 70
Query  70   FCPKXXXLTDAETKAFLKAGDADGDGMLGLDEFAVLVKQ 108
            F P    L+D ETKA+L AGD DGDG +G DEFA +V +
Sbjct  71   FTPDGRDLSDKETKALLAAGDKDGDGKIGADEFATMVAE 109

Sequence Alignment: 32. Allergen Name: Cro p 2.0101 Sequence ID: XP_019400389

 Score = 57.3 bits 328,  Expect = 1e-10
 Identities = 53/108 49%, Positives = 68/108 62%, Gaps = 0/108 0%
Query  1    ACAHLCKEADLKTALEACKAADSFNFKTFFHTLGFASKXXDDVKKXXXVLDQDASGFLEV 60
            A   L    D+K A+ A  AA+SFN K FF  +G+  K  DDVKK   +LD+D SGF+E 
Sbjct  2    AMTDLLSADDIKKAVGAFAAAESFNHKKFFEMVGLKKKSQDDVKKVFHILDKDRSGFIEE 61
Query  61   EELKLFLQNFCPKXXXLTDAETKAFLKAGDADGDGMLGLDEFAVLVKQ 108
            +ELK  L+ F P    L+D ETK +L AGD DGDG +G+DEF  LV +
Sbjct  62   DELKSVLKGFTPDARDLSDKETKELLAAGDKDGDGKIGVDEFTSLVAE 109

Sequence Alignment: 33. Allergen Name: Pan h 1.0201 Sequence ID: XP_026803769

 Score = 56.8 bits 325,  Expect = 1e-10
 Identities = 53/108 49%, Positives = 69/108 63%, Gaps = 0/108 0%
Query  1    ACAHLCKEADLKTALEACKAADSFNFKTFFHTLGFASKXXDDVKKXXXVLDQDASGFLEV 60
            A   L K  D+K AL+  K AD+F+ K FF  +G+ +   ++VKK   VLD DASGF+E 
Sbjct  2    AMQDLLKADDIKKALDTFKVADTFDHKKFFELVGLKAMSAENVKKVFSVLDVDASGFIEE 61
Query  61   EELKLFLQNFCPKXXXLTDAETKAFLKAGDADGDGMLGLDEFAVLVKQ 108
            +ELK+ L+ F      LTD ETKAFL A D DGDG +G+DEF  +V Q
Sbjct  62   DELKFVLKGFSKDGRDLTDKETKAFLTAADRDGDGKIGIDEFEAIVHQ 109

Sequence Alignment: 34. Allergen Name: Ran e 1 Sequence ID: CAC83046

 Score = 54.3 bits 307,  Expect = 9e-10
 Identities = 50/104 48%, Positives = 65/104 62%, Gaps = 0/104 0%
Query  5    LCKEADLKTALEACKAADSFNFKTFFHTLGFASKXXDDVKKXXXVLDQDASGFLEVEELK 64
            L    D+  A+ A  A +SFN K FF   G+ SK  + ++K   VLDQD SGF+E EEL 
Sbjct  6    LLAAGDISKAVSAFAAPESFNHKKFFELCGLKSKSKEIMQKVFHVLDQDQSGFIEKEELC 65
Query  65   LFLQNFCPKXXXLTDAETKAFLKAGDADGDGMLGLDEFAVLVKQ 108
            L L+ F P+   L+D ET A+L AGD DGDG +G+DEF  LV +
Sbjct  66   LILKGFTPEGRSLSDKETTALLAAGDKDGDGKIGVDEFVTLVSE 109

Sequence Alignment: 35. Allergen Name: Gad c 1 Sequence ID: P02622

 Score = 54.3 bits 307,  Expect = 9e-10
 Identities = 49/100 49%, Positives = 65/100 65%, Gaps = 0/100 0%
Query  9    ADLKTALEACKAADSFNFKTFFHTLGFASKXXDDVKKXXXVLDQDASGFLEVEELKLFLQ 68
            AD+K A  AC    SF+   F+  +G+ +   D++KK   + D+D  GF+E +ELKLFL 
Sbjct  9    ADIKAAEAACFKEGSFDEDGFYAKVGLDAFSADELKKLFKIADEDKEGFIEEDELKLFLI 68
Query  69   NFCPKXXXLTDAETKAFLKAGDADGDGMLGLDEFAVLVKQ 108
             F      LTDAETKAFLKAGD+DGDG +G+DEF  LV +
Sbjct  69   AFAADLRALTDAETKAFLKAGDSDGDGKIGVDEFGALVDK 108

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.