The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

ADAGYTPAAAATPAAAGGKAMTEEQKLIEDVNAGFKAAVAAASSAPPADKFKTFEATFTA
ACKANIAAAATKVPLFVAKLDAAYAVAYKTAAGPTPEAKYDAFVAALTEALRVIAGALEV
HAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPANDKFTVFEGAFNKAIKES
TGGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMSEAQKVATPAAA
ATGAATAAASAATGAATAAAGGYKV
Sequence Info Allergen Name Length Opt Bits Score E Value
AAK62277 Dac g 5.02 265 1601 371.6 1.6e-104
AAK62276 Dac g 5.01 265 1579 366.6 5.2e-103
CAB10765 Hol l 5.0101 264 1303 303.6 4.5e-84
AAD20386 Lol p 5 301 1299 302.7 9.9e-84
Q40963 Phl p 5.0201 284 1228 286.5 6.9e-79
AAC25996 Phl p 5.0204 265 1217 284.0 3.6e-78
CAB05371 Phl p 5.0202 281 1207 281.7 1.9e-77
9249029 Phl p 5.0205 265 1198 279.7 7.2e-77
CAD87529 Phl p 5.0109 284 1155 269.9 7e-74
AAC16527 Phl p 5.0107 276 1134 265.1 1.9e-72
Q9FPR0 Poa p 5.0101 303 1134 265.1 2.1e-72
CAA52753 Phl p 5.0101 312 1133 264.8 2.5e-72
P22286 Poa p 5 307 1128 263.7 5.5e-72
AAC16526 Phl p 5.0106 276 1127 263.5 5.6e-72
P22284 Poa p 5 373 1127 263.4 8.1e-72
AAC16528 Phl p 5.0108 276 1122 262.4 1.2e-71
P22285 Poa p 5 333 1122 262.3 1.6e-71
CAB10766 Hol l 5.0201 240 1111 259.9 5.9e-71
AAC16525 Phl p 5.0105 276 1109 259.4 9.7e-71
Q40962 Phl p 5.0102 286 1101 257.6 3.6e-70
CAB05372 Phl p 5.0104 276 1097 256.7 6.4e-70
Q40237 Lol p 5 339 1018 238.6 2.2e-64
AAK25823 Phl p 5 275 978 229.5 9.4e-62
P56164 Pha a 5 320 970 227.7 4e-61
P56167 Pha a 5 175 841 198.6 1.3e-52
CBG76811 Sec c 5.0101 292 838 197.6 4.1e-52
U57845 Hor v 5.0101 313 765 181.0 4.6e-47
Q40240 Lol p 5 308 737 174.6 3.7e-45
P56166 Pha a 5 294 695 165.0 2.7e-42
P56165 Pha a 5 305 626 149.3 1.5e-37
P43215 Phl p 6.0101 132 453 110.4 3.4e-26
CAA76556 Phl p 6.0102 138 445 108.5 1.3e-25
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Dac g 5.02 Sequence ID: AAK62277

 Score = 371.6 bits 1601,  Expect = 2e-104
 Identities = 265/265 100%, Positives = 265/265 100%, Gaps = 0/265 0%
Query  1    ADAGYTPAAAATPAAAGGKAMTEEQKLIEDVNAGFKAAVAAASSAPPADKFKTFEATFTA 60
            ADAGYTPAAAATPAAAGGKAMTEEQKLIEDVNAGFKAAVAAASSAPPADKFKTFEATFTA
Sbjct  1    ADAGYTPAAAATPAAAGGKAMTEEQKLIEDVNAGFKAAVAAASSAPPADKFKTFEATFTA 60
Query  61   ACKANIAAAATKVPLFVAKLDAAYAVAYKTAAGPTPEAKYDAFVAALTEALRVIAGALEV 120
            ACKANIAAAATKVPLFVAKLDAAYAVAYKTAAGPTPEAKYDAFVAALTEALRVIAGALEV
Sbjct  61   ACKANIAAAATKVPLFVAKLDAAYAVAYKTAAGPTPEAKYDAFVAALTEALRVIAGALEV 120
Query  121  HAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPANDKFTVFEGAFNKAIKES 180
            HAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPANDKFTVFEGAFNKAIKES
Sbjct  121  HAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPANDKFTVFEGAFNKAIKES 180
Query  181  TGGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMSEAQKVATPAAA 240
            TGGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMSEAQKVATPAAA
Sbjct  181  TGGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMSEAQKVATPAAA 240
Query  241  ATGAATAAASAATGAATAAAGGYKV 265
            ATGAATAAASAATGAATAAAGGYKV
Sbjct  241  ATGAATAAASAATGAATAAAGGYKV 265

Sequence Alignment: 2. Allergen Name: Dac g 5.01 Sequence ID: AAK62276

 Score = 366.6 bits 1579,  Expect = 5e-103
 Identities = 261/265 98%, Positives = 261/265 98%, Gaps = 0/265 0%
Query  1    ADAGYTPAAAATPAAAGGKAMTEEQKLIEDVNAGFKAAVAAASSAPPADKFKTFEATFTA 60
            ADAGYTPAAAATPA AGGKAMTEEQ LIEDVNAGFKAAVAAASSAPPADKFKTFEATFTA
Sbjct  1    ADAGYTPAAAATPATAGGKAMTEEQTLIEDVNAGFKAAVAAASSAPPADKFKTFEATFTA 60
Query  61   ACKANIAAAATKVPLFVAKLDAAYAVAYKTAAGPTPEAKYDAFVAALTEALRVIAGALEV 120
            ACKANIAAAATKVPLFVAKLDAAYAVAYKTA GPTPEAKYDAFVAALTEALRVIAGALEV
Sbjct  61   ACKANIAAAATKVPLFVAKLDAAYAVAYKTATGPTPEAKYDAFVAALTEALRVIAGALEV 120
Query  121  HAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPANDKFTVFEGAFNKAIKES 180
            HAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPANDKFTVFEGAFNKAIKES
Sbjct  121  HAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPANDKFTVFEGAFNKAIKES 180
Query  181  TGGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMSEAQKVATPAAA 240
            TGGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMSEAQKVATPAA 
Sbjct  181  TGGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMSEAQKVATPAAV 240
Query  241  ATGAATAAASAATGAATAAAGGYKV 265
            ATGAATAAASAATGAATAAAGGYKV
Sbjct  241  ATGAATAAASAATGAATAAAGGYKV 265

Sequence Alignment: 3. Allergen Name: Hol l 5.0101 Sequence ID: CAB10765

 Score = 303.6 bits 1303,  Expect = 4e-84
 Identities = 215/264 81%, Positives = 230/264 87%, Gaps = 1/264 0%
Query  1    ADAGYTPAAAATPAAAGGKAMTEEQKLIEDVNAGFKAAVAAASSAPPADKFKTFEATFTA 60
            ADAGYTPAA A  A AGGKA T+EQKL+EDVNAGFK AVAAA++ PPADK+KTFEA FTA
Sbjct  1    ADAGYTPAAPAA-AGAGGKATTDEQKLLEDVNAGFKTAVAAAANVPPADKYKTFEAAFTA 59
Query  61   ACKANIAAAATKVPLFVAKLDAAYAVAYKTAAGPTPEAKYDAFVAALTEALRVIAGALEV 120
            + KA+IAAAATK P ++ +L+AA   AY  A G TPEAKYDAFV  LTEALRVIAGALEV
Sbjct  60   SSKASIAAAATKAPGLIPQLNAATNTAYAAAQGATPEAKYDAFVTTLTEALRVIAGALEV 119
Query  121  HAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPANDKFTVFEGAFNKAIKES 180
            HAVKPA EEV AAKIPAGELQIVDKIDAA++IAATAANAAP NDKFTVFEGAFNKAIKES
Sbjct  120  HAVKPATEEVGAAKIPAGELQIVDKIDAAFRIAATAANAAPVNDKFTVFEGAFNKAIKES 179
Query  181  TGGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMSEAQKVATPAAA 240
            TGGAYE+YKFIP+LE AVKQAYAATVA APEVKY VFE AL KAITAMSEAQK A P AA
Sbjct  180  TGGAYEAYKFIPSLETAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKEAKPVAA 239
Query  241  ATGAATAAASAATGAATAAAGGYKV 265
            ATGAATAAA  A GAATAAAGGYKV
Sbjct  240  ATGAATAAAGVAAGAATAAAGGYKV 264

Sequence Alignment: 4. Allergen Name: Lol p 5 Sequence ID: AAD20386

 Score = 302.7 bits 1299,  Expect = 1e-83
 Identities = 218/264 82%, Positives = 235/264 89%, Gaps = 11/264 4%
Query  1    ADAGYTPAAAATPA-------AAGGKAMTEEQKLIEDVNAGFKAAVAAASSAPPADKFKT 53
            ADAGYTPAAAATPA       AAGGKA T+EQKL+EDVNAGFKAAVAAA++APPADKFK 
Sbjct  26   ADAGYTPAAAATPATPAATPAAAGGKATTDEQKLLEDVNAGFKAAVAAAANAPPADKFKI 85
Query  54   FEATFTAACKANIAAAATKVPLFVAKLDAAYAVAYKTAAGPTPEAKYDAFVAALTEALRV 113
            FEA F+ + K  +A +A K P ++ KLD AY VAYK A G TPEAKYDAFV ALTEALRV
Sbjct  86   FEAAFSESSKGLLATSAAKAPGLIPKLDTAYDVAYKAAEGATPEAKYDAFVTALTEALRV 145
Query  114  IAGALEVHAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPANDKFTVFEGAF 173
            IAGALEVHAVKPA EEVPAAKIP GELQIVDKIDAA+KIAATAANAAP NDKFTVFE AF
Sbjct  146  IAGALEVHAVKPATEEVPAAKIPTGELQIVDKIDAAFKIAATAANAAPTNDKFTVFESAF 205
Query  174  NKAIKESTGGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMSEAQK 233
            NKA+ E TGGAYE+YKFIP+LEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAM++AQK
Sbjct  206  NKALNECTGGAYETYKFIPSLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMTQAQK 265
Query  234  VATPAAAA-TGAATAA---ASAATGAATAAAGGYK 264
               PAAAA TGAAT A   A+AA GAATAAAGGYK
Sbjct  266  AGKPAAAAATGAATVATGAATAAAGAATAAAGGYK 300

Sequence Alignment: 5. Allergen Name: Phl p 5.0201 Sequence ID: Q40963

 Score = 286.5 bits 1228,  Expect = 7e-79
 Identities = 205/261 78%, Positives = 224/261 85%, Gaps = 8/261 3%
Query  1    ADAGYTPAAAATPAAAGGKAMTEEQKLIEDVNAGFKAAVAAASSAPPADKFKTFEATFTA 60
            ADAGY PA  A   AA GKA TEEQKLIED+N GFKAAVAAA+S P ADKFKTFEA FT+
Sbjct  20   ADAGYAPATPAAAGAAAGKATTEEQKLIEDINVGFKAAVAAAASVPAADKFKTFEAAFTS 79
Query  61   ACKANIAAAATKVPLFVAKLDAAYAVAYKTAAGPTPEAKYDAFVAALTEALRVIAGALEV 120
            + KA    AA K P +V KLDAAY+VAYK A G TPEAK+D+FVA+LTEALRVIAGALEV
Sbjct  80   SSKA----AAAKAPGLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGALEV 135
Query  121  HAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPANDKFTVFEGAFNKAIKES 180
            HAVKP  EE   AKIPAGELQI+DKIDAA+K+AATAA  APA+DKFTVFE AFNKAIKES
Sbjct  136  HAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKES 195
Query  181  TGGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMSEAQKVATPAAA 240
            TGGAY++YK IP+LEAAVKQAYAATVAAAP+VKYAVFEAALTKAITAMSE QKV+ PA  
Sbjct  196  TGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQPATG 255
Query  241  AT----GAATAAASAATGAATAAAGGYKV 265
            A     GAAT AA AA+GAAT AAGGYKV
Sbjct  256  AATVAAGAATTAAGAASGAATVAAGGYKV 284

Sequence Alignment: 6. Allergen Name: Phl p 5.0204 Sequence ID: AAC25996

 Score = 284.0 bits 1217,  Expect = 4e-78
 Identities = 203/261 77%, Positives = 222/261 85%, Gaps = 8/261 3%
Query  1    ADAGYTPAAAATPAAAGGKAMTEEQKLIEDVNAGFKAAVAAASSAPPADKFKTFEATFTA 60
            ADAGY PA  A   A  GKA TEEQKLIED+N GFKAAVAAA+S P ADKFKTFEA FT+
Sbjct  1    ADAGYAPATPAAAGAEAGKATTEEQKLIEDINVGFKAAVAAAASVPAADKFKTFEAAFTS 60
Query  61   ACKANIAAAATKVPLFVAKLDAAYAVAYKTAAGPTPEAKYDAFVAALTEALRVIAGALEV 120
            + KA    A  K P +V KLDAAY+VAYK A G TPEAK+D+FVA+LTEALRVIAGALEV
Sbjct  61   SSKA----ATAKAPGLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGALEV 116
Query  121  HAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPANDKFTVFEGAFNKAIKES 180
            HAVKP  EE   AKIPAGELQI+DKIDAA+K+AATAA  APA+DKFTVFE AFNKAIKES
Sbjct  117  HAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKES 176
Query  181  TGGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMSEAQKVATPAAA 240
            TGGAY++YK IP+LEAAVKQAYAATVAAAP+VKYAVFEAALTKAITAMSE QKV+ PA  
Sbjct  177  TGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQPATG 236
Query  241  AT----GAATAAASAATGAATAAAGGYKV 265
            A     GAAT AA AA+GAAT AAGGYKV
Sbjct  237  AATVAAGAATTAAGAASGAATVAAGGYKV 265

Sequence Alignment: 7. Allergen Name: Phl p 5.0202 Sequence ID: CAB05371

 Score = 281.7 bits 1207,  Expect = 2e-77
 Identities = 201/261 77%, Positives = 220/261 84%, Gaps = 8/261 3%
Query  1    ADAGYTPAAAATPAAAGGKAMTEEQKLIEDVNAGFKAAVAAASSAPPADKFKTFEATFTA 60
            ADAGY PA  A   A  GKA TEEQKLIED+N GFKAAVAAA+S P  DKFKTFEA FT+
Sbjct  17   ADAGYAPATPAAAGAEAGKATTEEQKLIEDINVGFKAAVAAAASVPAGDKFKTFEAAFTS 76
Query  61   ACKANIAAAATKVPLFVAKLDAAYAVAYKTAAGPTPEAKYDAFVAALTEALRVIAGALEV 120
            + KA    A  K P +V KLDAAY+VAYK A G TPEAK+D+FVA+LTEALRVIAGALEV
Sbjct  77   SSKA----ATAKAPGLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGALEV 132
Query  121  HAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPANDKFTVFEGAFNKAIKES 180
            HAVKP  EE   AKIPAGELQI+DKIDAA+K+AATAA  APA+DKFTVFE AFNKAIKES
Sbjct  133  HAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKES 192
Query  181  TGGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMSEAQKVATPAAA 240
            TGGAY++YK IP+LEAAVKQAYAATVAAAP+VKYAVFEAALTKAITAMSE QKV+ PA  
Sbjct  193  TGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQPATG 252
Query  241  AT----GAATAAASAATGAATAAAGGYKV 265
            A     GAAT A  AA+GAAT AAGGYKV
Sbjct  253  AATVAAGAATTATGAASGAATVAAGGYKV 281

Sequence Alignment: 8. Allergen Name: Phl p 5.0205 Sequence ID: 9249029

 Score = 279.7 bits 1198,  Expect = 7e-77
 Identities = 200/261 76%, Positives = 220/261 84%, Gaps = 8/261 3%
Query  1    ADAGYTPAAAATPAAAGGKAMTEEQKLIEDVNAGFKAAVAAASSAPPADKFKTFEATFTA 60
            ADAGY PA  A   A  GKA TEEQKLIED+N GF AAVAAA+S P ADKFKTFEA FT+
Sbjct  1    ADAGYAPATPAAAGAEAGKATTEEQKLIEDINVGFNAAVAAAASVPAADKFKTFEAAFTS 60
Query  61   ACKANIAAAATKVPLFVAKLDAAYAVAYKTAAGPTPEAKYDAFVAALTEALRVIAGALEV 120
            + KA    A  K P +V KLDAAY+VAYK A G TPEAK+D++VA+LTEALRVIAGALEV
Sbjct  61   SSKA----ATAKAPGLVPKLDAAYSVAYKAAVGATPEAKFDSLVASLTEALRVIAGALEV 116
Query  121  HAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPANDKFTVFEGAFNKAIKES 180
            HAVKP  EE   AKIPAGELQI+DKIDAA+K+AATAA  APA+DKFTVFE AFNKAIKES
Sbjct  117  HAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKES 176
Query  181  TGGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMSEAQKVATPAAA 240
            TGGAY++YK IP+LEAAVKQ YAATVAAAP+VKYAVFEAALTKAITAMSE QKV+ PA  
Sbjct  177  TGGAYDTYKCIPSLEAAVKQPYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQPATG 236
Query  241  AT----GAATAAASAATGAATAAAGGYKV 265
            A     GAAT AA AA+GAAT AAGGYKV
Sbjct  237  AATVAAGAATTAAGAASGAATVAAGGYKV 265

Sequence Alignment: 9. Allergen Name: Phl p 5.0109 Sequence ID: CAD87529

 Score = 269.9 bits 1155,  Expect = 7e-74
 Identities = 196/260 75%, Positives = 215/260 82%, Gaps = 13/260 5%
Query  3    AGYTPAAAATPAAAGGKAMTEEQKLIEDVNAGFKAAVAAASSAPPADKFKTFEATFTAAC 62
            AGYTPAA A  A   GKA TEEQKLIE +NAGFKAA+AAA+  PPADK++TF ATF AA 
Sbjct  15   AGYTPAAPAG-AEPAGKATTEEQKLIEKINAGFKAALAAAAGVPPADKYRTFVATFGAAS 73
Query  63   KANIAAAATKVP----------LFVAKLDAAYAVAYKTAAGPTPEAKYDAFVAALTEALR 112
                A   +  P           + +KLDAAY +AYKTA G TPEAKYDA+VA L+EALR
Sbjct  74   NKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALR 133
Query  113  VIAGALEVHAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPANDKFTVFEGA 172
            +IAG LEVHAVKPAAEEV    IPAGELQ+++K+DAA+K+AATAANAAPANDKFTVFE A
Sbjct  134  IIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDAAFKVAATAANAAPANDKFTVFEAA 191
Query  173  FNKAIKESTGGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMSEAQ 232
            FN AIK STGGAYESYKFIP LEAAVKQAYAATVA APEVKY VFE AL KAITAMSEAQ
Sbjct  192  FNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQ 251
Query  233  KVATPAAAATGAATAAASAATGAATAAAGGYKV 265
            K A PAAAAT  AT+A  AATGAATAA GGYKV
Sbjct  252  KAAKPAAAATATATSAVGAATGAATAATGGYKV 284

Sequence Alignment: 10. Allergen Name: Phl p 5.0107 Sequence ID: AAC16527

 Score = 265.1 bits 1134,  Expect = 2e-72
 Identities = 196/263 74%, Positives = 215/263 81%, Gaps = 15/263 5%
Query  1    ADAGYT-PAAAATPAAAG--GKAMTEEQKLIEDVNAGFKAAVAAASSAPPADKFKTFEAT 57
            AD GY  PA  A PA A   GKA TEEQKLIE +N GFKAA+AAA+  PPADK+KTF AT
Sbjct  1    ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT 60
Query  58   FTAACKANIAAAATKVP----------LFVAKLDAAYAVAYKTAAGPTPEAKYDAFVAAL 107
            F AA     A   +  P           + +KLDAAY +AYKTA G TPEAKYDA+VA L
Sbjct  61   FGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATL 120
Query  108  TEALRVIAGALEVHAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPANDKFT 167
            +EALR+IAG LEVHAVKPAAEEV    IPAGELQ+++K+D+A+K+AATAANAAPANDKFT
Sbjct  121  SEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDSAFKVAATAANAAPANDKFT 178
Query  168  VFEGAFNKAIKESTGGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITA 227
            VFE AFN AIK STGGAYESYKFIP LEAAVKQAYAATVA APEVKY VFE AL KAITA
Sbjct  179  VFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITA 238
Query  228  MSEAQKVATPAAAATGAATAAASAATGAATAAAGGYKV 265
            MSEAQK A PAAAAT  AT+A  AATGA TAAAGGYKV
Sbjct  239  MSEAQKAAKPAAAATATATSAVGAATGATTAAAGGYKV 276

Sequence Alignment: 11. Allergen Name: Poa p 5.0101 Sequence ID: Q9FPR0

 Score = 265.1 bits 1134,  Expect = 2e-72
 Identities = 192/265 72%, Positives = 221/265 83%, Gaps = 13/265 4%
Query  1    ADAGYTPAAAATPAAAGGKAM-TEEQKLIEDVNAGFKAAVAAASSAPPADKFKTFEATFT 59
            ADAGY PA  A   AA GK   T+EQKL+ED+N GFKAAVAAA+ APPADKFKTF+A F+
Sbjct  26   ADAGYAPATPAAAGAAAGKITPTQEQKLMEDINVGFKAAVAAAAGAPPADKFKTFQAAFS 85
Query  60   AACKANIAA-AATKVPLFVAKLDAAYAVAYKTAAGPTPEAKYDAFVAALTEALRVIAGAL 118
            A+ +A+ A   A + P FV+ + A     YK A G TPEAK+D+FVAA+TEALR+IAG L
Sbjct  86   ASVEASAAKLNAAQAPGFVSHVAATSDATYKAAVGATPEAKFDSFVAAFTEALRIIAGVL 145
Query  119  EVHAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPANDKFTVFEGAFNKAIK 178
            +VHAVKP  EE  AAKIPAGE QI+DKIDAA+K+AATAANAAPANDKFTVFE AFN AIK
Sbjct  146  KVHAVKPITEETGAAKIPAGEQQIIDKIDAAFKVAATAANAAPANDKFTVFEAAFNNAIK 205
Query  179  ESTGGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMSEAQKVATPA 238
            ESTGGAY++YK IP+LEAAVKQAYAAT+AAAPEVK+AVF+AALTKAITAM+E QKV+ P 
Sbjct  206  ESTGGAYDTYKSIPSLEAAVKQAYAATIAAAPEVKFAVFKAALTKAITAMAEVQKVSKPV 265
Query  239  A-----------AATGAATAAASAATGAATAAAGGYKV 265
            A           AATGAAT AA AATGAAT +AGGYKV
Sbjct  266  AGAATVAAGAATAATGAATGAAGAATGAATVSAGGYKV 303

Sequence Alignment: 12. Allergen Name: Phl p 5.0101 Sequence ID: CAA52753

 Score = 264.8 bits 1133,  Expect = 3e-72
 Identities = 197/261 75%, Positives = 215/261 82%, Gaps = 14/261 5%
Query  3    AGYTPAAAATPAAAG--GKAMTEEQKLIEDVNAGFKAAVAAASSAPPADKFKTFEATFTA 60
            AGYTPA  A PA A   GKA TEEQKLIE +NAGFKAA+AAA+   PADK++TF ATF A
Sbjct  40   AGYTPATPAAPAEAAPAGKATTEEQKLIEKINAGFKAALAAAAGVQPADKYRTFVATFGA 99
Query  61   ACKANIAAAATKVP----------LFVAKLDAAYAVAYKTAAGPTPEAKYDAFVAALTEA 110
            A     A   +  P           + +KLDAAY +AYKTA G TPEAKYDA+VA L+EA
Sbjct  100  ASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEA 159
Query  111  LRVIAGALEVHAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPANDKFTVFE 170
            LR+IAG LEVHAVKPAAEEV    IPAGELQ+++K+DAA+K+AATAANAAPANDKFTVFE
Sbjct  160  LRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDAAFKVAATAANAAPANDKFTVFE 217
Query  171  GAFNKAIKESTGGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMSE 230
             AFN AIK STGGAYESYKFIP LEAAVKQAYAATVA APEVKY VFE AL KAITAMSE
Sbjct  218  AAFNDAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSE 277
Query  231  AQKVATPAAAATGAATAAASAATGAATAAAGGYKV 265
            AQK A PAAAAT  ATAA  AATGAATAA GGYKV
Sbjct  278  AQKAAKPAAAATATATAAVGAATGAATAATGGYKV 312

Sequence Alignment: 13. Allergen Name: Poa p 5 Sequence ID: P22286

 Score = 263.7 bits 1128,  Expect = 5e-72
 Identities = 191/258 74%, Positives = 212/258 82%, Gaps = 15/258 5%
Query  3    AGYTPAAAATPAAAGGKAMTEEQKLIEDVNAGFKAAVAAASSAPPADKFKTFEATFTAAC 62
            AGYTPAA   PA A  KA T+EQK+IE +N GFKAAVAAA   P A+K+KTF ATF AA 
Sbjct  40   AGYTPAA---PAGAAPKATTDEQKMIEKINVGFKAAVAAAGGVPAANKYKTFVATFGAAS 96
Query  63   KANIAAAATKVP----------LFVAKLDAAYAVAYKTAAGPTPEAKYDAFVAALTEALR 112
                A A +  P           + +KLDAAY +AYK+A G TPEAKYD +VA L+EALR
Sbjct  97   NKAFAEALSTEPKGAAVDSSKAALTSKLDAAYKLAYKSAEGATPEAKYDDYVATLSEALR 156
Query  113  VIAGALEVHAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPANDKFTVFEGA 172
            +IAG LEVH VKPAAEEV A   PAGELQ++DK+DAA+K+AATAANAAPANDKFTVFE A
Sbjct  157  IIAGTLEVHGVKPAAEEVKAT--PAGELQVIDKVDAAFKVAATAANAAPANDKFTVFEAA 214
Query  173  FNKAIKESTGGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMSEAQ 232
            FN AIK STGGAY+SYKFIP LEAAVKQ+YAATVA AP VKY VFE AL KAITAMS+AQ
Sbjct  215  FNDAIKASTGGAYQSYKFIPALEAAVKQSYAATVATAPAVKYTVFETALKKAITAMSQAQ 274
Query  233  KVATPAAAATGAATAAASAATGAATAAAGGYKV 265
            K A PAAAATG ATAA  AATGAATAAAGGYKV
Sbjct  275  KAAKPAAAATGTATAAVGAATGAATAAAGGYKV 307

Sequence Alignment: 14. Allergen Name: Phl p 5.0106 Sequence ID: AAC16526

 Score = 263.5 bits 1127,  Expect = 6e-72
 Identities = 195/263 74%, Positives = 213/263 80%, Gaps = 15/263 5%
Query  1    ADAGYT-PAAAATPAAAG--GKAMTEEQKLIEDVNAGFKAAVAAASSAPPADKFKTFEAT 57
            AD GY  PA  A PA A   GKA TEEQKLIE +N GFKAA+AAA+  PPADK+KTF AT
Sbjct  1    ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT 60
Query  58   FTAACKANIAAAATKVP----------LFVAKLDAAYAVAYKTAAGPTPEAKYDAFVAAL 107
            F AA     A   +  P           + +KLDAAY +AYKTA G TPEAKYDA+VA L
Sbjct  61   FGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATL 120
Query  108  TEALRVIAGALEVHAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPANDKFT 167
            +EALR+IAG LEVHAVKPAAEEV    IPAGELQ+++K+D+A+K+AATAANAAPANDKFT
Sbjct  121  SEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDSAFKVAATAANAAPANDKFT 178
Query  168  VFEGAFNKAIKESTGGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITA 227
            VFE AFN AIK STGGAYESYKFIP LEAAVKQAYAATVA APEVKY VFE AL KAITA
Sbjct  179  VFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITA 238
Query  228  MSEAQKVATPAAAATGAATAAASAATGAATAAAGGYKV 265
            MSEAQK A PA  AT  ATAA  AATGAATAA GGYKV
Sbjct  239  MSEAQKAAKPATEATATATAAVGAATGAATAATGGYKV 276

Sequence Alignment: 15. Allergen Name: Poa p 5 Sequence ID: P22284

 Score = 263.4 bits 1127,  Expect = 8e-72
 Identities = 191/258 74%, Positives = 213/258 82%, Gaps = 15/258 5%
Query  3    AGYTPAAAATPAAAGGKAMTEEQKLIEDVNAGFKAAVAAASSAPPADKFKTFEATFTAAC 62
            A YTPAA   PA A  KA T+EQKLIE +N GFKAAVAAA+  P A K+KTF ATF AA 
Sbjct  106  AAYTPAA---PAGAAPKATTDEQKLIEKINVGFKAAVAAAAGVPAASKYKTFVATFGAAS 162
Query  63   KANIAAAATKVP----------LFVAKLDAAYAVAYKTAAGPTPEAKYDAFVAALTEALR 112
                A A +  P          ++ +KLDAAY +AYK+A G TPEAKYDA+VA L+EALR
Sbjct  163  NKAFAEALSTEPKGAAVASSKAVLTSKLDAAYKLAYKSAEGATPEAKYDAYVATLSEALR 222
Query  113  VIAGALEVHAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPANDKFTVFEGA 172
            +IAG LEVH VKPAAEEV A  IPAGELQ++DK+DAA+K+AATAANAAPANDKFTVFE A
Sbjct  223  IIAGTLEVHGVKPAAEEVKA--IPAGELQVIDKVDAAFKVAATAANAAPANDKFTVFEAA 280
Query  173  FNKAIKESTGGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMSEAQ 232
            FN AIK STGGAY+SYKFIP LEAAVKQ+YAATVA AP VKY VFE AL KAITAMS+AQ
Sbjct  281  FNDAIKASTGGAYQSYKFIPALEAAVKQSYAATVATAPAVKYTVFETALKKAITAMSQAQ 340
Query  233  KVATPAAAATGAATAAASAATGAATAAAGGYKV 265
            K A PAAA TG AT+A  AATGAATAAAGGYKV
Sbjct  341  KAAKPAAAVTGTATSAVGAATGAATAAAGGYKV 373
 Score = 50.1 bits 191,  Expect = 1e-07
 Identities = 39/103 37%, Positives = 57/103 55%, Gaps = 6/103 5%
Query  28   IEDVNAGFKAAVAAASSAPPADKFKTFEATFTAACKANIAAAATKVPLFVAKLDAAYAVA 87
            ++  N  +K A+ AAS+  PA+KF  F+ATF    K  ++        F  KLDA    +
Sbjct  1    MDKANGAYKTALKAASAVAPAEKFPVFQATFDKNLKEGLSG--PDAVGFAKKLDAFIQTS 58
Query  88   YKTAAGPTPEAKYDAFVAALTEALRVIAGALEVHAVKPAAEEVPAAKIP 136
            Y +     P+ K+D FV +LTE LR +AGA++     P A + PA   P
Sbjct  59   YLSTKAAEPKEKFDLFVLSLTEVLRFMAGAVKA----PPASKFPAKPAP 103

Sequence Alignment: 16. Allergen Name: Phl p 5.0108 Sequence ID: AAC16528

 Score = 262.4 bits 1122,  Expect = 1e-71
 Identities = 194/263 73%, Positives = 212/263 80%, Gaps = 15/263 5%
Query  1    ADAGYT-PAAAATPAAAG--GKAMTEEQKLIEDVNAGFKAAVAAASSAPPADKFKTFEAT 57
            AD GY  PA  A PA A   GKA TEEQKLIE +N GFKAA+AAA+  PPADK+KTF AT
Sbjct  1    ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT 60
Query  58   FTAACKANIAAAATKVP----------LFVAKLDAAYAVAYKTAAGPTPEAKYDAFVAAL 107
            F AA     A   +  P           + +KLDAAY +AYKTA G TPEAKYDA+VA L
Sbjct  61   FGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATL 120
Query  108  TEALRVIAGALEVHAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPANDKFT 167
            +EALR+IAG LEVHAVKPAAEEV    IPAGELQ+++K+D+A+K+AATAANAAPANDKFT
Sbjct  121  SEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDSAFKVAATAANAAPANDKFT 178
Query  168  VFEGAFNKAIKESTGGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITA 227
            VFE AFN AIK STGGAYESYKFIP LEAAVKQAYAATVA APEVKY VFE AL KA TA
Sbjct  179  VFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAFTA 238
Query  228  MSEAQKVATPAAAATGAATAAASAATGAATAAAGGYKV 265
            MSEAQK A PA  AT  ATAA  AATGAATAA GGYKV
Sbjct  239  MSEAQKAAKPATEATATATAAVGAATGAATAATGGYKV 276

Sequence Alignment: 17. Allergen Name: Poa p 5 Sequence ID: P22285

 Score = 262.3 bits 1122,  Expect = 2e-71
 Identities = 196/257 76%, Positives = 218/257 84%, Gaps = 22/257 8%
Query  3    AGYTPAAAATPAAAGGKAMTEEQKLIEDVNAGFKAAVAAASSAPPADKFKTFEATF-TAA 61
            AGYTPAA   PA A  KA T+EQKLIE +NAGFKAAVAAA+  P  DK+KTF ATF TA+
Sbjct  47   AGYTPAA---PAGAAPKATTDEQKLIEKINAGFKAAVAAAAGVPAVDKYKTFVATFGTAS 103
Query  62   CKA---------NIAAAATKVPLFVAKLDAAYAVAYKTAAGPTPEAKYDAFVAALTEALR 112
             KA           AAAA+   ++ +KLDAAY +AYK+A G TPEAKYDA+VA L+EALR
Sbjct  104  NKAFAEALSTEPKGAAAASSNAVLTSKLDAAYKLAYKSAEGATPEAKYDAYVATLSEALR 163
Query  113  VIAGALEVHAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPANDKFTVFEGA 172
            +IAG LEVHAVKPA EEV A  IPAGELQ++DK+DAA+K+AATAANAAPANDKFTVFE A
Sbjct  164  IIAGTLEVHAVKPAGEEVKA--IPAGELQVIDKVDAAFKVAATAANAAPANDKFTVFEAA 221
Query  173  FNKAIKESTGGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMSEAQ 232
            FN AIK STGGAY+SYKFIP LEAAVKQ+YAATVA AP VKY VFE AL KAITAMS+AQ
Sbjct  222  FNDAIKASTGGAYQSYKFIPALEAAVKQSYAATVATAPAVKYTVFETALKKAITAMSQAQ 281
Query  233  KVATPAAAAT-------GAATAAASAATGAATAAAGGYK 264
            K A PAAA T       GAAT A  AATGAATAAAGGYK
Sbjct  282  KAAKPAAAVTATATGAVGAATGAVGAATGAATAAAGGYK 320

Sequence Alignment: 18. Allergen Name: Hol l 5.0201 Sequence ID: CAB10766

 Score = 259.9 bits 1111,  Expect = 6e-71
 Identities = 188/237 79%, Positives = 206/237 86%, Gaps = 7/237 2%
Query  25   QKLIEDVNAGFKAAVAAASSAPPADKFKTFEATFTAACKANIA---AAATKVPLFVAKLD 81
            QKL+EDVNA FKAAVAAA+  PPADK+KTF   FT   + +     A  TK+P + +KL 
Sbjct  1    QKLLEDVNASFKAAVAAAAKVPPADKYKTFLRAFTVLDRGSTEQSKAEETKMPELSSKLV 60
Query  82   AAYAVAYKTAAGPTPEAKYDAFVAALTEALRVIAGALEVHAVKPAAEEVPAAKIPAGELQ 141
             AY  A+K + G T EAKYDAFV  LTEALRVIAGALEVHAVKPA EEVPAAKIPAG+LQ
Sbjct  61   DAYMAAFKASTGGTQEAKYDAFVTTLTEALRVIAGALEVHAVKPATEEVPAAKIPAGDLQ 120
Query  142  IVDKIDAAYKIAATAANAAPANDKFTVFEGAFNKAIKESTGGAYESYKFIPTLEAAVKQA 201
            +VDKIDA++KIAATAANAAPANDKFTVFE AFNKA+KESTGGAYESYKFIP+LEAAVKQA
Sbjct  121  VVDKIDASFKIAATAANAAPANDKFTVFETAFNKALKESTGGAYESYKFIPSLEAAVKQA 180
Query  202  YAATVAAAPEVKYAVFEAALTKAITAMSEAQKVATPAAAATGAATAAASAATGAATAAAG 261
            YA+TVAAAPEVKYAVFEAALTKAITAMS+AQKVA PAAAATGAAT AA    GAAT AAG
Sbjct  181  YASTVAAAPEVKYAVFEAALTKAITAMSQAQKVAQPAAAATGAATVAA----GAATTAAG 236
Query  262  GYKV 265
            GYKV
Sbjct  237  GYKV 240

Sequence Alignment: 19. Allergen Name: Phl p 5.0105 Sequence ID: AAC16525

 Score = 259.4 bits 1109,  Expect = 1e-70
 Identities = 193/263 73%, Positives = 211/263 80%, Gaps = 15/263 5%
Query  1    ADAGYT-PAAAATPAAAG--GKAMTEEQKLIEDVNAGFKAAVAAASSAPPADKFKTFEAT 57
            AD GY  PA  A PA A   GKA TEEQKLIE +N GFKAA+AAA+  PPADK+KTF AT
Sbjct  1    ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT 60
Query  58   FTAACKANIAAAATKVP----------LFVAKLDAAYAVAYKTAAGPTPEAKYDAFVAAL 107
            F AA     A   +  P           + +KLDAAY +AYKTA G TPEA+YDA+VA L
Sbjct  61   FGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAEYDAYVATL 120
Query  108  TEALRVIAGALEVHAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPANDKFT 167
            +EALR+IAG LEVHAVKPAAEEV    IPAGELQ+++K+D+A K+AATAANAAPANDKFT
Sbjct  121  SEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDSALKVAATAANAAPANDKFT 178
Query  168  VFEGAFNKAIKESTGGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITA 227
            VFE AFN AIK STGGAYESYKFIP LEAAVKQAYAATVA APEVKY VFE AL KAITA
Sbjct  179  VFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITA 238
Query  228  MSEAQKVATPAAAATGAATAAASAATGAATAAAGGYKV 265
             SEAQK A PA  AT  ATAA  AATGAATAA GGYKV
Sbjct  239  TSEAQKAAKPATEATATATAAVGAATGAATAATGGYKV 276

Sequence Alignment: 20. Allergen Name: Phl p 5.0102 Sequence ID: Q40962

 Score = 257.6 bits 1101,  Expect = 4e-70
 Identities = 194/260 74%, Positives = 211/260 81%, Gaps = 15/260 5%
Query  3    AGYTPAAAATPAAA--GGKAMTEEQKLIEDVNAGFKAAVAAASSAPPADKFKTFEATFTA 60
            AGYTPA  A PA A   GKA TEEQKLIE +NAGFKAA+A A    PADK++TF ATF  
Sbjct  15   AGYTPATPAAPAGADAAGKATTEEQKLIEKINAGFKAALAGAG-VQPADKYRTFVATFGP 73
Query  61   ACKANIAAAATKVP----------LFVAKLDAAYAVAYKTAAGPTPEAKYDAFVAALTEA 110
            A     A   +  P           + +KLDAAY +AYKTA G TPEAKYDA+VA L+EA
Sbjct  74   ASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEA 133
Query  111  LRVIAGALEVHAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPANDKFTVFE 170
            LR+IAG LEVHAVKPAAEEV    IPAGELQ+++K+DAA+K+AATAANAAPANDKFTVFE
Sbjct  134  LRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDAAFKVAATAANAAPANDKFTVFE 191
Query  171  GAFNKAIKESTGGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMSE 230
             AFN  IK STGGAYESYKFIP LEAAVKQAYAATVA APEVKY VFE AL KAITAMSE
Sbjct  192  AAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSE 251
Query  231  AQKVATPAAAATGAATAAASAATGAATAAAGGYKV 265
            AQK A PAAAAT  ATAA  AATGAATAA GGYKV
Sbjct  252  AQKAAKPAAAATATATAAVGAATGAATAATGGYKV 286

Sequence Alignment: 21. Allergen Name: Phl p 5.0104 Sequence ID: CAB05372

 Score = 256.7 bits 1097,  Expect = 6e-70
 Identities = 192/263 73%, Positives = 210/263 79%, Gaps = 15/263 5%
Query  1    ADAGYT-PAAAATPAAAG--GKAMTEEQKLIEDVNAGFKAAVAAASSAPPADKFKTFEAT 57
            AD GY  PA  A PA A   GKA TEEQKLIE +N GFKAA+AAA+  PPADK+KTF AT
Sbjct  1    ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT 60
Query  58   FTAACKANIAAAATKVP----------LFVAKLDAAYAVAYKTAAGPTPEAKYDAFVAAL 107
            F AA     A   +  P           + +KL+AAY +AYKT+ G TPEAKYDA+VA L
Sbjct  61   FGAASNKAFAEGLSAEPKGAAESSSKGALTSKLEAAYKLAYKTSEGATPEAKYDAYVATL 120
Query  108  TEALRVIAGALEVHAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPANDKFT 167
            +EALR+IAG LEVHAVKPAAEEV    IPAGELQ ++K+D+A K+AATAANAA ANDKFT
Sbjct  121  SEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQFIEKVDSALKVAATAANAAAANDKFT 178
Query  168  VFEGAFNKAIKESTGGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITA 227
            VFE AFN AIK STGGAYESYKFIP LEAAVKQAYAATVA APEVKY VFE AL KAITA
Sbjct  179  VFEAAFNHAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITA 238
Query  228  MSEAQKVATPAAAATGAATAAASAATGAATAAAGGYKV 265
            MSEAQK A PA  AT  ATAA  AATGAATAA GGYKV
Sbjct  239  MSEAQKAAKPATEATATATAAVGAATGAATAATGGYKV 276

Sequence Alignment: 22. Allergen Name: Lol p 5 Sequence ID: Q40237

 Score = 238.6 bits 1018,  Expect = 2e-64
 Identities = 177/254 69%, Positives = 196/254 77%, Gaps = 7/254 2%
Query  6    TPAAAATPAAA-GGKAMTEEQKLIEDVNAGFKAAVAAASSAPPADKFKTFEATF-TAACK 63
            TPA  ATPAA   GKA TEEQKLIE +NAGFKAAVAAA+  PPADK+KTF  TF TA  K
Sbjct  49   TPATPATPAAVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVETFGTATNK 108
Query  64   ANIAAAATKVP-----LFVAKLDAAYAVAYKTAAGPTPEAKYDAFVAALTEALRVIAGAL 118
            A +   A+         + +KLDAA  +AY+ A G TPEAKYDA+VA LTEALRVIAG L
Sbjct  109  AFVEGLASGYADQSKNQLTSKLDAALKLAYEAAQGATPEAKYDAYVATLTEALRVIAGTL 168
Query  119  EVHAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPANDKFTVFEGAFNKAIK 178
            EVHAVKPAAEEV    IPA E+Q++DK+DAAY+ AATAANAAPANDKFTVFE  FN AIK
Sbjct  169  EVHAVKPAAEEVKVGAIPAAEVQLIDKVDAAYRTAATAANAAPANDKFTVFENTFNNAIK 228
Query  179  ESTGGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMSEAQKVATPA 238
             S G AY+SYKFIPTL AAVKQAYAA  A APEVKY V E AL KA+TAMSEA+K ATPA
Sbjct  229  VSLGAAYDSYKFIPTLVAAVKQAYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPA 288
Query  239  AAATGAATAAASAATGAATAA 259
            AAAT   T AA+ AT    AA
Sbjct  289  AAATATPTPAAATATATPAAA 309

Sequence Alignment: 23. Allergen Name: Phl p 5 Sequence ID: AAK25823

 Score = 229.5 bits 978,  Expect = 9e-62
 Identities = 166/228 72%, Positives = 183/228 80%, Gaps = 12/228 5%
Query  36   KAAVAAASSAPPADKFKTFEATFTAACKANIAAAATKVP----------LFVAKLDAAYA 85
            KA     +  PPADK++TF ATF AA     A   +  P           + +KLDAAY 
Sbjct  38   KARSERPAIVPPADKYRTFVATFGAASNKAFAEGLSGEPKGGAESSSKAALTSKLDAAYK 97
Query  86   VAYKTAAGPTPEAKYDAFVAALTEALRVIAGALEVHAVKPAAEEVPAAKIPAGELQIVDK 145
            +AYKTA G TPEAKYDA+VA L+EALR+IAG LEVHAVKPAAEEV    IPAGELQ+++K
Sbjct  98   LAYKTAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEK 155
Query  146  IDAAYKIAATAANAAPANDKFTVFEGAFNKAIKESTGGAYESYKFIPTLEAAVKQAYAAT 205
            +DAA+K+AATAANAAPANDKFTVFE AFN AIK  TGGAYESYKFIP LEAAVKQAYAAT
Sbjct  156  VDAAFKVAATAANAAPANDKFTVFEAAFNNAIKAGTGGAYESYKFIPALEAAVKQAYAAT 215
Query  206  VAAAPEVKYAVFEAALTKAITAMSEAQKVATPAAAATGAATAAASAATGAATAAAGGYKV 265
            VA APEVKY VFE AL KAITAMSEAQK A PAAAAT  AT+A  A TGA TAAAGGYKV
Sbjct  216  VATAPEVKYTVFETALKKAITAMSEAQKAAKPAAAATATATSAVGAPTGATTAAAGGYKV 275

Sequence Alignment: 24. Allergen Name: Pha a 5 Sequence ID: P56164

 Score = 227.7 bits 970,  Expect = 4e-61
 Identities = 170/254 66%, Positives = 189/254 74%, Gaps = 6/254 2%
Query  6    TPAAAATPAAAGGKAMTEEQKLIEDVNAGFKAAVAAASSAPPADKFKTFEATFTAACKAN 65
            TP     P A     +T   + +ED+NA  +    A  S PPADKFKTF         A+
Sbjct  30   TPPLLPPPRARDKATLT--SRSVEDINAASRRPWWA--SVPPADKFKTFADHVLCVPNAD 85
Query  66   IAAAATKVPLFVAKLDAAYAVAYKTAAGPTPEAKYDAFVAALTEALRVIAGALEVHAVKP 125
            + +AATK P + AKLDAAY VAY+ A G TPEAKYDAF+AALTEALRVIAGA+EVHAVKP
Sbjct  86   VTSAATKAPQLKAKLDAAYRVAYEAAEGSTPEAKYDAFIAALTEALRVIAGAFEVHAVKP 145
Query  126  AAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPANDKFTVFEGAFNKAIKESTGGAY 185
            A EEV A   P GELQIVDKIDAA+KIAATAAN+APANDKFTVFEGAFNKAIKEST GAY
Sbjct  146  ATEEVVAD--PVGELQIVDKIDAAFKIAATAANSAPANDKFTVFEGAFNKAIKESTAGAY 203
Query  186  ESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMSEAQKVATPAAAATGAA 245
            E+YKFIP+LEAAVKQAY ATVA APEVKYAVFEA LTKAITAMSEAQKVA P  +     
Sbjct  204  ETYKFIPSLEAAVKQAYGATVARAPEVKYAVFEAGLTKAITAMSEAQKVAKPPLSPQPPQ 263
Query  246  TAAASAATGAATAAAGGYKV 265
                +A   A  AAA   +V
Sbjct  264  VLPLAAGGAATVAAASDVRV 283

Sequence Alignment: 25. Allergen Name: Pha a 5 Sequence ID: P56167

 Score = 198.6 bits 841,  Expect = 1e-52
 Identities = 143/168 85%, Positives = 152/168 90%, Gaps = 7/168 4%
Query  98   AKYDAFVAALTEALRVIAGALEVHAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAA 157
            AKYDAF+AALTEALRVIAGA+EVHAVKPA EEVPAAKIPAGELQIVDKIDAA+KIAATAA
Sbjct  1    AKYDAFIAALTEALRVIAGAFEVHAVKPATEEVPAAKIPAGELQIVDKIDAAFKIAATAA 60
Query  158  NAAPANDKFTVFEGAFNKAIKESTGGAYESYKFIPTLEAA-VKQAYAATVAAAPEVKYAV 216
            N+APANDKFTVFEGAFNKAIKE  GGAYE+YKFIP+LEA+  KQAY ATVA APEVKYAV
Sbjct  61   NSAPANDKFTVFEGAFNKAIKERHGGAYETYKFIPSLEASRSKQAYGATVARAPEVKYAV 120
Query  217  FEAALTKAITAMSEAQKVATPAAAATGAATAAASAATGAATAAA------GGYKV 265
            FEA LTKAITAMSEAQKVA P  + T AA  AA+AA GAAT AA      GGYKV
Sbjct  121  FEAGLTKAITAMSEAQKVAKPVRSVTAAAAGAATAAGGAATVAASRPTSAGGYKV 175

Sequence Alignment: 26. Allergen Name: Sec c 5.0101 Sequence ID: CBG76811

 Score = 197.6 bits 838,  Expect = 4e-52
 Identities = 167/252 66%, Positives = 203/252 80%, Gaps = 21/252 8%
Query  5    YTPAAAATPAAAGGKAMTEEQKLIEDVNAGFKAAVAAASSAPPADKFKTFEATF------ 58
            Y PAA  T      KA T EQKL+E++N GFKAAV AA++  PADK+KTF+ TF      
Sbjct  27   YAPAAPGTQP----KATTPEQKLMENINNGFKAAVEAAAAVAPADKYKTFQTTFIKGSNK 82
Query  59   ------TAACKANIAAAATKVPLFVAKLDAAYAVAYKTAAGPTPEAKYDAFVAALTEALR 112
                  TAA    I A +  +  +   L+++Y +AY +A G TPE KYD +VA+LTE+LR
Sbjct  83   AFADVLTAAASGQIPAQSDSMARLSTSLESSYKLAYDSAEGATPETKYDTYVASLTESLR 142
Query  113  VIAGALEVHAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPANDKFTVFEGA 172
            VI+GA+EVHAVKPA+EEV    +PA +L++VD+IDAAY+ AATAANAAP NDKF VFE +
Sbjct  143  VISGAFEVHAVKPASEEVKG--VPAPQLKVVDQIDAAYRTAATAANAAPTNDKFNVFESS 200
Query  173  FNKAIKESTGGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMSEAQ 232
            FNKAIKE+TGGAY SY F+P LE+AVKQAYAATVA+APEVKYAVF+AAL+KAI AM EA+
Sbjct  201  FNKAIKENTGGAYASYTFVPALESAVKQAYAATVASAPEVKYAVFQAALSKAINAMVEAE 260
Query  233  KVATPAAAATGAATAAASAATGAAT-AAAGGYK 264
            K A PAAAA  AATA A+A  GAA  AAAGGYK
Sbjct  261  KDAKPAAAA--AATATATATVGAAAGAAAGGYK 291

Sequence Alignment: 27. Allergen Name: Hor v 5.0101 Sequence ID: U57845

 Score = 181.0 bits 765,  Expect = 5e-47
 Identities = 129/207 62%, Positives = 157/207 75%, Gaps = 7/207 3%
Query  52   KTFEATFTAACKANIAAAATKVPLFVAKLDAAYAVAYKTAAGPTPEAKYDAFVAALTEAL 111
            K F   +  A    IA  ++ +  + + L+ +Y +AY  A G TPEAKYDA+VA LTE+L
Sbjct  107  KAFAEVLKGAATGQIAGQSSSMAKLSSSLELSYKLAYDKAQGATPEAKYDAYVATLTESL 166
Query  112  RVIAGALEVHAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPANDKFTVFEG 171
            RVI+G LEVH+VKPAAEEV    +PAGEL+ +D++DAA++ AATAA+AAPANDKFTVFE 
Sbjct  167  RVISGTLEVHSVKPAAEEVKG--VPAGELKAIDQVDAAFRTAATAADAAPANDKFTVFES 224
Query  172  AFNKAIKESTGGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMSEA 231
                  ++  GGAYESYKFIP LEAAVKQAYAATVAAAPEVK+ VF+ AL+KAI AM++A
Sbjct  225  LQQGPSRKPRGGAYESYKFIPALEAAVKQAYAATVAAAPEVKFTVFQTALSKAINAMTQA 284
Query  232  QKVATPAAAATGAATAAASAATGAATAAAGGYKV 265
             KVA PAAAAT  AT AA AA     A AG YKV
Sbjct  285  GKVAKPAAAATATATVAAGAA-----ATAGNYKV 313

Sequence Alignment: 28. Allergen Name: Lol p 5 Sequence ID: Q40240

 Score = 174.6 bits 737,  Expect = 4e-45
 Identities = 147/253 58%, Positives = 171/253 67%, Gaps = 18/253 7%
Query  1    ADAGYTPAAAATPAA-----AGGKAMTEEQKLIEDVNAGFKAAVAAASSAPPAD------ 49
            ADAGYTPAAAATPA      AGG    ++++  E   AG +  +A+    PP        
Sbjct  26   ADAGYTPAAAATPATPAATPAGGWREGDDRR-AE--AAGGRQRLASRQPWPPLPTPLRRT 82
Query  50   KFKTFEATFTAACKANIAAAATKVPLFVAKLDAAYAVAYKTAAGPTPEAKYDAFVAALTE 109
              ++      +  +A+   +A K P ++ KLD AY VAYK AA   P  +   +      
Sbjct  83   SSRSSRPPSPSPPRASSPTSAAKAPGLIPKLDTAYDVAYK-AAEAHPRGQVRRLRHCPHR 141
Query  110  ALRVIAGALEVHAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPANDKFTVF 169
            +LRVIAGALEVHAVKPA EEV AAKIP GELQIVDKIDAA+KIAATAANAAP NDKFTVF
Sbjct  142  SLRVIAGALEVHAVKPATEEVLAAKIPTGELQIVDKIDAAFKIAATAANAAPTNDKFTVF 201
Query  170  EGAFNKAIKESTGGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMS 229
            E AFNKA+ E TGGA       P       +       AAPEVKYAVFEAALTKAITAM+
Sbjct  202  ESAFNKALNECTGGAMRPTSSSPPSRPRSSRPTPPPSPAAPEVKYAVFEAALTKAITAMT 261
Query  230  EAQKVATPAAAATGAATAAASAATGAATAAA 260
            +AQK   PAAA   AATAAA+ AT AATAAA
Sbjct  262  QAQKAGKPAAA---AATAAATVATAAATAAA 289

Sequence Alignment: 29. Allergen Name: Pha a 5 Sequence ID: P56166

 Score = 165.0 bits 695,  Expect = 3e-42
 Identities = 181/252 71%, Positives = 198/252 78%, Gaps = 30/252 11%
Query  1    ADAGY--TPAAAATPAAAGGKAMTEEQKLIEDVNAGFKAAVAAASSAPPADKFKTFEATF 58
            ADAG   TPA  A P AA GKA T EQKLIED+NA FK   A   SAPPADK+KTFE  F
Sbjct  26   ADAGTPPTPATPAVPGAAAGKATTHEQKLIEDINAAFKWWPA---SAPPADKYKTFETAF 82
Query  59   TAACKANIAAAATKVPLFVAKLDAAYAVAYKTAAGPTPEAKYDAFVAALTEALRVIAGAL 118
            +   KANIA A+TK       LDAAY+V Y TAAG TPEAKYD+FV ALTEALR++AG L
Sbjct  83   S---KANIAGASTK------GLDAAYSVVYNTAAGATPEAKYDSFVTALTEALRIMAGTL 133
Query  119  EVHAVKPAAEE-VPAAKIPAGELQIVDKIDAAYKIAAT---------AANAAPANDKFTV 168
            EVHAVKPA EE VP+AKI     +   +  + +KIAAT         AAN+APANDKFTV
Sbjct  134  EVHAVKPATEEEVPSAKILRANSRSSTR-SSRFKIAATVATPLSHSTAANSAPANDKFTV 192
Query  169  FEGAFNKAIKESTGGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAM 228
            FEGAFNKAIKE  GG  E+YKFIP+LEAAVKQAY ATVA APEVKYAVFEA LTKAITAM
Sbjct  193  FEGAFNKAIKERHGGPTETYKFIPSLEAAVKQAYGATVARAPEVKYAVFEAGLTKAITAM 252
Query  229  SEAQKVATPAAAATGAATAAASAATGAATAAA-----GGYKV 265
            SEAQKVA P   +         AA GAAT AA     GGYKV
Sbjct  253  SEAQKVAKPVRLSPQPPQVLPLAAGGAATVAAASDSRGGYKV 294

Sequence Alignment: 30. Allergen Name: Pha a 5 Sequence ID: P56165

 Score = 149.3 bits 626,  Expect = 2e-37
 Identities = 129/254 50%, Positives = 166/254 65%, Gaps = 25/254 9%
Query  3    AGYTPAAAATPAAAGGKAMTEEQKLIEDVNAGFKAAVAAASSAPP----ADKFKTFEATF 58
            A  T A  ATPAA+   A T E  ++    AG+     AA         +D+    +   
Sbjct  36   ASATLATPATPAASPQHAGTTEYHIVR--KAGLNEEKNAARQTDDEQKRSDEINCPDFNK 93
Query  59   TAACKANIAAAATKVPLFVAKLDAAYAVAYKTAAGPTPEAKYDAFVAALTEALRVIAGAL 118
            +  C+A+     +      +K D A+ + Y +  G + +   DA V +++  + VI  A+
Sbjct  94   SVHCRADRLPVCSSTSAHSSKQDVAWMLGYGSIQGFSMD---DASVGSVSSEFHVIESAI 150
Query  119  EVHAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPANDKFTVFEGAFNKAIK 178
            EV  +    EEV    IPAGE+++++K+ AA+  AATAA+ APANDKFTVF  +FNKAIK
Sbjct  151  EV--ITYIGEEVKV--IPAGEVEVINKVKAAFSTAATAADEAPANDKFTVFVSSFNKAIK 206
Query  179  ESTGGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMSEAQKVATPA 238
            E+TGGAY  YKFIPTLEAAVKQAYAA+ A APEVKYAVFE AL KAI+AMSEAQK A PA
Sbjct  207  ETTGGAYAGYKFIPTLEAAVKQAYAASSATAPEVKYAVFETALKKAISAMSEAQKEAKPA 266
Query  239  AAATGAATA-AASAATGAA-----------TAAAGGYKV 265
            AA + A T  +AS AT AA            A AGGYKV
Sbjct  267  AAISAATTTISASTATPAAPPPPQLGTATPAAVAGGYKV 305

Sequence Alignment: 31. Allergen Name: Phl p 6.0101 Sequence ID: P43215

 Score = 110.4 bits 453,  Expect = 3e-26
 Identities = 71/118 60%, Positives = 85/118 72%, Gaps = 0/118 0%
Query  10   AATPAAAGGKAMTEEQKLIEDVNAGFKAAVAAASSAPPADKFKTFEATFTAACKANIAAA 69
            A +P A GGKA TEEQKLIEDVNA F+AA+A  ++ PPADK+KTFEA FT + K N+A A
Sbjct  15   ATSPTAEGGKATTEEQKLIEDVNASFRAAMATTANVPPADKYKTFEAAFTVSSKRNLADA 74
Query  70   ATKVPLFVAKLDAAYAVAYKTAAGPTPEAKYDAFVAALTEALRVIAGALEVHAVKPAA 127
             +K P +V KLD  Y  AY  A    PE KY+AFV  ++EALR+IAG  EVHAVKP A
Sbjct  75   VSKAPQLVPKLDEVYNAAYNAADHAAPEDKYEAFVLHFSEALRIIAGTPEVHAVKPGA 132

Sequence Alignment: 32. Allergen Name: Phl p 6.0102 Sequence ID: CAA76556

 Score = 108.5 bits 445,  Expect = 1e-25
 Identities = 69/118 58%, Positives = 84/118 71%, Gaps = 0/118 0%
Query  10   AATPAAAGGKAMTEEQKLIEDVNAGFKAAVAAASSAPPADKFKTFEATFTAACKANIAAA 69
            A +P A GGKA TEEQKLIED+NA F+AA+A  ++ PPADK+KTFEA FT + K N+A A
Sbjct  21   ATSPTAEGGKATTEEQKLIEDINASFRAAMATTANVPPADKYKTFEAAFTVSSKRNLADA 80
Query  70   ATKVPLFVAKLDAAYAVAYKTAAGPTPEAKYDAFVAALTEALRVIAGALEVHAVKPAA 127
             +K P +V KLD  Y  AY  A    PE KY+AFV  ++EAL +IAG  EVHAVKP A
Sbjct  81   VSKAPQLVPKLDEVYNAAYNAADHAAPEDKYEAFVLHFSEALHIIAGTPEVHAVKPGA 138

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.