The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

ADDLTTLRNGTLDRGITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQISH
QIAILIHGFLSTGNNENFDAMAKALIEIDNFLVISVDWKKGACNAFASTNDVLGYSQAVG
NTRHVGKYVADFTKLLVEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGL
DPAGPSFLTNKCPNRLCETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSEPSC
SHTKAVKYLTECIKRECCLIGTPWKSYFSTPKPISQCKRDTCVCVGLNAQSYPAKGSFYV
PVEKDAPYCHNEGIKL
Sequence Info Allergen Name Length Opt Bits Score E Value
AAS67042 Pol d 1.0102 316 2143 495.0 1.6e-141
AAS67041 Pol d 1.0101 337 2139 494.1 3.2e-141
AAS67043 Pol d 1.0103 316 2128 491.6 1.7e-140
AAS67044 Pol d 1.0104 316 2121 490.0 5.2e-140
Q9U6W0 Pol a 1 301 1765 408.8 1.3e-115
ABN13879 Poly p 1.0101 322 1700 394.0 4.1e-111
3989146 Pol e 1.0101 302 1430 332.5 1.3e-92
P53357 Dol m 1.02 303 1208 281.9 2.2e-77
C0HLL3 Vesp v 1.0101 304 1171 273.4 7.6e-75
P49369 Ves v 1 336 1144 267.3 6.1e-73
Q06478 Dol m 1.0101 317 1127 263.4 8.3e-72
P51528 Ves m 1 300 1108 259.1 1.6e-70
ACA00159 Vesp c 1.0101 301 1104 258.2 3e-70
3989146 Ves s 1.0101 298 1056 247.2 5.8e-67
AAT95008 Sol i 1.0101 346 491 118.4 4.1e-28
P83542 Pol g 1.0101 42 269 72.7 2.8e-15
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Pol d 1.0102 Sequence ID: AAS67042

 Score = 495.0 bits 2143,  Expect = 2e-141
 Identities = 316/316 100%, Positives = 316/316 100%, Gaps = 0/316 0%
Query  1    ADDLTTLRNGTLDRGITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQISH 60
            ADDLTTLRNGTLDRGITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQISH
Sbjct  1    ADDLTTLRNGTLDRGITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQISH 60
Query  61   QIAILIHGFLSTGNNENFDAMAKALIEIDNFLVISVDWKKGACNAFASTNDVLGYSQAVG 120
            QIAILIHGFLSTGNNENFDAMAKALIEIDNFLVISVDWKKGACNAFASTNDVLGYSQAVG
Sbjct  61   QIAILIHGFLSTGNNENFDAMAKALIEIDNFLVISVDWKKGACNAFASTNDVLGYSQAVG 120
Query  121  NTRHVGKYVADFTKLLVEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGL 180
            NTRHVGKYVADFTKLLVEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGL
Sbjct  121  NTRHVGKYVADFTKLLVEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGL 180
Query  181  DPAGPSFLTNKCPNRLCETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSEPSC 240
            DPAGPSFLTNKCPNRLCETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSEPSC
Sbjct  181  DPAGPSFLTNKCPNRLCETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSEPSC 240
Query  241  SHTKAVKYLTECIKRECCLIGTPWKSYFSTPKPISQCKRDTCVCVGLNAQSYPAKGSFYV 300
            SHTKAVKYLTECIKRECCLIGTPWKSYFSTPKPISQCKRDTCVCVGLNAQSYPAKGSFYV
Sbjct  241  SHTKAVKYLTECIKRECCLIGTPWKSYFSTPKPISQCKRDTCVCVGLNAQSYPAKGSFYV 300
Query  301  PVEKDAPYCHNEGIKL 316
            PVEKDAPYCHNEGIKL
Sbjct  301  PVEKDAPYCHNEGIKL 316

Sequence Alignment: 2. Allergen Name: Pol d 1.0101 Sequence ID: AAS67041

 Score = 494.1 bits 2139,  Expect = 3e-141
 Identities = 315/316 99%, Positives = 316/316 100%, Gaps = 0/316 0%
Query  1    ADDLTTLRNGTLDRGITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQISH 60
            ADDLTTLRNGTLDRGITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQISH
Sbjct  22   ADDLTTLRNGTLDRGITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQISH 81
Query  61   QIAILIHGFLSTGNNENFDAMAKALIEIDNFLVISVDWKKGACNAFASTNDVLGYSQAVG 120
            QIAILIHGFLSTGNNENFDAMAKALIEIDNFLVISVDWKKGACNAFASTNDVLGYSQAVG
Sbjct  82   QIAILIHGFLSTGNNENFDAMAKALIEIDNFLVISVDWKKGACNAFASTNDVLGYSQAVG 141
Query  121  NTRHVGKYVADFTKLLVEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGL 180
            NTRHVGKYVADFTKLLVEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGL
Sbjct  142  NTRHVGKYVADFTKLLVEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGL 201
Query  181  DPAGPSFLTNKCPNRLCETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSEPSC 240
            DPAGPSFLTNKCPNRLCETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSEPSC
Sbjct  202  DPAGPSFLTNKCPNRLCETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSEPSC 261
Query  241  SHTKAVKYLTECIKRECCLIGTPWKSYFSTPKPISQCKRDTCVCVGLNAQSYPAKGSFYV 300
            SHTKAVKYLTECIKRECCLIGTPWKSYFSTPKPISQCKRDTCVCVGLNAQSYPAKGSFYV
Sbjct  262  SHTKAVKYLTECIKRECCLIGTPWKSYFSTPKPISQCKRDTCVCVGLNAQSYPAKGSFYV 321
Query  301  PVEKDAPYCHNEGIKL 316
            PV+KDAPYCHNEGIKL
Sbjct  322  PVDKDAPYCHNEGIKL 337

Sequence Alignment: 3. Allergen Name: Pol d 1.0103 Sequence ID: AAS67043

 Score = 491.6 bits 2128,  Expect = 2e-140
 Identities = 313/316 99%, Positives = 316/316 100%, Gaps = 0/316 0%
Query  1    ADDLTTLRNGTLDRGITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQISH 60
            ADDLTTLRNGTLDRGITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQISH
Sbjct  1    ADDLTTLRNGTLDRGITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQISH 60
Query  61   QIAILIHGFLSTGNNENFDAMAKALIEIDNFLVISVDWKKGACNAFASTNDVLGYSQAVG 120
            QIAILIHGFLSTGNNENFDAMAKALIEIDNFLVISVDWKKGACNAFASTNDVLGYSQAVG
Sbjct  61   QIAILIHGFLSTGNNENFDAMAKALIEIDNFLVISVDWKKGACNAFASTNDVLGYSQAVG 120
Query  121  NTRHVGKYVADFTKLLVEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGL 180
            NTRHVGKYVADFTKLLVEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGL
Sbjct  121  NTRHVGKYVADFTKLLVEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGL 180
Query  181  DPAGPSFLTNKCPNRLCETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSEPSC 240
            DPAGPSFLT+KCP+RLCETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSEPSC
Sbjct  181  DPAGPSFLTSKCPDRLCETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSEPSC 240
Query  241  SHTKAVKYLTECIKRECCLIGTPWKSYFSTPKPISQCKRDTCVCVGLNAQSYPAKGSFYV 300
            SHTKAVKYLTECIKRECCLIGTPWKSYFSTPKPISQCKRDTCVCVGLNAQSYPAKGSFYV
Sbjct  241  SHTKAVKYLTECIKRECCLIGTPWKSYFSTPKPISQCKRDTCVCVGLNAQSYPAKGSFYV 300
Query  301  PVEKDAPYCHNEGIKL 316
            PV+KDAPYCHNEGIKL
Sbjct  301  PVDKDAPYCHNEGIKL 316

Sequence Alignment: 4. Allergen Name: Pol d 1.0104 Sequence ID: AAS67044

 Score = 490.0 bits 2121,  Expect = 5e-140
 Identities = 313/316 99%, Positives = 315/316 99%, Gaps = 0/316 0%
Query  1    ADDLTTLRNGTLDRGITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQISH 60
            ADDLTTLRNGTLDRGITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQISH
Sbjct  1    ADDLTTLRNGTLDRGITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQISH 60
Query  61   QIAILIHGFLSTGNNENFDAMAKALIEIDNFLVISVDWKKGACNAFASTNDVLGYSQAVG 120
            QIAILIHGFLSTGNNENFDAMAKALIEIDNFLVISVDWKKGACNAFASTNDVLGYSQAVG
Sbjct  61   QIAILIHGFLSTGNNENFDAMAKALIEIDNFLVISVDWKKGACNAFASTNDVLGYSQAVG 120
Query  121  NTRHVGKYVADFTKLLVEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGL 180
            NTRHVGKYVADFTKLLVEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGL
Sbjct  121  NTRHVGKYVADFTKLLVEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGL 180
Query  181  DPAGPSFLTNKCPNRLCETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSEPSC 240
            DPAGPSFLT+KCP+RLCETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSEPSC
Sbjct  181  DPAGPSFLTSKCPDRLCETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSEPSC 240
Query  241  SHTKAVKYLTECIKRECCLIGTPWKSYFSTPKPISQCKRDTCVCVGLNAQSYPAKGSFYV 300
            SHTKAVKYLTECIKRECCLIGTPWKSYFSTPK ISQCKRDTCVCVGLNAQSYPAKGSFYV
Sbjct  241  SHTKAVKYLTECIKRECCLIGTPWKSYFSTPKSISQCKRDTCVCVGLNAQSYPAKGSFYV 300
Query  301  PVEKDAPYCHNEGIKL 316
            PVEKDAPYCHNEGIKL
Sbjct  301  PVEKDAPYCHNEGIKL 316

Sequence Alignment: 5. Allergen Name: Pol a 1 Sequence ID: Q9U6W0

 Score = 408.8 bits 1765,  Expect = 1e-115
 Identities = 254/301 84%, Positives = 276/301 91%, Gaps = 0/301 0%
Query  16   ITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQISHQIAILIHGFLSTGNN 75
            ++PDCTFNEKDI ++VYSRDKR+GIILKKE L NYDLF KS IS Q+  LIHGFLSTGNN
Sbjct  1    MSPDCTFNEKDIVFYVYSRDKRDGIILKKETLTNYDLFTKSTISKQVVFLIHGFLSTGNN 60
Query  76   ENFDAMAKALIEIDNFLVISVDWKKGACNAFASTNDVLGYSQAVGNTRHVGKYVADFTKL 135
            ENF AM+KALIE D+FLVISVDWKKGACNAFAST D LGYS+AVGNTRHVGK+VADFTKL
Sbjct  61   ENFVAMSKALIEKDDFLVISVDWKKGACNAFASTKDALGYSKAVGNTRHVGKFVADFTKL 120
Query  136  LVEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGLDPAGPSFLTNKCPNR 195
            LVE+YKV +SNIRLIGHSLGAHTSGFAGKEVQ+LKLGKYKEIIGLDPAGP F  + CP+R
Sbjct  121  LVEKYKVLISNIRLIGHSLGAHTSGFAGKEVQKLKLGKYKEIIGLDPAGPYFHRSDCPDR 180
Query  196  LCETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSEPSCSHTKAVKYLTECIKR 255
            LC TDAEYVQ IHTS ILGVYYNVGSVDFYVNYGK+QPGC+EPSCSHTKAVKYLTECIK 
Sbjct  181  LCVTDAEYVQVIHTSIILGVYYNVGSVDFYVNYGKNQPGCNEPSCSHTKAVKYLTECIKH 240
Query  256  ECCLIGTPWKSYFSTPKPISQCKRDTCVCVGLNAQSYPAKGSFYVPVEKDAPYCHNEGIK 315
            ECCLIGTPWK YFSTPKPISQC+ DTCVCVGLNA+SYPA+G+FY PVE +APYCHNEGIK
Sbjct  241  ECCLIGTPWKKYFSTPKPISQCRGDTCVCVGLNAKSYPARGAFYAPVEANAPYCHNEGIK 300
Query  316  L 316
            L
Sbjct  301  L 301

Sequence Alignment: 6. Allergen Name: Poly p 1.0101 Sequence ID: ABN13879

 Score = 394.0 bits 1700,  Expect = 4e-111
 Identities = 247/307 80%, Positives = 266/307 86%, Gaps = 3/307 0%
Query  10   GTLDRGITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQISHQIAILIHGF 69
            GTLDRG+ P+C FNE DI + VY+R +R+GI+L +E L+NYDLF+KS IS Q+  + HGF
Sbjct  13   GTLDRGLIPECPFNEYDILFFVYTRQQRDGIVLTEETLQNYDLFKKSTISRQVVFIDHGF 72
Query  70   LSTGNNENFDAMAKALIEIDNFLVISVDWKKGACNAFASTNDVLGYSQAVGNTRHVGKYV 129
            LS GNNENF AMAKALIE DNFLVISVDWKKGACNAFAST D LGYS AVGNTRHVGKYV
Sbjct  73   LSNGNNENFIAMAKALIEKDNFLVISVDWKKGACNAFASTLDYLGYSTAVGNTRHVGKYV 132
Query  130  ADFTKLLVEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGLDPAGPSFLT 189
            ADFTKLLVEQYKV MSNIRLIGHSLGAHTSGFAGKEVQ LKL KY  I GLDPAGPSF +
Sbjct  133  ADFTKLLVEQYKVSMSNIRLIGHSLGAHTSGFAGKEVQELKLNKYSNIDGLDPAGPSFDS 192
Query  190  NKCPNRLCETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSE---PSCSHTKAV 246
            N CP RLCETDAEYVQ IHTS ILGVY  +G+VDFY+NYG  QPGC     PSCSHTKAV
Sbjct  193  NDCPERLCETDAEYVQIIHTSNILGVYSKIGTVDFYMNYGSHQPGCGRFFSPSCSHTKAV 252
Query  247  KYLTECIKRECCLIGTPWKSYFSTPKPISQCKRDTCVCVGLNAQSYPAKGSFYVPVEKDA 306
            KYLTECIK ECCLIGTPWK YFSTPKPISQC +DTCVCVGLNA+SYPA+GSFYVPVE  A
Sbjct  253  KYLTECIKHECCLIGTPWKKYFSTPKPISQCTKDTCVCVGLNAKSYPARGSFYVPVEATA 312
Query  307  PYCHNEGIKL 316
            PYCHNEGIKL
Sbjct  313  PYCHNEGIKL 322

Sequence Alignment: 7. Allergen Name: Pol e 1.0101 Sequence ID: 3989146

 Score = 332.5 bits 1430,  Expect = 1e-92
 Identities = 209/301 69%, Positives = 239/301 79%, Gaps = 2/301 0%
Query  15   GITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKS-QISHQIAILIHGFLSTG 73
            G++PDCTFNEKDI ++VYSRDKR+GIILKK+ L NYDLF KS  +S Q+  LIHGFL++ 
Sbjct  1    GMSPDCTFNEKDIVFYVYSRDKRDGIILKKDSLTNYDLFTKSITVSKQVVFLIHGFLTSX 60
Query  74   NNENFDAMAKALIEIDNFLVISVDWKKGACNAFASTNDVLGYSQAVGNTRHVGKYVADFT 133
                  +++ ALIE D+FLV+SVDWKK            LGYS+       +G YVADFT
Sbjct  61   XXXXXXSLSGALIEGDDFLVMSVDWKKXXXXXXXXXXGALGYSKXASIKDALGTYVADFT 120
Query  134  KLLVEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGLDPAGPSFLTNKCP 193
            KL + +YKV     R IGHSLGAHTSGFAGKEVQ+LKLGKYKEIIGLDPAGPSFLT+KCP
Sbjct  121  KLKLGKYKVLRXXXRGIGHSLGAHTSGFAGKEVQKLKLGKYKEIIGLDPAGPSFLTSKCP 180
Query  194  NRLCETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSEPSCSHTKAVKYLTECI 253
            +RLCE+  +Y Q +HTS   GVYYNVGSVDFYVNYGKSQPGC+EPSC   KA KYLTECI
Sbjct  181  DRLCESGTDYTQILHTSXXXGVYYNVGSVDFYVNYGKSQPGCNEPSCXXXKATKYLTECI 240
Query  254  KRECCLIGTPWKSYFSTPKPISQCKRDTCVCVGLNAQSYPAKGSFYVPVEKDAPYCHNEG 313
            K ECCLI TPW  YFSTPKPISQC RDTCVCVGLNA+SYPA+G+FY PVE +APYCHNEG
Sbjct  241  KEECCLISTPWFKYFSTPKPISQC-RDTCVCVGLNAKSYPARGAFYAPVEANAPYCHNEG 299
Query  314  IKL 316
            IKL
Sbjct  300  IKL 302

Sequence Alignment: 8. Allergen Name: Dol m 1.02 Sequence ID: P53357

 Score = 281.9 bits 1208,  Expect = 2e-77
 Identities = 170/295 57%, Positives = 227/295 76%, Gaps = 9/295 3%
Query  15   GITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQIS-HQIAILIHGFLSTG 73
            GI P+C +  ++I + + +R+ R+G+ L  + LKN  +F+ S +S  ++  LIHGF+S+ 
Sbjct  1    GILPECKLVPEEISFVLSTRENRDGVYLTLQKLKNGKMFKNSDLSSKKVPFLIHGFISSA 60
Query  74   NNENFDAMAKALIEIDNFLVISVDWKKGAC-NAFASTNDVLGYSQAVGNTRHVGKYVADF 132
             N+N+  M +AL++ D+ +VIS+DW+ GAC N FA     +GY +AV NTR VGKY+ADF
Sbjct  61   TNKNYADMTRALLDKDDIMVISIDWRDGACSNEFALLK-FIGYPKAVENTRAVGKYIADF 119
Query  133  TKLLVEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGLDPAGPSFLTNKC 192
            +K+L+++YKV + NIRLIGHSLGA+ +GFAGKE QR+KLGKY EIIGLDPAGPSF    C
Sbjct  120  SKILIQKYKVLLENIRLIGHSLGAQIAGFAGKEFQRFKLGKYPEIIGLDPAGPSFKKKDC 179
Query  193  PNRLCETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSE---PSCSHTKAVKYL 249
            P R+CETDA YVQ +HTS+ LG    +G+VDFY+N G +QPGC+     +CSHT+AVKYL
Sbjct  180  PERICETDAHYVQILHTSSNLGTERTLGTVDFYINDGSNQPGCTYIIGETCSHTRAVKYL 239
Query  250  TECIKRECCLIGTPWKSYFSTPKPISQCKRDTCVCVGLNAQSYPAKGSFYVPVEKDAPYC 309
            TECI+RECCLIG P       P+P+S+C R+ CVCVGLNA+ YP KGSFYVPVE  AP+C
Sbjct  240  TECIRRECCLIGVPQSK---NPQPVSKCTRNECVCVGLNAKEYPKKGSFYVPVEAKAPFC 296
Query  310  HNEG 313
            +N G
Sbjct  297  NNNG 300

Sequence Alignment: 9. Allergen Name: Vesp v 1.0101 Sequence ID: C0HLL3

 Score = 273.4 bits 1171,  Expect = 8e-75
 Identities = 167/299 55%, Positives = 221/299 73%, Gaps = 8/299 2%
Query  15   GITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQISH-QIAILIHGFLSTG 73
            G+ P C +  + I + + +R+ RNG+ L  + LK   ++ KS +S  Q+  LIHGF+S+ 
Sbjct  1    GLLPKCKLVPEQISFILSTRENRNGVFLTLDSLKKGGILNKSDLSSTQVVFLIHGFISSA 60
Query  74   NNENFDAMAKALIEIDNFLVISVDWKKGACNAFASTNDVLGYSQAVGNTRHVGKYVADFT 133
            NN N+  M KAL+E ++ +VIS+DW+ GAC         +GY +AV NTR VGKY+ADF+
Sbjct  61   NNSNYMDMTKALLEKNDCMVISIDWRNGACTNEFQILKFIGYPKAVENTRTVGKYIADFS 120
Query  134  KLLVEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGLDPAGPSFLTNKCP 193
            KLL+++YKV ++NIRLIGHSLGA+ +GFAGKE Q++KLGKY EIIGLDPAGP F +N C 
Sbjct  121  KLLMQKYKVSLANIRLIGHSLGAQIAGFAGKEYQKFKLGKYPEIIGLDPAGPLFKSNDCS 180
Query  194  NRLCETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSEP----SCSHTKAVKYL 249
             R+CETDA YVQ IHTS  LG    +G+VDFY+N G +QPGC       +CSHT+AV+Y+
Sbjct  181  QRICETDAHYVQIIHTSNNLGTERTLGTVDFYMNNGYNQPGCYYSFIGETCSHTRAVQYF 240
Query  250  TECIKRECCLIGTPWKSYFSTPKPISQCKRDTCVCVGLNAQSYPAKGSFYVPVEKDAPYC 309
            TECI+ ECCLIG P       P+P+S+C R+ CVCVGLNA+ YP  GSFYVPVE  APYC
Sbjct  241  TECIRHECCLIGVPQS---KNPQPVSKCTRNECVCVGLNAKRYPKTGSFYVPVESKAPYC 297
Query  310  HNEGIKL 316
            +N+G K+
Sbjct  298  NNKGKKI 304

Sequence Alignment: 10. Allergen Name: Ves v 1 Sequence ID: P49369

 Score = 267.3 bits 1144,  Expect = 6e-73
 Identities = 166/297 55%, Positives = 214/297 72%, Gaps = 8/297 2%
Query  12   LDRGITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQISHQIAILIHGFLS 71
            LDRG  P C FN   + + + +R+ RN  +   + L+N+  F+K  I+  +  + HGF S
Sbjct  34   LDRG--PKCPFNSDTVSIIIETRENRNRDLYTLQTLQNHPEFKKKTITRPVVFITHGFTS 91
Query  72   TGNNENFDAMAKALIEIDNFLVISVDWKKGACNAFASTNDVLGYSQAVGNTRHVGKYVAD 131
            + +  NF  +AKAL++ DN++VIS+DW+  AC   A+    L Y  A  NTR VG+Y+A 
Sbjct  92   SASETNFINLAKALVDKDNYMVISIDWQTAACTNEAAGLKYLYYPTAARNTRLVGQYIAT 151
Query  132  FTKLLVEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGLDPAGPSFLTNK 191
             T+ LV++YK+ M+NIRLIGHSLGAH SGFAGK+VQ LKLGKY EIIGLDPA PSF +N 
Sbjct  152  ITQKLVKHYKISMANIRLIGHSLGAHASGFAGKKVQELKLGKYSEIIGLDPARPSFDSNH 211
Query  192  CPNRLCETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSE---PSCSHTKAVKY 248
            C  RLCETDAEYVQ IHTS  LG    +G+VDFY+N GK+QPGC       CSH++AV Y
Sbjct  212  CSERLCETDAEYVQIIHTSNYLGTEKTLGTVDFYMNNGKNQPGCGRFFSEVCSHSRAVIY 271
Query  249  LTECIKRECCLIGTPWKSYFSTPKPISQCKRDTCVCVGLNAQSYPAKGSFYVPVEKDAPY 308
            + ECIK ECCLIG P KS   + +PIS C +  CVCVGLNA+ YP++GSFYVPVE  AP+
Sbjct  272  MAECIKHECCLIGIP-KS--KSSQPISSCTKQECVCVGLNAKKYPSRGSFYVPVESTAPF 328
Query  309  CHNEG 313
            C+N+G
Sbjct  329  CNNKG 333

Sequence Alignment: 11. Allergen Name: Dol m 1.0101 Sequence ID: Q06478

 Score = 263.4 bits 1127,  Expect = 8e-72
 Identities = 158/291 54%, Positives = 204/291 70%, Gaps = 6/291 2%
Query  20   CTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQISHQIAILIHGFLSTGNNENFD 79
            C F+   +++   +R+ R       + +  ++ F+KS I   +  + HGF S+   +NF 
Sbjct  21   CPFSNDTVKMIFLTRENRKHDFYTLDTMNRHNEFKKSIIKRPVVFITHGFTSSATEKNFV 80
Query  80   AMAKALIEIDNFLVISVDWKKGACNAFASTNDVLGYSQAVGNTRHVGKYVADFTKLLVEQ 139
            AM++AL+   +FL+I VDW+  AC         + Y  AVGNTR VG ++A   K LVEQ
Sbjct  81   AMSEALMHTGDFLIIMVDWRMAACTDEYPGLKYMFYKAAVGNTRLVGNFIAMIAKKLVEQ 140
Query  140  YKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGLDPAGPSFLTNKCPNRLCET 199
            YKVPM+NIRL+GHSLGAH SGFAGK VQ LKLGK+ EIIGLDPAGPSF  N C  R+CET
Sbjct  141  YKVPMTNIRLVGHSLGAHISGFAGKRVQELKLGKFSEIIGLDPAGPSFKKNDCSERICET 200
Query  200  DAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSE---PSCSHTKAVKYLTECIKRE 256
            DA YVQ +HTS+ LG    +G+VDFY+N G +QPGC      +CSHT+AVKY+TECI+RE
Sbjct  201  DAHYVQILHTSSNLGTERTLGTVDFYINNGSNQPGCRYIIGETCSHTRAVKYFTECIRRE 260
Query  257  CCLIGTPWKSYFSTPKPISQCKRDTCVCVGLNAQSYPAKGSFYVPVEKDAPYCHNEG 313
            CCLIG P       P+P+S+C R+ CVCVGLNA+ YP +GSFYVPVE +APYC+N G
Sbjct  261  CCLIGVPQSK---NPQPVSKCTRNECVCVGLNAKKYPKRGSFYVPVEAEAPYCNNNG 314

Sequence Alignment: 12. Allergen Name: Ves m 1 Sequence ID: P51528

 Score = 259.1 bits 1108,  Expect = 2e-70
 Identities = 159/293 54%, Positives = 206/293 70%, Gaps = 6/293 2%
Query  18   PDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQISHQIAILIHGFLSTGNNEN 77
            P C FN   + + + +R+ RN  +   + L+N+  F+K  I+  +  + HGF S+ + +N
Sbjct  2    PKCPFNSDTVSIIIETRENRNRDLYTLQTLQNHPEFKKKTITRPVVFITHGFTSSASEKN 61
Query  78   FDAMAKALIEIDNFLVISVDWKKGACNAFASTNDVLGYSQAVGNTRHVGKYVADFTKLLV 137
            F  +AKAL++ DN++VIS+DW+  AC           Y  A  NTR VG+Y+A  T+ LV
Sbjct  62   FINLAKALVDKDNYMVISIDWQTAACTNEYPGLKYAYYPTAASNTRLVGQYIATITQKLV 121
Query  138  EQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGLDPAGPSFLTNKCPNRLC 197
            + YK+ M+NIRLIGHSLGAH SGFAGK VQ LKLGKY EIIGLDPA PSF +N C  RLC
Sbjct  122  KDYKISMANIRLIGHSLGAHVSGFAGKRVQELKLGKYSEIIGLDPARPSFDSNHCSERLC 181
Query  198  ETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSE---PSCSHTKAVKYLTECIK 254
            ETDAEYVQ IHTS  LG    +G+VDFY+N GK+ PGC       CSHT+AV Y+ ECIK
Sbjct  182  ETDAEYVQIIHTSNYLGTEKILGTVDFYMNNGKNNPGCGRFFSEVCSHTRAVIYMAECIK 241
Query  255  RECCLIGTPWKSYFSTPKPISQCKRDTCVCVGLNAQSYPAKGSFYVPVEKDAPYCHNEG 313
             ECCLIG P +S   + +PIS+C +  CVCVGLNA+ YP++GSFYVPVE  AP+C+N+G
Sbjct  242  HECCLIGIP-RS--KSSQPISRCTKQECVCVGLNAKKYPSRGSFYVPVESTAPFCNNKG 297

Sequence Alignment: 13. Allergen Name: Vesp c 1.0101 Sequence ID: ACA00159

 Score = 258.2 bits 1104,  Expect = 3e-70
 Identities = 163/290 56%, Positives = 210/290 72%, Gaps = 9/290 3%
Query  20   CTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQISHQIAILI-HGFLSTGNNENF 78
            C +++  +++ V +R+ +       + +KN++ F K  I+ +  ++I HGF S+   ENF
Sbjct  4    CPYSDDTVKMIVLTRENKKYDFYTLDTIKNHNEF-KDTITLKPHVFITHGFTSSATAENF 62
Query  79   DAMAKALIEIDNFLVISVDWKKGACNAFASTNDVLGYSQAVGNTRHVGKYVADFTKLLVE 138
              MAKAL++  N+LVI  DW+  AC    +   +  Y  A  NTR VG Y+A  TK+LV+
Sbjct  63   VVMAKALLDKGNYLVILTDWRMAACTNEIAGLKLAYYPYAASNTRLVGNYIATVTKMLVQ 122
Query  139  QYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGLDPAGPSFLTNKCPNRLCE 198
            +Y VPM+NIRLIGHSLGAH SGFAGK+VQ L LGKY EIIGLDPAGPSF +N C  R+CE
Sbjct  123  KYNVPMANIRLIGHSLGAHISGFAGKKVQELGLGKYPEIIGLDPAGPSFKSNDCSQRICE 182
Query  199  TDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSEP----SCSHTKAVKYLTECIK 254
            TDA YVQ IHTS  LG    +G+VDFY+N G +QPGC  P    +CSHT+AVKY+TECIK
Sbjct  183  TDANYVQIIHTSNRLGTERTLGTVDFYMNNGYNQPGCGLPIIGETCSHTRAVKYFTECIK 242
Query  255  RECCLIGTPWKSYFSTPKPISQCKRDTCVCVGLNAQSYPAKGSFYVPVEKDAPYCHNEG 313
             ECCLIG P KS    P+P+S+C R+ CVCVGLNA++YP  GSFYVPVE  APYC+N+G
Sbjct  243  HECCLIGVP-KS--KNPQPVSKCTRNECVCVGLNAKTYPKTGSFYVPVESKAPYCNNKG 298

Sequence Alignment: 14. Allergen Name: Ves s 1.0101 Sequence ID: 3989146

 Score = 247.2 bits 1056,  Expect = 6e-67
 Identities = 155/288 53%, Positives = 198/288 68%, Gaps = 10/288 3%
Query  20   CTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQISHQIAILIHGFLSTGNNENFD 79
            C F++  + + + +R+ RN      + L+N+D F+K  I+  +  + HGF S+   E+F 
Sbjct  4    CPFSDDTVAMVIVTRENRNRDFYTLQTLRNHDEFKKKAITRPVVFITHGFTSSATVESFV 63
Query  80   AMAKALIEIDNFLVISVDWKKGACNAFASTNDVLGYSQAVGNTRHVGKYVADFTKLLVEQ 139
             +  A++E     V   DW+  ACN    T  +L Y  AV NTR VG+Y+A  TK LV  
Sbjct  64   DLQTAILEXXXXKVTVSDWRVAACN---RTTGLLYYVTAVSNTRLVGRYIATVTKKLVTD 120
Query  140  YKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGLDPAGPSFLTNKCPNRLCET 199
            Y V M++IRLIGHSLGAH SGFAGKEVQ+LKL KY EIIGLDPAGPSF +N C  RLC+T
Sbjct  121  YNVSMADIRLIGHSLGAHVSGFAGKEVQKLKLEKYSEIIGLDPAGPSFESNDCAERLCKT 180
Query  200  DAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCS----EPSCSHTKAVKYLTECIKR 255
            DA YVQ IHTS  +G+  ++G VDFYVN G +QPGC     +  CSH++A+ Y+TECIKR
Sbjct  181  DAHYVQIIHTSKKFGIEKSIGHVDFYVNQGNNQPGCGIIPLKDVCSHSRAITYMTECIKR 240
Query  256  ECCLIGTPWKSYFSTPKPISQCKRDTCVCVGLNAQSYPAKGSFYVPVEKDAPYCHNEG 313
            ECCLIG P      + K IS C R  CVCVGL A+SYP  GSFYVPVE  AP+C+N+G
Sbjct  241  ECCLIGIPQSK---SSKSISSCTRQECVCVGLKAKSYPNTGSFYVPVESTAPFCNNKG 295

Sequence Alignment: 15. Allergen Name: Sol i 1.0101 Sequence ID: AAT95008

 Score = 118.4 bits 491,  Expect = 4e-28
 Identities = 91/271 33%, Positives = 145/271 53%, Gaps = 24/271 8%
Query  20   CTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQISHQIAILIHGFLSTGNNENFD 79
            C +      ++VY  + R    ++ + L N    Q    S  +  + HGF S+     F 
Sbjct  40   CVYGNSSY-INVYLYNSR----FQGKNLGNQQSCQDINASLPVVFITHGFTSSAQVSTFK 94
Query  80   AMAKALIEIDNFLVISVDWKKGACNAFASTNDVLGYSQAVGNTRHVGKYVADFTKLLVEQ 139
             +A A+++  +   I VDW + AC           Y+ A  NT  +G+ +A +T  L+ +
Sbjct  95   DLANAFVQKGHTAFI-VDWSEAACTDGLPGVQFAEYNAAASNTYDIGQLMAKYTVDLMNK 153
Query  140  YKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGLDPAGPSFLTNKCPNRLCET 199
             K+P++NI+ +GHSLG+H  GFA K V++L       I+ LDPA PSF +NKC  R+C++
Sbjct  154  CKIPLNNIQYVGHSLGSHVCGFAAKHVKKLINKTMPYILALDPADPSFGSNKCGERICKS 213
Query  200  DAEYVQAIHTSAILGVYYNV-GSVDFYVNYGKSQPGCS--EPSCSHTKAVKYLTECIKRE 256
            DA+ +    TS ILG+  N+ G +    + GKSQP CS  +  CSH++++ Y T  +   
Sbjct  214  DAKRIVVFKTS-ILGIGENIIGHLLIVFDGGKSQPACSWYDVPCSHSESIVYATGMVSGR 272
Query  257  CCLIGTPWKSY-------------FSTPKPISQCKRDTCVCVGLNAQSYPAKGSF 298
            C  +  PW +              F++  P      DT  CV LN   +    +F
Sbjct  273  CQHLAVPWTAQQRINPIQWKFWRVFTSNIPAYPTS-DTTNCVVLNTNVFKNDNTF 326

Sequence Alignment: 16. Allergen Name: Pol g 1.0101 Sequence ID: P83542

 Score = 72.7 bits 269,  Expect = 3e-15
 Identities = 40/42 95%, Positives = 42/42 100%, Gaps = 0/42 0%
Query  15   GITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKS 56
            GITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLF++S
Sbjct  1    GITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFKES 42

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.