The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

AGPFRFPRCRKEFQQAQHLRACQQWLHKQAMQSGSGPQPQGPQQRPPLLQQCCNELHQEE
PLCVCPTLKGASKAVKQQIRQQGQQQGQQGQQLQHEISRIYQTATHLPRVCNIPRVSICP
FQKTMPGPS
Sequence Info Allergen Name Length Opt Bits Score E Value
P80207 Bra j 1 129 949 97.1 1.6e-22
P15322 Sin a 1 127 844 87.7 1e-19
P80208 Bra n 1 125 835 86.9 1.8e-19
CAA62910 Sin a 1 145 604 66.5 3e-13
CAA62912 Sin a 1 145 604 66.5 3e-13
CAA62911 Sin a 1 145 602 66.3 3.4e-13
CAA62909 Sin a 1 145 600 66.1 3.8e-13
CAA62908 Sin a 1 145 598 65.9 4.3e-13
AAB25214 Sin a 1 145 587 65.0 8.5e-13
Q42473 Bra r 1 178 543 61.2 1.4e-11
Q8LPD3 Lin u 1.01 168 233 33.6 0.0028
Q8LPD3 Lin u 1.01 168 233 33.6 0.0028
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Bra j 1 Sequence ID: P80207

 Score = 97.1 bits 949,  Expect = 2e-22
 Identities = 129/129 100%, Positives = 129/129 100%, Gaps = 0/129 0%
Query  1    AGPFRFPRCRKEFQQAQHLRACQQWLHKQAMQSGSGPQPQGPQQRPPLLQQCCNELHQEE 60
            AGPFRFPRCRKEFQQAQHLRACQQWLHKQAMQSGSGPQPQGPQQRPPLLQQCCNELHQEE
Sbjct  1    AGPFRFPRCRKEFQQAQHLRACQQWLHKQAMQSGSGPQPQGPQQRPPLLQQCCNELHQEE 60
Query  61   PLCVCPTLKGASKAVKQQIRQQGQQQGQQGQQLQHEISRIYQTATHLPRVCNIPRVSICP 120
            PLCVCPTLKGASKAVKQQIRQQGQQQGQQGQQLQHEISRIYQTATHLPRVCNIPRVSICP
Sbjct  61   PLCVCPTLKGASKAVKQQIRQQGQQQGQQGQQLQHEISRIYQTATHLPRVCNIPRVSICP 120
Query  121  FQKTMPGPS 129
            FQKTMPGPS
Sbjct  121  FQKTMPGPS 129

Sequence Alignment: 2. Allergen Name: Sin a 1 Sequence ID: P15322

 Score = 87.7 bits 844,  Expect = 1e-19
 Identities = 114/126 90%, Positives = 121/126 96%, Gaps = 3/126 2%
Query  1    AGPFRFPRCRKEFQQAQHLRACQQWLHKQAMQSGSGPQPQGPQQRPPLLQQCCNELHQEE 60
            AGPFR P+CRKEFQQAQHLRACQQWLHKQAMQSGSGP PQGPQQRPPLLQQCCNELHQEE
Sbjct  2    AGPFRIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGPSPQGPQQRPPLLQQCCNELHQEE 61
Query  61   PLCVCPTLKGASKAVKQQIRQQGQQQGQQGQQLQHEISRIYQTATHLPRVCNIPRVSICP 120
            PLCVCPTLKGASKAVKQQ+RQQ +QQGQQG    H ISRIYQTATHLP+VCNIP+VS+CP
Sbjct  62   PLCVCPTLKGASKAVKQQVRQQLEQQGQQGP---HVISRIYQTATHLPKVCNIPQVSVCP 118
Query  121  FQKTMPGPS 129
            F+KTMPGPS
Sbjct  119  FKKTMPGPS 127

Sequence Alignment: 3. Allergen Name: Bra n 1 Sequence ID: P80208

 Score = 86.9 bits 835,  Expect = 2e-19
 Identities = 115/124 92%, Positives = 122/124 98%, Gaps = 5/124 4%
Query  1    AGPFRFPRCRKEFQQAQHLRACQQWLHKQAMQSGSGPQPQGPQQRPPLLQQCCNELHQEE 60
            AGPFR P+CRKEFQQAQHLRACQQWLHKQAMQSGSGPQ  GPQQRPPLLQQCCNELHQEE
Sbjct  2    AGPFRIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGPQ--GPQQRPPLLQQCCNELHQEE 59
Query  61   PLCVCPTLKGASKAVKQQIRQQGQQQGQQGQQLQHEISRIYQTATHLPRVCNIPRVSICP 120
            PLCVCPTLKGAS+AVKQQ+RQ   QQGQQGQQLQ+ ISRIYQTATHLP+VCNIP+VS+CP
Sbjct  60   PLCVCPTLKGASRAVKQQVRQ---QQGQQGQQLQQVISRIYQTATHLPKVCNIPQVSVCP 116
Query  121  FQKTMPGPS 129
            FQKTMPGPS
Sbjct  117  FQKTMPGPS 125

Sequence Alignment: 4. Allergen Name: Sin a 1 Sequence ID: CAA62910

 Score = 66.5 bits 604,  Expect = 3e-13
 Identities = 116/129 89%, Positives = 124/129 96%, Gaps = 15/129 11%
Query  1    AGPFRFPRCRKEFQQAQHLRACQQWLHKQAMQSGSGPQ---------------PQGPQQR 45
            AGPFR P+CRKEFQQAQHLRACQQWLHKQAMQSGSGP                PQGPQQR
Sbjct  2    AGPFRIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGPSWTLEGEFDFEDDMENPQGPQQR 61
Query  46   PPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQIRQQGQQQGQQGQQLQHEISRIYQTAT 105
            PPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQ+RQQ +QQGQQG +LQH ISRIYQTAT
Sbjct  62   PPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQVRQQLEQQGQQGPHLQHVISRIYQTAT 121
Query  106  HLPRVCNIPRVSICPFQKTMPGPS 129
            HLP+VCNIP+VS+CPF+KTMPGPS
Sbjct  122  HLPKVCNIPQVSVCPFKKTMPGPS 145

Sequence Alignment: 5. Allergen Name: Sin a 1 Sequence ID: CAA62912

 Score = 66.5 bits 604,  Expect = 3e-13
 Identities = 116/129 89%, Positives = 124/129 96%, Gaps = 15/129 11%
Query  1    AGPFRFPRCRKEFQQAQHLRACQQWLHKQAMQSGSGPQ---------------PQGPQQR 45
            AGPFR P+CRKEFQQAQHLRACQQWLHKQAMQSGSGP                PQGPQQR
Sbjct  2    AGPFRIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGPSWTLDDEFDFEDDMENPQGPQQR 61
Query  46   PPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQIRQQGQQQGQQGQQLQHEISRIYQTAT 105
            PPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQ+RQQ +QQGQQG +LQH ISRIYQTAT
Sbjct  62   PPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQVRQQLEQQGQQGPHLQHVISRIYQTAT 121
Query  106  HLPRVCNIPRVSICPFQKTMPGPS 129
            HLP+VCNIP+VS+CPF+KTMPGPS
Sbjct  122  HLPKVCNIPQVSVCPFKKTMPGPS 145

Sequence Alignment: 6. Allergen Name: Sin a 1 Sequence ID: CAA62911

 Score = 66.3 bits 602,  Expect = 3e-13
 Identities = 115/129 89%, Positives = 122/129 94%, Gaps = 15/129 11%
Query  1    AGPFRFPRCRKEFQQAQHLRACQQWLHKQAMQSGSGPQ---------------PQGPQQR 45
            AGPF  P+CRKEFQQAQHLRACQQWLHKQAMQSGSGP                PQGPQQR
Sbjct  2    AGPFGIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGPSWTLDDEFDFEDDMENPQGPQQR 61
Query  46   PPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQIRQQGQQQGQQGQQLQHEISRIYQTAT 105
            PPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQ+RQQ  QQGQQG Q+QH ISRIYQTAT
Sbjct  62   PPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQVRQQLGQQGQQGPQVQHVISRIYQTAT 121
Query  106  HLPRVCNIPRVSICPFQKTMPGPS 129
            HLP+VCNIP+VS+CPF+KTMPGPS
Sbjct  122  HLPKVCNIPQVSVCPFKKTMPGPS 145

Sequence Alignment: 7. Allergen Name: Sin a 1 Sequence ID: CAA62909

 Score = 66.1 bits 600,  Expect = 4e-13
 Identities = 116/129 89%, Positives = 122/129 94%, Gaps = 15/129 11%
Query  1    AGPFRFPRCRKEFQQAQHLRACQQWLHKQAMQSGSGPQ---------------PQGPQQR 45
            AGPF  P+CRKEFQQAQHLRACQQWLHKQAMQSGSGP                PQGPQQR
Sbjct  2    AGPFGIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGPSWTLDDEFDFEDDMENPQGPQQR 61
Query  46   PPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQIRQQGQQQGQQGQQLQHEISRIYQTAT 105
            PPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQ+RQQ +QQGQQG +LQH ISRIYQTAT
Sbjct  62   PPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQVRQQLEQQGQQGPHLQHVISRIYQTAT 121
Query  106  HLPRVCNIPRVSICPFQKTMPGPS 129
            HLPRVCNI +VS+CPFQKTMPGPS
Sbjct  122  HLPRVCNIRQVSVCPFQKTMPGPS 145

Sequence Alignment: 8. Allergen Name: Sin a 1 Sequence ID: CAA62908

 Score = 65.9 bits 598,  Expect = 4e-13
 Identities = 114/129 88%, Positives = 122/129 94%, Gaps = 15/129 11%
Query  1    AGPFRFPRCRKEFQQAQHLRACQQWLHKQAMQSGSGPQ---------------PQGPQQR 45
            AGPF  P+CRKEFQQAQHLRACQQWLHKQAMQSGSGP                PQGPQQ+
Sbjct  2    AGPFGIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGPSWTLDDEFDFEDDMENPQGPQQK 61
Query  46   PPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQIRQQGQQQGQQGQQLQHEISRIYQTAT 105
            PPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQ+RQQ  QQGQQG Q+QH ISRIYQTAT
Sbjct  62   PPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQVRQQLGQQGQQGPQVQHVISRIYQTAT 121
Query  106  HLPRVCNIPRVSICPFQKTMPGPS 129
            HLP+VCNIP+VS+CPF+KTMPGPS
Sbjct  122  HLPKVCNIPQVSVCPFKKTMPGPS 145

Sequence Alignment: 9. Allergen Name: Sin a 1 Sequence ID: AAB25214

 Score = 65.0 bits 587,  Expect = 8e-13
 Identities = 115/129 89%, Positives = 122/129 94%, Gaps = 15/129 11%
Query  1    AGPFRFPRCRKEFQQAQHLRACQQWLHKQAMQSGSGPQ---------------PQGPQQR 45
            AGPFR P+CRKEFQQAQHLRACQQWLHKQAMQSGSGP                PQGPQQR
Sbjct  2    AGPFRIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGPSWTLDDEFDFEDDMENPQGPQQR 61
Query  46   PPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQIRQQGQQQGQQGQQLQHEISRIYQTAT 105
            PPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQ+RQQ  QQGQQG +LQH ISRIYQTAT
Sbjct  62   PPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQVRQQLGQQGQQGPHLQHVISRIYQTAT 121
Query  106  HLPRVCNIPRVSICPFQKTMPGPS 129
            HLP+VCNI +VS+CPF+KTMPGPS
Sbjct  122  HLPKVCNIRQVSVCPFKKTMPGPS 145

Sequence Alignment: 10. Allergen Name: Bra r 1 Sequence ID: Q42473

 Score = 61.2 bits 543,  Expect = 1e-11
 Identities = 111/124 89%, Positives = 118/124 95%, Gaps = 20/124 16%
Query  1    AGPFRFPRCRKEFQQAQHLRACQQWLHKQAMQSGSGPQ---------------PQGPQQR 45
            AGPFR P+CRKEFQQAQHL+ACQQWLHKQAMQSGSGP                 QGPQQ 
Sbjct  39   AGPFRIPKCRKEFQQAQHLKACQQWLHKQAMQSGSGPSWTLDGEFDFEEDMENTQGPQQE 98
Query  46   PPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQIRQQGQQQGQQGQQLQHEISRIYQTAT 105
            PPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQ+RQQGQQQ     Q+Q+ ISRIYQT+T
Sbjct  99   PPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQVRQQGQQQ-----QMQQVISRIYQTST 153
Query  106  HLPRVCNIPRVSICPFQKTMPGPS 129
            HLPRVCNI +VSICPFQKTMPGPS
Sbjct  154  HLPRVCNIRQVSICPFQKTMPGPS 177

Sequence Alignment: 11. Allergen Name: Lin u 1.01 Sequence ID: Q8LPD3

 Score = 33.6 bits 233,  Expect = 0.003
 Identities = 39/109 35%, Positives = 64/109 58%, Gaps = 9/109 8%
Query  8    RCRKEFQQAQHLRACQQWLHKQAMQSGSG---PQPQGPQQRPPLLQQCCNELHQEEPLCV 64
            +C K+ Q+  +LR+CQQ+L ++  + G      Q +G  Q+   +  CC++L Q    C 
Sbjct  49   QCEKQIQEQDYLRSCQQFLWEKVQKGGRSYYYNQGRGGGQQSQHFDSCCDDLKQLRSECT 108
Query  65   CPTLKGASKAVKQQIRQQGQQQGQQGQQLQHEISRIYQTATHLPRVCNIPRVSICPFQ 122
            C   +G  +A+ Q +RQ  QQQGQQ Q+++  + +  Q A  LP  C   + S C +Q
Sbjct  109  C---RGLERAIGQ-MRQDIQQQGQQ-QEVERWVQQAKQVARDLPGQCGT-QPSRCQLQ 160

Sequence Alignment: 12. Allergen Name: Lin u 1.01 Sequence ID: Q8LPD3

 Score = 33.6 bits 233,  Expect = 0.003
 Identities = 39/109 35%, Positives = 64/109 58%, Gaps = 9/109 8%
Query  8    RCRKEFQQAQHLRACQQWLHKQAMQSGSG---PQPQGPQQRPPLLQQCCNELHQEEPLCV 64
            +C K+ Q+  +LR+CQQ+L ++  + G      Q +G  Q+   +  CC++L Q    C 
Sbjct  49   QCEKQIQEQDYLRSCQQFLWEKVQKGGRSYYYNQGRGGGQQSQHFDSCCDDLKQLRSECT 108
Query  65   CPTLKGASKAVKQQIRQQGQQQGQQGQQLQHEISRIYQTATHLPRVCNIPRVSICPFQ 122
            C   +G  +A+ Q +RQ  QQQGQQ Q+++  + +  Q A  LP  C   + S C +Q
Sbjct  109  C---RGLERAIGQ-MRQDIQQQGQQ-QEVERWVQQAKQVARDLPGQCGT-QPSRCQLQ 160

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.