The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

AGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA
TPAPPGAAPPPAAGGSPPPPTDGGSPPPPADGGSPPADGGSPPPPSTH
Sequence Info Allergen Name Length Opt Bits Score E Value
AHF71025 Art l 1.0101 108 834 140.6 8.9e-36
ANC85014 Art la 1.0102 132 825 139.3 2.6e-35
ANC85009 Art ar 1.0102 132 825 139.3 2.6e-35
ANC85011 Art gm 1.0101 132 824 139.2 2.9e-35
AHF71024 Art f 1.0101 108 823 138.9 2.9e-35
AHF71026 Art t 1.0101 108 823 138.9 2.9e-35
AHF71023 Art c 1.0101 108 818 138.1 5.1e-35
ANC85008 Art ar 1.0101 132 818 138.2 5.6e-35
ANC85006 Art an 1.0102 132 818 138.2 5.6e-35
ANC85010 Art ca 1.0101 132 818 138.2 5.6e-35
ANC85013 Art la 1.0101 132 818 138.2 5.6e-35
AHF71021 Art ab 1.0101 108 816 137.8 6.3e-35
AF493943 Art v 1.0101 132 813 137.5 9.7e-35
ANC85016 Art si 1.0102 132 812 137.3 1.1e-34
ANC85015 Art si 1.0101 132 805 136.2 2.3e-34
CBK52317 Amb a 4.0101 164 433 77.9 9.9e-17
A0A0X9C7K4 Par h 1.0101 156 421 76.0 3.6e-16
QUJ17885 Api g 7.0101 93 256 49.8 1.7e-08
Q7M1F3 Aes h 1.0101 50 235 46.0 1.2e-07
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Art l 1.0101 Sequence ID: AHF71025

 Score = 140.6 bits 834,  Expect = 9e-36
 Identities = 108/108 100%, Positives = 108/108 100%, Gaps = 0/108 0%
Query  1    AGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA 60
            AGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA
Sbjct  1    AGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA 60
Query  61   TPAPPGAAPPPAAGGSPPPPTDGGSPPPPADGGSPPADGGSPPPPSTH 108
            TPAPPGAAPPPAAGGSPPPPTDGGSPPPPADGGSPPADGGSPPPPSTH
Sbjct  61   TPAPPGAAPPPAAGGSPPPPTDGGSPPPPADGGSPPADGGSPPPPSTH 108

Sequence Alignment: 2. Allergen Name: Art la 1.0102 Sequence ID: ANC85014

 Score = 139.3 bits 825,  Expect = 3e-35
 Identities = 106/108 98%, Positives = 107/108 99%, Gaps = 0/108 0%
Query  1    AGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA 60
            AGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA
Sbjct  25   AGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA 84
Query  61   TPAPPGAAPPPAAGGSPPPPTDGGSPPPPADGGSPPADGGSPPPPSTH 108
            TPAPPGA+PPPAAGGSPPPP DGGSPPPPADGGSPPADGGSPPPPSTH
Sbjct  85   TPAPPGASPPPAAGGSPPPPADGGSPPPPADGGSPPADGGSPPPPSTH 132

Sequence Alignment: 3. Allergen Name: Art ar 1.0102 Sequence ID: ANC85009

 Score = 139.3 bits 825,  Expect = 3e-35
 Identities = 106/108 98%, Positives = 107/108 99%, Gaps = 0/108 0%
Query  1    AGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA 60
            AGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA
Sbjct  25   AGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA 84
Query  61   TPAPPGAAPPPAAGGSPPPPTDGGSPPPPADGGSPPADGGSPPPPSTH 108
            TPAPPGA+PPPAAGGSPPPP DGGSPPPPADGGSPPADGGSPPPPSTH
Sbjct  85   TPAPPGASPPPAAGGSPPPPADGGSPPPPADGGSPPADGGSPPPPSTH 132

Sequence Alignment: 4. Allergen Name: Art gm 1.0101 Sequence ID: ANC85011

 Score = 139.2 bits 824,  Expect = 3e-35
 Identities = 106/108 98%, Positives = 106/108 98%, Gaps = 0/108 0%
Query  1    AGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA 60
            AGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA
Sbjct  25   AGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA 84
Query  61   TPAPPGAAPPPAAGGSPPPPTDGGSPPPPADGGSPPADGGSPPPPSTH 108
            TPAPPGAAPPPA GGSPPPP DGGSPPPPADGGSPPADGGSPPPPSTH
Sbjct  85   TPAPPGAAPPPATGGSPPPPADGGSPPPPADGGSPPADGGSPPPPSTH 132

Sequence Alignment: 5. Allergen Name: Art f 1.0101 Sequence ID: AHF71024

 Score = 138.9 bits 823,  Expect = 3e-35
 Identities = 106/108 98%, Positives = 107/108 99%, Gaps = 0/108 0%
Query  1    AGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA 60
            AGSKLCEKTSKT+SGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA
Sbjct  1    AGSKLCEKTSKTWSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA 60
Query  61   TPAPPGAAPPPAAGGSPPPPTDGGSPPPPADGGSPPADGGSPPPPSTH 108
            TPAPPGAAPPPAAGGSPPPPTDGGSPPPPADGGSPPADGGSPPPPS H
Sbjct  61   TPAPPGAAPPPAAGGSPPPPTDGGSPPPPADGGSPPADGGSPPPPSAH 108

Sequence Alignment: 6. Allergen Name: Art t 1.0101 Sequence ID: AHF71026

 Score = 138.9 bits 823,  Expect = 3e-35
 Identities = 106/108 98%, Positives = 107/108 99%, Gaps = 0/108 0%
Query  1    AGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA 60
            AGSKLCEKTSKT+SGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA
Sbjct  1    AGSKLCEKTSKTWSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA 60
Query  61   TPAPPGAAPPPAAGGSPPPPTDGGSPPPPADGGSPPADGGSPPPPSTH 108
            TPAPPGAAPPPAAGGSPPPPTDGGSPPPPADGGSPPADGGSPPPPS H
Sbjct  61   TPAPPGAAPPPAAGGSPPPPTDGGSPPPPADGGSPPADGGSPPPPSAH 108

Sequence Alignment: 7. Allergen Name: Art c 1.0101 Sequence ID: AHF71023

 Score = 138.1 bits 818,  Expect = 5e-35
 Identities = 105/108 97%, Positives = 106/108 98%, Gaps = 0/108 0%
Query  1    AGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA 60
            AGSKLCEKTSKT+SGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA
Sbjct  1    AGSKLCEKTSKTWSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA 60
Query  61   TPAPPGAAPPPAAGGSPPPPTDGGSPPPPADGGSPPADGGSPPPPSTH 108
            TPAPPGAAPPPAAGGSPPPP DGGSPPPPADGGSPPADGGSPPPPS H
Sbjct  61   TPAPPGAAPPPAAGGSPPPPADGGSPPPPADGGSPPADGGSPPPPSAH 108

Sequence Alignment: 8. Allergen Name: Art ar 1.0101 Sequence ID: ANC85008

 Score = 138.2 bits 818,  Expect = 6e-35
 Identities = 106/108 98%, Positives = 106/108 98%, Gaps = 0/108 0%
Query  1    AGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA 60
            AGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA
Sbjct  25   AGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA 84
Query  61   TPAPPGAAPPPAAGGSPPPPTDGGSPPPPADGGSPPADGGSPPPPSTH 108
            TPAPPGAAPPPAAGGSP PP DGGSPPPPADGGSPPADGGSPPPPSTH
Sbjct  85   TPAPPGAAPPPAAGGSPSPPADGGSPPPPADGGSPPADGGSPPPPSTH 132

Sequence Alignment: 9. Allergen Name: Art an 1.0102 Sequence ID: ANC85006

 Score = 138.2 bits 818,  Expect = 6e-35
 Identities = 105/108 97%, Positives = 106/108 98%, Gaps = 0/108 0%
Query  1    AGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA 60
            AGSKLCEKTSKT+SGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA
Sbjct  25   AGSKLCEKTSKTWSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA 84
Query  61   TPAPPGAAPPPAAGGSPPPPTDGGSPPPPADGGSPPADGGSPPPPSTH 108
            TPAPPGAAPPPAAGGSPPPP DGGSPPPPADGGSPPADGGSPPPPS H
Sbjct  85   TPAPPGAAPPPAAGGSPPPPADGGSPPPPADGGSPPADGGSPPPPSAH 132

Sequence Alignment: 10. Allergen Name: Art ca 1.0101 Sequence ID: ANC85010

 Score = 138.2 bits 818,  Expect = 6e-35
 Identities = 105/108 97%, Positives = 106/108 98%, Gaps = 0/108 0%
Query  1    AGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA 60
            AGSKLCEKTSKT+SGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA
Sbjct  25   AGSKLCEKTSKTWSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA 84
Query  61   TPAPPGAAPPPAAGGSPPPPTDGGSPPPPADGGSPPADGGSPPPPSTH 108
            TPAPPGAAPPPAAGGSPPPP DGGSPPPPADGGSPPADGGSPPPPS H
Sbjct  85   TPAPPGAAPPPAAGGSPPPPADGGSPPPPADGGSPPADGGSPPPPSAH 132

Sequence Alignment: 11. Allergen Name: Art la 1.0101 Sequence ID: ANC85013

 Score = 138.2 bits 818,  Expect = 6e-35
 Identities = 106/108 98%, Positives = 106/108 98%, Gaps = 0/108 0%
Query  1    AGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA 60
            AGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA
Sbjct  25   AGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA 84
Query  61   TPAPPGAAPPPAAGGSPPPPTDGGSPPPPADGGSPPADGGSPPPPSTH 108
            TPAPPGAAPPPAAGGSP PP DGGSPPPPADGGSPPADGGSPPPPSTH
Sbjct  85   TPAPPGAAPPPAAGGSPSPPADGGSPPPPADGGSPPADGGSPPPPSTH 132

Sequence Alignment: 12. Allergen Name: Art ab 1.0101 Sequence ID: AHF71021

 Score = 137.8 bits 816,  Expect = 6e-35
 Identities = 104/108 96%, Positives = 107/108 99%, Gaps = 0/108 0%
Query  1    AGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA 60
            AGSKLCEKTSKT+SGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA
Sbjct  1    AGSKLCEKTSKTWSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA 60
Query  61   TPAPPGAAPPPAAGGSPPPPTDGGSPPPPADGGSPPADGGSPPPPSTH 108
            TPAPPGA+PPPAAGGSPPPP DGG+PPPPADGGSPPADGGSPPPPSTH
Sbjct  61   TPAPPGASPPPAAGGSPPPPADGGTPPPPADGGSPPADGGSPPPPSTH 108

Sequence Alignment: 13. Allergen Name: Art v 1.0101 Sequence ID: AF493943

 Score = 137.5 bits 813,  Expect = 1e-34
 Identities = 105/108 97%, Positives = 105/108 97%, Gaps = 0/108 0%
Query  1    AGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA 60
            AGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA
Sbjct  25   AGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA 84
Query  61   TPAPPGAAPPPAAGGSPPPPTDGGSPPPPADGGSPPADGGSPPPPSTH 108
            TPAPPGAAPPPAAGGSP PP DGGSPPPPADGGSPP DGGSPPPPSTH
Sbjct  85   TPAPPGAAPPPAAGGSPSPPADGGSPPPPADGGSPPVDGGSPPPPSTH 132

Sequence Alignment: 14. Allergen Name: Art si 1.0102 Sequence ID: ANC85016

 Score = 137.3 bits 812,  Expect = 1e-34
 Identities = 105/108 97%, Positives = 106/108 98%, Gaps = 0/108 0%
Query  1    AGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA 60
            AGSKLCEKTSKT+SGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA
Sbjct  25   AGSKLCEKTSKTWSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA 84
Query  61   TPAPPGAAPPPAAGGSPPPPTDGGSPPPPADGGSPPADGGSPPPPSTH 108
            TPAPPGAAPPPAAGGSP PP DGGSPPPPADGGSPPADGGSPPPPSTH
Sbjct  85   TPAPPGAAPPPAAGGSPSPPADGGSPPPPADGGSPPADGGSPPPPSTH 132

Sequence Alignment: 15. Allergen Name: Art si 1.0101 Sequence ID: ANC85015

 Score = 136.2 bits 805,  Expect = 2e-34
 Identities = 104/108 96%, Positives = 105/108 97%, Gaps = 0/108 0%
Query  1    AGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA 60
            AGSKLCEKTSKT+SGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA
Sbjct  25   AGSKLCEKTSKTWSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA 84
Query  61   TPAPPGAAPPPAAGGSPPPPTDGGSPPPPADGGSPPADGGSPPPPSTH 108
            TPAPPGAAPPPAAGGSP PP DGGSPPPPADGGSPPADGGSPPPPS H
Sbjct  85   TPAPPGAAPPPAAGGSPSPPADGGSPPPPADGGSPPADGGSPPPPSGH 132

Sequence Alignment: 16. Allergen Name: Amb a 4.0101 Sequence ID: CBK52317

 Score = 77.9 bits 433,  Expect = 1e-16
 Identities = 62/96 64%, Positives = 73/96 76%, Gaps = 10/96 10%
Query  4    KLCEKTSKTYSGKCDNK---KCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSP-PG 59
            KLCEK S T+SGKC  K   KCDK+CIEWE A+HGACHKR++ K +CFCYFDC  +  PG
Sbjct  21   KLCEKPSVTWSGKCKVKQTDKCDKRCIEWEGAKHGACHKRDS-KATCFCYFDCDPTKNPG 79
Query  60   ATP-APPGAAP---PPAAGGSPPPPT-DGGSPPPPADGGSPPADGG 100
              P AP G AP   PP+ GG+PPP   +GG  PPP +GG    DGG
Sbjct  80   PPPGAPKGKAPAPSPPSGGGAPPPSGGEGGDGPPPPEGGEGGGDGG 125

Sequence Alignment: 17. Allergen Name: Par h 1.0101 Sequence ID: A0A0X9C7K4

 Score = 76.0 bits 421,  Expect = 4e-16
 Identities = 56/100 56%, Positives = 67/100 67%, Gaps = 9/100 9%
Query  4    KLCEKTSKTYSGKC-DNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDC----SKSPP 58
            K+CEK SKT+ G C D +KCDK+C+EWE A+HGACH+RE+ K  CFCYFDC    +  PP
Sbjct  29   KVCEKPSKTWFGNCKDTEKCDKRCMEWEGAKHGACHQRES-KYMCFCYFDCDPKKNPGPP 87
Query  59   GATPAPPGAAPPPAAGGSPPPPTDGGSPPPPAD---GGSPPADGGSPPP 104
               P  PG  P P  GG    P  GG+PPP      GG     GG+PPP
Sbjct  88   PGAPGTPGTPPAPPGGGEGDAPPGGGAPPPAGGEGGGGGGEGGGGAPPP 136

Sequence Alignment: 18. Allergen Name: Api g 7.0101 Sequence ID: QUJ17885

 Score = 49.8 bits 256,  Expect = 2e-08
 Identities = 34/48 70%, Positives = 40/48 83%, Gaps = 3/48 6%
Query  5    LCEKTSKTYSGKCDN-KKCDKKCIEWEKAQHGACHKREAGKESCFCYFD-C 53
            LCEK S+T++GKC N K CD +CI+WE A+HGACHKR  GK  CFCYFD C
Sbjct  44   LCEKPSQTWTGKCGNTKNCDNQCIQWETARHGACHKR-GGKWMCFCYFDRC 93

Sequence Alignment: 19. Allergen Name: Aes h 1.0101 Sequence ID: Q7M1F3

 Score = 46.0 bits 235,  Expect = 1e-07
 Identities = 31/48 64%, Positives = 37/48 77%, Gaps = 3/48 6%
Query  5    LC-EKTSKTYSGKCDNK-KCDKKCIEWEKAQHGACHKREAGKESCFCYFDC 53
            LC E+ S+T+SG C N   CDK+C +WEKA HGACHKRE     CFCYF+C
Sbjct  1    LCNERPSQTWSGNCGNTAHCDKQCQDWEKASHGACHKRE-NHWKCFCYFNC 50

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.