The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

AIGDKPGPNITATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGN
EPIFKDGLGCRACYEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKG
QEDKLRKAGELTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIK
PRDSDEFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTS
KLQFGA
Sequence Info Allergen Name Length Opt Bits Score E Value
O04701 Cyn d 1 246 1720 398.8 8.7e-113
AAK96255 Cyn d 1.0201 244 1506 350.1 3.9e-98
AAF80379 Cyn d 1.0204 244 1503 349.5 6.2e-98
AAL14078 Cyn d 1 262 1498 348.3 1.5e-97
AAL14079 Cyn d 1.0203 262 1496 347.8 2e-97
AAL14077 Cyn d 1.0202 262 1496 347.8 2e-97
A0A4D6FZ45 Uro m 1.0101 262 1496 347.8 2e-97
QCX36431 Zoy m 1.0101 272 1450 337.4 3e-94
A0A4D6G2J8 Uro m 1.0201 229 1222 285.6 9.9e-79
P43213 Phl p 1 263 1176 275.1 1.7e-75
CAA10140 Hol l 1 263 1174 274.6 2.3e-75
CAA10520 Poa p a 263 1169 273.5 5e-75
CAA81613 Phl p 1.0101 263 1165 272.6 9.5e-75
CAA93121 Hol l 1.0102 248 1156 270.5 3.6e-74
P43216 Hol l 1 265 1155 270.3 4.6e-74
AAF72983 Ory s 1 267 1149 268.9 1.2e-73
AAF72991 Ory s 1 267 1142 267.3 3.6e-73
CAB63699 Lol p 1.0103 263 1129 264.4 2.8e-72
Q41260 Pha a 1 269 1129 264.4 2.8e-72
AAA63278 Lol p 1.0102 252 1118 261.9 1.5e-71
P58738 Zea m 1 269 1116 261.4 2.2e-71
P14946 Lol p 1 263 1103 258.5 1.7e-70
ACA23876 Pas n 1.0101 265 1101 258.0 2.3e-70
AAA63279 Lol p 1.0101 263 1097 257.1 4.3e-70
ABC58726 Sor h 1.0101 239 1077 252.6 8.9e-69
AAF72990 Ory s 1 269 1068 250.5 4.3e-68
Q40638 Ory s 1 263 996 234.1 3.5e-63
AAF72984 Ory s 1 268 939 221.1 2.9e-59
AAF72987 Ory s 1 275 916 215.9 1.1e-57
Q07154 Zea m 1 191 889 209.9 4.9e-56
AAD10496 Tri a ps93 271 878 207.3 4.4e-55
AAB61710 Ory s 1 261 875 206.6 6.7e-55
AAF72985 Ory s 1 286 857 202.5 1.3e-53
AAF72989 Ory s 1 271 828 195.9 1.2e-51
AAA50175 Gly m 2 277 719 171.1 3.5e-44
AAF72988 Ory s 1 327 716 170.3 6.9e-44
AAF72986 Ory s 1 275 689 164.3 3.9e-42
CAB37496 Ara t expansin 265 382 94.5 3.9e-21
AAG13596 Ory s 1 275 340 84.9 3.1e-18
BAA85432 Ory s 1 284 309 77.8 4.3e-16
AAP80171 Cyn d 15 112 273 70.0 3.7e-14
CAA10346 Cyn d 2 122 263 67.7 2e-13
CAA10348 Poa p 2 122 259 66.8 3.8e-13
CAA10345 Dac g 2 122 259 66.8 3.8e-13
P43214 Phl p 2 122 259 66.8 3.8e-13
P14947 Lol p 2 97 253 65.5 7.2e-13
CAA51775 Lol p 2 88 239 62.4 5.8e-12
P93124 Dac g 3 96 238 62.1 7.6e-12
2JNZ_A Phl p 3.0101 108 217 57.3 2.4e-10
P14948 Lol p 3 97 209 55.5 7.4e-10
CAA90746 Tri a 3 118 186 50.2 3.6e-08
A0A077B2S0 Sor h 2.0201 121 184 49.8 5.1e-08
A0A077B7S9 Sor h 2.0101 119 177 48.2 1.5e-07
Q7M1X8 Dac g 1.0101 34 150 42.6 2.1e-06
Q7M1X6 Ant o 1.0101 32 140 40.3 9.4e-06
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Cyn d 1 Sequence ID: O04701

 Score = 398.8 bits 1720,  Expect = 9e-113
 Identities = 246/246 100%, Positives = 246/246 100%, Gaps = 0/246 0%
Query  1    AIGDKPGPNITATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGN 60
            AIGDKPGPNITATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGN
Sbjct  1    AIGDKPGPNITATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGN 60
Query  61   EPIFKDGLGCRACYEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKG 120
            EPIFKDGLGCRACYEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKG
Sbjct  61   EPIFKDGLGCRACYEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKG 120
Query  121  QEDKLRKAGELTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIK 180
            QEDKLRKAGELTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIK
Sbjct  121  QEDKLRKAGELTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIK 180
Query  181  PRDSDEFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTS 240
            PRDSDEFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTS
Sbjct  181  PRDSDEFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTS 240
Query  241  KLQFGA 246
            KLQFGA
Sbjct  241  KLQFGA 246

Sequence Alignment: 2. Allergen Name: Cyn d 1.0201 Sequence ID: AAK96255

 Score = 350.1 bits 1506,  Expect = 4e-98
 Identities = 208/244 85%, Positives = 225/244 92%, Gaps = 0/244 0%
Query  1    AIGDKPGPNITATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGN 60
            A+GDKPGPNITATYG KWL+A+ATFYGS+PRGAAPDDHGGACGYKDVDK PFDGMT CGN
Sbjct  1    AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGN 60
Query  61   EPIFKDGLGCRACYEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKG 120
            EPIFKDGL C +CYEIKCKEP ECSGEPVL+KITDKNYEHIAAYHFDLSGKAFGAMAKKG
Sbjct  61   EPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKG 120
Query  121  QEDKLRKAGELTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIK 180
            +EDKLRKAGEL LQFRRVKC+YPS TKI FH+EKGS+ +YLALLVKYAAGDGNIV VDIK
Sbjct  121  EEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIK 180
Query  181  PRDSDEFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTS 240
            P+ SDEF+PMK SWGAIWRIDP KPLKGPF+IRLTSE G H+ QDDVIP +WKPDTVY S
Sbjct  181  PKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKS 240
Query  241  KLQF 244
            K+QF
Sbjct  241  KIQF 244

Sequence Alignment: 3. Allergen Name: Cyn d 1.0204 Sequence ID: AAF80379

 Score = 349.5 bits 1503,  Expect = 6e-98
 Identities = 207/244 84%, Positives = 225/244 92%, Gaps = 0/244 0%
Query  1    AIGDKPGPNITATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGN 60
            A+GDKPGPNITATYG KWL+A+ATFYGS+PRGAAPDDHGGACGYKDVDK PFDGMT CGN
Sbjct  1    AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGN 60
Query  61   EPIFKDGLGCRACYEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKG 120
            EPIFKDGL C +CYEIKCKEP ECSGEPVL+KITDKNYEHIAAYHFDLSGKAFGAMAKKG
Sbjct  61   EPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKG 120
Query  121  QEDKLRKAGELTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIK 180
            +EDKLRKAGEL LQFRRVKC+YPS TKI FH+EKGS+ +YLALLVKYAAGDGNIV VDIK
Sbjct  121  EEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIK 180
Query  181  PRDSDEFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTS 240
            P+ SDEF+PMK SWGAIWR+DP KPLKGPF+IRLTSE G H+ QDDVIP +WKPDTVY S
Sbjct  181  PKGSDEFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKS 240
Query  241  KLQF 244
            K+QF
Sbjct  241  KIQF 244

Sequence Alignment: 4. Allergen Name: Cyn d 1 Sequence ID: AAL14078

 Score = 348.3 bits 1498,  Expect = 1e-97
 Identities = 207/244 84%, Positives = 226/244 92%, Gaps = 0/244 0%
Query  1    AIGDKPGPNITATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGN 60
            A+GDKPGPNITATYG KWL+A+ATFYGS+PRGAAPDDHGGACGYKDVDK PFDGMT CGN
Sbjct  19   AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGN 78
Query  61   EPIFKDGLGCRACYEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKG 120
            EPIFKDGLGC +CYEIKCKEP ECSGEPVL+KITDKNYEHIAAYHFDLSGKAFGAMAKKG
Sbjct  79   EPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKG 138
Query  121  QEDKLRKAGELTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIK 180
            +EDKLRKAGEL LQFRRVKC+YPS TKITFH+EKGS+ +YLALLVKYAAGDGNIV VDIK
Sbjct  139  EEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYLALLVKYAAGDGNIVGVDIK 198
Query  181  PRDSDEFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTS 240
            P+ SD F+PMK SWGAIWR+DP KPLKGPF+IRLTSE G H+ Q+DVIP +WKPDTVY S
Sbjct  199  PKGSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYKS 258
Query  241  KLQF 244
            K+QF
Sbjct  259  KIQF 262

Sequence Alignment: 5. Allergen Name: Cyn d 1.0203 Sequence ID: AAL14079

 Score = 347.8 bits 1496,  Expect = 2e-97
 Identities = 207/244 84%, Positives = 225/244 92%, Gaps = 0/244 0%
Query  1    AIGDKPGPNITATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGN 60
            A+GDKPGPNITATYG KWL+A+ATFYGS+PRGAAPDDHGGACGYKDVDK PFD MT CGN
Sbjct  19   AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDSMTGCGN 78
Query  61   EPIFKDGLGCRACYEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKG 120
            EPIFKDGLGC +CYEIKCKEP ECSGEPVL+KITDKNYEHIAAYHFDLSGKAFGAMAKKG
Sbjct  79   EPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKG 138
Query  121  QEDKLRKAGELTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIK 180
            +EDKLRKAGEL LQFRRVKC+YPS TKI FH+EKGSN +YLALLVKYAAGDGNIV+VDIK
Sbjct  139  EEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDIK 198
Query  181  PRDSDEFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTS 240
             + SDEF+PMK SWGAIWRIDP KPLKGPF+IRLTSE G H+ Q+DVIP +WKPDTVY S
Sbjct  199  SKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYKS 258
Query  241  KLQF 244
            K+QF
Sbjct  259  KIQF 262

Sequence Alignment: 6. Allergen Name: Cyn d 1.0202 Sequence ID: AAL14077

 Score = 347.8 bits 1496,  Expect = 2e-97
 Identities = 207/244 84%, Positives = 225/244 92%, Gaps = 0/244 0%
Query  1    AIGDKPGPNITATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGN 60
            A+GDKPGPNITATYG KWL+A+ATFYGS+PRGAAPDDHGGACGYKDVDK PFDGMT CGN
Sbjct  19   AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGN 78
Query  61   EPIFKDGLGCRACYEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKG 120
            EPIFKDGL C +CYEIKCKEP ECSGEPVL+KITDKNYEHIAAYHFDLSGKAFGAMAKKG
Sbjct  79   EPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKG 138
Query  121  QEDKLRKAGELTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIK 180
            +EDKLRKAGEL LQFRRVKC+YPS TKI FH+EKGSN +YLALLVKYAAGDGNIV+VDIK
Sbjct  139  EEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDIK 198
Query  181  PRDSDEFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTS 240
             + SDEF+PMK SWGAIWRIDP KPLKGPF+IRLTSE G H+ Q+DVIP +WKPDTVY S
Sbjct  199  SKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYKS 258
Query  241  KLQF 244
            K+QF
Sbjct  259  KIQF 262

Sequence Alignment: 7. Allergen Name: Uro m 1.0101 Sequence ID: A0A4D6FZ45

 Score = 347.8 bits 1496,  Expect = 2e-97
 Identities = 207/244 84%, Positives = 225/244 92%, Gaps = 0/244 0%
Query  1    AIGDKPGPNITATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGN 60
            A+GDKPGPNITATYG KWL+A+ATFYGS+PRGAAPDDHGGACGYKDVDK PFD MT CGN
Sbjct  19   AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDSMTGCGN 78
Query  61   EPIFKDGLGCRACYEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKG 120
            EPIFKDGLGC +CYEIKCKEP ECSGEPVL+KITDKNYEHIAAYHFDLSGKAFGAMAKKG
Sbjct  79   EPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKG 138
Query  121  QEDKLRKAGELTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIK 180
            +EDKLRKAGEL LQFRRVKC+YPS TKI FH+EKGSN +YLALLVKYAAGDGNIV+VDIK
Sbjct  139  EEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDIK 198
Query  181  PRDSDEFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTS 240
             + SDEF+PMK SWGAIWRIDP KPLKGPF+IRLTSE G H+ Q+DVIP +WKPDTVY S
Sbjct  199  SKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYKS 258
Query  241  KLQF 244
            K+QF
Sbjct  259  KIQF 262

Sequence Alignment: 8. Allergen Name: Zoy m 1.0101 Sequence ID: QCX36431

 Score = 337.4 bits 1450,  Expect = 3e-94
 Identities = 200/243 82%, Positives = 224/243 92%, Gaps = 0/243 0%
Query  2    IGDKPGPNITATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGNE 61
            IGDKPGPNITATY  +W +A+ATFYGSNPRGAAPDD GGACGYK+VDK PF GMT CGNE
Sbjct  30   IGDKPGPNITATYNEEWQDAKATFYGSNPRGAAPDDDGGACGYKNVDKAPFFGMTGCGNE 89
Query  62   PIFKDGLGCRACYEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKGQ 121
            PIFKDGLGC +C+EIKCKEP ECS +PVL++ITDKNYEHIAAYHFDLSGKAFG+MAK+GQ
Sbjct  90   PIFKDGLGCGSCFEIKCKEPAECSDKPVLIRITDKNYEHIAAYHFDLSGKAFGSMAKQGQ 149
Query  122  EDKLRKAGELTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKP 181
            ED LRKAGELTLQFRRVKC+YPS TKITFH+EKG ND+YLALLV+YAAGDG+IVAVDIKP
Sbjct  150  EDNLRKAGELTLQFRRVKCEYPSKTKITFHVEKGCNDNYLALLVEYAAGDGDIVAVDIKP 209
Query  182  RDSDEFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTSK 241
            + SDEF+PMK SWGAIWRIDPKKPLKGPF++RLTSE GA LVQ+DVIPA+WKP+T YTS 
Sbjct  210  KGSDEFLPMKPSWGAIWRIDPKKPLKGPFTVRLTSESGAKLVQEDVIPADWKPNTAYTSN 269
Query  242  LQF 244
            LQ+
Sbjct  270  LQY 272

Sequence Alignment: 9. Allergen Name: Uro m 1.0201 Sequence ID: A0A4D6G2J8

 Score = 285.6 bits 1222,  Expect = 1e-78
 Identities = 169/227 74%, Positives = 196/227 86%, Gaps = 1/227 0%
Query  17   KWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGNEPIFKDGLGCRACYEI 76
            KWL+A+AT+YG  P GA PDD+GGACGYKDV+K PF+ M ACGN PIFKDGLGC +CYEI
Sbjct  3    KWLDAKATWYGK-PTGAGPDDNGGACGYKDVNKAPFNSMGACGNPPIFKDGLGCGSCYEI 61
Query  77   KCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKGQEDKLRKAGELTLQFR 136
            KC +P ECSGEPV+V ITD+NYE IAAYHFDL+G AFGAMAKKG+E+KLRKAG + +QFR
Sbjct  62   KCDKPAECSGEPVIVHITDQNYEPIAAYHFDLAGTAFGAMAKKGEEEKLRKAGIIDMQFR 121
Query  137  RVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSDEFIPMKSSWGA 196
            RVKCKYP+ TKI FH+EKG N +Y+ALL+KYAAGDG+IVAVDIK + S+EFIP+K SWGA
Sbjct  122  RVKCKYPANTKIAFHVEKGCNPNYFALLIKYAAGDGDIVAVDIKEKGSEEFIPLKHSWGA 181
Query  197  IWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTSKLQF 244
            IWRID  KP+KGP ++RLTSEGG  LVQDD IP  WK DTVYTSKLQF
Sbjct  182  IWRIDSPKPIKGPIAVRLTSEGGTTLVQDDAIPEGWKADTVYTSKLQF 229

Sequence Alignment: 10. Allergen Name: Phl p 1 Sequence ID: P43213

 Score = 275.1 bits 1176,  Expect = 2e-75
 Identities = 164/235 69%, Positives = 186/235 79%, Gaps = 1/235 0%
Query  6    PGPNITATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGNEPIFK 65
            PGPNITATYG KWL+A++T+YG  P GA P D+GGACGYKDVDKPPF GMT CGN PIFK
Sbjct  29   PGPNITATYGDKWLDAKSTWYGK-PTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFK 87
Query  66   DGLGCRACYEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKGQEDKL 125
             G GC +C+EIKC +P  CSGEPV+V ITD N E IA YHFDLSG AFGAMAKKG E KL
Sbjct  88   SGRGCGSCFEIKCTKPEACSGEPVVVHITDDNEEPIAPYHFDLSGHAFGAMAKKGDEQKL 147
Query  126  RKAGELTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSD 185
            R AGEL LQFRRVKCKYP GTK+TFH+EKGSN +YLALLVKY  GDG++VAVDIK +  D
Sbjct  148  RSAGELELQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKYVNGDGDVVAVDIKEKGKD 207
Query  186  EFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTSK 241
            ++I +K SWGAIWRID    L GPF++R T+EGG     +DVIP  WK DT Y SK
Sbjct  208  KWIELKESWGAIWRIDTPDKLTGPFTVRYTTEGGTKTEAEDVIPEGWKADTSYESK 263

Sequence Alignment: 11. Allergen Name: Hol l 1 Sequence ID: CAA10140

 Score = 274.6 bits 1174,  Expect = 2e-75
 Identities = 160/235 68%, Positives = 190/235 80%, Gaps = 1/235 0%
Query  6    PGPNITATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGNEPIFK 65
            PGPNITATYG KWL+A++T+YG  P GA P D+GGACGYKDVDKPPF GMT CGN PIFK
Sbjct  29   PGPNITATYGDKWLDAKSTWYGK-PTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFK 87
Query  66   DGLGCRACYEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKGQEDKL 125
             G GC +C+EIKC +P  CSGEP++V ITD N E IAAYH+DLSGKAFGAMAKKG+E KL
Sbjct  88   SGRGCGSCFEIKCTKPESCSGEPIVVHITDDNEEPIAAYHLDLSGKAFGAMAKKGEEQKL 147
Query  126  RKAGELTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSD 185
            R AGEL L+FRRVKC+YP GTK+TFH+EKGSN +YLALLVKY  GDG++VAVDIK +  D
Sbjct  148  RSAGELELKFRRVKCEYPKGTKVTFHVEKGSNPNYLALLVKYVDGDGDVVAVDIKEKGKD 207
Query  186  EFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTSK 241
            ++I +K SWGA+WR+D    L GPF++R T+EGG  +  +DVIP  WK DT Y SK
Sbjct  208  KWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKVEAEDVIPEGWKADTAYESK 263

Sequence Alignment: 12. Allergen Name: Poa p a Sequence ID: CAA10520

 Score = 273.5 bits 1169,  Expect = 5e-75
 Identities = 162/235 68%, Positives = 188/235 80%, Gaps = 1/235 0%
Query  6    PGPNITATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGNEPIFK 65
            PGPNITATYG KWL+A++T+YG  P GA P D+GGACGYKDVDK PF GMT CGN PIFK
Sbjct  29   PGPNITATYGDKWLDAKSTWYGK-PTGAGPKDNGGACGYKDVDKAPFSGMTGCGNTPIFK 87
Query  66   DGLGCRACYEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKGQEDKL 125
             G GC +C+EIKC +P  CSGEPVLV ITD N E IAAYHFDLSGKAFGAMAKKG+E KL
Sbjct  88   SGRGCGSCFEIKCTKPESCSGEPVLVHITDDNEEPIAAYHFDLSGKAFGAMAKKGEEQKL 147
Query  126  RKAGELTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSD 185
            R AGEL L+FRRVKC+YP GTK+TFH+EKGSN +YLALLVKY  GDG++VAVDIK +  D
Sbjct  148  RSAGELELKFRRVKCEYPEGTKVTFHVEKGSNPNYLALLVKYVTGDGDVVAVDIKEKGKD 207
Query  186  EFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTSK 241
            ++I +K SWG+IWR+D    L GPF++R T+EGG     +DVIP  WK DT Y SK
Sbjct  208  KWIELKESWGSIWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAYASK 263

Sequence Alignment: 13. Allergen Name: Phl p 1.0101 Sequence ID: CAA81613

 Score = 272.6 bits 1165,  Expect = 9e-75
 Identities = 162/235 68%, Positives = 188/235 80%, Gaps = 1/235 0%
Query  6    PGPNITATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGNEPIFK 65
            PGPNITATYG KWL+A++T+YG  P  A P D+GGACGYKDVDKPPF GMT CGN PIFK
Sbjct  29   PGPNITATYGDKWLDAKSTWYGK-PTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFK 87
Query  66   DGLGCRACYEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKGQEDKL 125
             G GC +C+EIKC +P  CSGEPV+V ITD N E IAAYHFDLSG AFG+MAKKG E KL
Sbjct  88   SGRGCGSCFEIKCTKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKL 147
Query  126  RKAGELTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSD 185
            R AGE+ +QFRRVKCKYP GTK+TFH+EKGSN +YLALLVK+ AGDG++VAVDIK +  D
Sbjct  148  RSAGEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVAVDIKEKGKD 207
Query  186  EFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTSK 241
            ++I +K SWGAIWRID  + LKGPF++R T+EGG      DVIP  WK DT Y SK
Sbjct  208  KWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAKDVIPEGWKADTAYESK 263

Sequence Alignment: 14. Allergen Name: Hol l 1.0102 Sequence ID: CAA93121

 Score = 270.5 bits 1156,  Expect = 4e-74
 Identities = 159/235 67%, Positives = 186/235 79%, Gaps = 1/235 0%
Query  6    PGPNITATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGNEPIFK 65
            PGPNITATYG +WL+A++T+YG  P GA P D+GGACGYKDVDKPPF GMT CGN PIFK
Sbjct  14   PGPNITATYGDEWLDAKSTWYGK-PTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFK 72
Query  66   DGLGCRACYEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKGQEDKL 125
            DG GC +C+EIKC +P  CSGEPV V ITD N E IA YHFDLSG AFG+MAKKG+E KL
Sbjct  73   DGRGCGSCFEIKCSKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKL 132
Query  126  RKAGELTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSD 185
            R AGEL L+FRRVKCKYP GTK TFH+EKGSN +YLALLVKY  GDG++VAVDIK +  D
Sbjct  133  RSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVAVDIKEKGKD 192
Query  186  EFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTSK 241
            ++I +K SWGA+WR+D    L GPF++R T+EGG     +DVIP  WK DT Y +K
Sbjct  193  KWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAYEAK 248

Sequence Alignment: 15. Allergen Name: Hol l 1 Sequence ID: P43216

 Score = 270.3 bits 1155,  Expect = 5e-74
 Identities = 159/235 67%, Positives = 186/235 79%, Gaps = 1/235 0%
Query  6    PGPNITATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGNEPIFK 65
            PGPNITATYG +WL+A++T+YG  P GA P D+GGACGYKDVDKPPF GMT CGN PIFK
Sbjct  31   PGPNITATYGDEWLDAKSTWYGK-PTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFK 89
Query  66   DGLGCRACYEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKGQEDKL 125
            DG GC +C+EIKC +P  CSGEPV V ITD N E IA YHFDLSG AFG+MAKKG+E KL
Sbjct  90   DGRGCGSCFEIKCTKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKL 149
Query  126  RKAGELTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSD 185
            R AGEL L+FRRVKCKYP GTK TFH+EKGSN +YLALLVKY  GDG++VAVDIK +  D
Sbjct  150  RSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVAVDIKEKGKD 209
Query  186  EFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTSK 241
            ++I +K SWGA+WR+D    L GPF++R T+EGG     +DVIP  WK DT Y +K
Sbjct  210  KWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAYEAK 265

Sequence Alignment: 16. Allergen Name: Ory s 1 Sequence ID: AAF72983

 Score = 268.9 bits 1149,  Expect = 1e-73
 Identities = 157/237 66%, Positives = 193/237 81%, Gaps = 1/237 0%
Query  6    PGPNITATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGNEPIFK 65
            PGPNIT +YG KWLEA+AT+YG+ P+GA P D+GGACGYKDVDK PF GM +CGN+PIFK
Sbjct  29   PGPNITTSYGDKWLEAKATWYGA-PKGAGPKDNGGACGYKDVDKAPFLGMNSCGNDPIFK 87
Query  66   DGLGCRACYEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKGQEDKL 125
            DG GC +C+EIKC +P  CS +P L+ +TD N E IAAYHFDLSG AFGAMAK G++++L
Sbjct  88   DGKGCGSCFEIKCSKPEACSDKPALIHVTDMNDEPIAAYHFDLSGLAFGAMAKDGKDEEL 147
Query  126  RKAGELTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSD 185
            RKAG +  QFRRVKCKYP+ TKITFHIEK SN +YLALLVKY AGDG++V V+IK + S+
Sbjct  148  RKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSE 207
Query  186  EFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTSKLQ 243
            E+  +K SWGAIWRID  KPLKGPFS+R+T+EGG  ++ +D IP  WK D+VY S +Q
Sbjct  208  EWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGGEKIIAEDAIPDGWKADSVYKSNVQ 265

Sequence Alignment: 17. Allergen Name: Ory s 1 Sequence ID: AAF72991

 Score = 267.3 bits 1142,  Expect = 4e-73
 Identities = 151/237 63%, Positives = 194/237 81%, Gaps = 1/237 0%
Query  6    PGPNITATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGNEPIFK 65
            PGPNITA YG +WLEAR T+YG  P+GA PDD+GGACGYKD+DK PF GM +CGN+PIFK
Sbjct  29   PGPNITAAYGKQWLEARGTWYGK-PKGAGPDDNGGACGYKDIDKAPFLGMNSCGNDPIFK 87
Query  66   DGLGCRACYEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKGQEDKL 125
            DG GC +C+E+KC +P  CS +PV++ ITD N E IAAYHFDLSG AFGAMAK+G++++L
Sbjct  88   DGKGCGSCFEVKCSKPEACSDKPVIIHITDMNTEPIAAYHFDLSGHAFGAMAKEGKDEEL 147
Query  126  RKAGELTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSD 185
            RKAG + +QFRRV+CKYP  TK+TFH+EKGSN +Y+A+LVKY  GDG++V V++K + S+
Sbjct  148  RKAGIIDMQFRRVRCKYPGETKVTFHVEKGSNPNYFAVLVKYVGGDGDVVKVELKEKGSE 207
Query  186  EFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTSKLQ 243
            E+ P+  SWGAIWRID  KPLKGPFS+R+T+E    LV +DVIP NWK + +Y S++Q
Sbjct  208  EWKPLNESWGAIWRIDTPKPLKGPFSLRVTTESDQKLVANDVIPDNWKANALYKSEIQ 265

Sequence Alignment: 18. Allergen Name: Lol p 1.0103 Sequence ID: CAB63699

 Score = 264.4 bits 1129,  Expect = 3e-72
 Identities = 157/235 66%, Positives = 184/235 78%, Gaps = 1/235 0%
Query  6    PGPNITATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGNEPIFK 65
            PGPNITA YG KWL+A++T+YG  P GA P D+GGACGYKDVDK PF+GMT CGN PIFK
Sbjct  29   PGPNITAEYGDKWLDAKSTWYGK-PTGAGPKDNGGACGYKDVDKAPFNGMTGCGNTPIFK 87
Query  66   DGLGCRACYEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKGQEDKL 125
            DG GC +C+EIKC +P  CSGE V V ITD N E IA YHFDLSG AFG+MAKKG+E KL
Sbjct  88   DGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKL 147
Query  126  RKAGELTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSD 185
            R AGEL LQFRRVKCKYP GTK TFH+EK SN +YLA+LVKY  GDG++VAVDIK +  D
Sbjct  148  RSAGELELQFRRVKCKYPDGTKPTFHVEKASNPNYLAILVKYVDGDGDVVAVDIKEKGKD 207
Query  186  EFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTSK 241
            ++I +K SWGA+WRID    L GPF++R T+EGG     +DVIP  WK DT Y++K
Sbjct  208  KWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEVEDVIPEGWKADTSYSAK 263

Sequence Alignment: 19. Allergen Name: Pha a 1 Sequence ID: Q41260

 Score = 264.4 bits 1129,  Expect = 3e-72
 Identities = 157/235 66%, Positives = 184/235 78%, Gaps = 1/235 0%
Query  6    PGPNITATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGNEPIFK 65
            PGPNITA YG KWL+A++T+YG  P GA P D+GGACGYKDVDK PF+GMT CGN PIFK
Sbjct  35   PGPNITAEYGDKWLDAKSTWYGK-PTGAGPKDNGGACGYKDVDKAPFNGMTGCGNTPIFK 93
Query  66   DGLGCRACYEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKGQEDKL 125
            DG GC +C+E+KC +P  CSGEP+ V ITD N E IA YHFDLSG AFG+MAKKG+E+ +
Sbjct  94   DGRGCGSCFELKCSKPESCSGEPITVHITDDNEEPIAPYHFDLSGHAFGSMAKKGEEENV 153
Query  126  RKAGELTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSD 185
            R AGEL LQFRRVKCKYP GTK TFH+EKGSN +YLALLVKY  GDG++VAVDIK +  D
Sbjct  154  RGAGELELQFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYVDGDGDVVAVDIKEKGKD 213
Query  186  EFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTSK 241
            ++I +K SWGAIWRID    L GPF++R T+EGG     +DVIP  WK DT   SK
Sbjct  214  KWIELKESWGAIWRIDTPDKLTGPFTVRYTTEGGTKAEFEDVIPEGWKADTHDASK 269

Sequence Alignment: 20. Allergen Name: Lol p 1.0102 Sequence ID: AAA63278

 Score = 261.9 bits 1118,  Expect = 1e-71
 Identities = 155/235 65%, Positives = 183/235 77%, Gaps = 1/235 0%
Query  6    PGPNITATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGNEPIFK 65
            PGPNITA YG KWL+A++T+YG  P GA P D+GGACGYKDVDK PF+GMT CGN PIFK
Sbjct  18   PGPNITAEYGDKWLDAKSTWYGK-PTGAGPKDNGGACGYKDVDKAPFNGMTGCGNTPIFK 76
Query  66   DGLGCRACYEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKGQEDKL 125
            DG GC +C+EIKC +P  CSGE V V ITD N E IA YHFDLSG AFG+MAKKG+E  +
Sbjct  77   DGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQNV 136
Query  126  RKAGELTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSD 185
            R AGEL LQFRRVKCKYP  TK TFH+EKGSN +YLA+LVKY  GDG++VAVDIK +  D
Sbjct  137  RSAGELELQFRRVKCKYPDDTKPTFHVEKGSNPNYLAILVKYVDGDGDVVAVDIKEKGKD 196
Query  186  EFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTSK 241
            ++I +K SWGA+WRID    L GPF++R T+EGG     +DVIP  WK DT Y++K
Sbjct  197  KWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEVEDVIPEGWKADTSYSAK 252

Sequence Alignment: 21. Allergen Name: Zea m 1 Sequence ID: P58738

 Score = 261.4 bits 1116,  Expect = 2e-71
 Identities = 156/238 65%, Positives = 185/238 77%, Gaps = 1/238 0%
Query  6    PGPNITATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGNEPIFK 65
            PGPNIT  Y  KWL ARAT+YG  P GA   D+GGACG K+V+ PP+ GMTACGN PIFK
Sbjct  31   PGPNITTNYNGKWLTARATWYGQ-PNGAGAPDNGGACGIKNVNLPPYSGMTACGNVPIFK 89
Query  66   DGLGCRACYEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKGQEDKL 125
            DG GC +CYE++CKE  ECSG PV V ITD NYE IA YHFDLSGKAFG++AK G  DK+
Sbjct  90   DGKGCGSCYEVRCKEKPECSGNPVTVYITDMNYEPIAPYHFDLSGKAFGSLAKPGLNDKI 149
Query  126  RKAGELTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSD 185
            R  G + ++FRRV+CKYP+G KI FHIEKG N +YLA+LVKY A DG+IV ++I+ + S 
Sbjct  150  RHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYLAVLVKYVADDGDIVLMEIQDKLSA 209
Query  186  EFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTSKLQF 244
            E+ PMK SWGAIWR+D  K LKGPFSIRLTSE G  ++  DVIPANW+PD VYTS +QF
Sbjct  210  EWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDVIPANWRPDAVYTSNVQF 268

Sequence Alignment: 22. Allergen Name: Lol p 1 Sequence ID: P14946

 Score = 258.5 bits 1103,  Expect = 2e-70
 Identities = 153/235 65%, Positives = 182/235 77%, Gaps = 1/235 0%
Query  6    PGPNITATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGNEPIFK 65
            PGPNITA YG KWL+A++T+YG  P GA P D+GGACGYK+VDK PF+GMT CGN PIFK
Sbjct  29   PGPNITAEYGDKWLDAKSTWYGK-PTGAGPKDNGGACGYKNVDKAPFNGMTGCGNTPIFK 87
Query  66   DGLGCRACYEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKGQEDKL 125
            DG GC +C+EIKC +P  CSGE V V ITD N E IA YHFDLSG AFG+MAKKG+E  +
Sbjct  88   DGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQNV 147
Query  126  RKAGELTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSD 185
            R AGEL LQFRRVKCKYP  TK TFH+EK SN +YLA+LVKY  GDG++VAVDIK +  D
Sbjct  148  RSAGELELQFRRVKCKYPDDTKPTFHVEKASNPNYLAILVKYVDGDGDVVAVDIKEKGKD 207
Query  186  EFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTSK 241
            ++I +K SWGA+WRID    L GPF++R T+EGG     +DVIP  WK DT Y++K
Sbjct  208  KWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEFEDVIPEGWKADTSYSAK 263

Sequence Alignment: 23. Allergen Name: Pas n 1.0101 Sequence ID: ACA23876

 Score = 258.0 bits 1101,  Expect = 2e-70
 Identities = 156/236 66%, Positives = 184/236 77%, Gaps = 3/236 1%
Query  6    PGPNITATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGNEPIFK 65
            PGPNIT  Y  KWL A+AT+YG  P GA PDD+GGACG K+V+ PP++G TACGN PIFK
Sbjct  30   PGPNITTNYNGKWLPAKATWYGQ-PNGAGPDDNGGACGIKNVNLPPYNGFTACGNPPIFK 88
Query  66   DGLGCRACYEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKGQEDKL 125
            DG GC +CYEI+C +P ECSG+PV V ITD NYE IA YHFDLSGKAFGAMAK G  DKL
Sbjct  89   DGKGCGSCYEIRCNKP-ECSGQPVTVFITDMNYEPIAPYHFDLSGKAFGAMAKPGLNDKL 147
Query  126  RKAGELTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSD 185
            R  G + L+FRRV+CKY  G KI FH+EKGSN +YLA+LVK+ A DG+IV +++K + SD
Sbjct  148  RHYGIFDLEFRRVRCKYQGGQKIVFHVEKGSNPNYLAMLVKFVADDGDIVLMELKEKSSD 207
Query  186  EFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTSKLQF 244
             + PMK SWGAIWR+D  K L  PFSIRLTSE G  ++  DVIP NWKPDTVY S +QF
Sbjct  208  -WKPMKLSWGAIWRMDTPKALVPPFSIRLTSESGKKVIAQDVIPVNWKPDTVYNSNVQF 265

Sequence Alignment: 24. Allergen Name: Lol p 1.0101 Sequence ID: AAA63279

 Score = 257.1 bits 1097,  Expect = 4e-70
 Identities = 152/235 64%, Positives = 181/235 77%, Gaps = 1/235 0%
Query  6    PGPNITATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGNEPIFK 65
            PGPNITA YG KWL+A++T+YG  P GA P D+GGACGYK+VDK PF+GMT CGN PIFK
Sbjct  29   PGPNITAEYGDKWLDAKSTWYGK-PTGAGPKDNGGACGYKNVDKAPFNGMTGCGNTPIFK 87
Query  66   DGLGCRACYEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKGQEDKL 125
            DG GC +C+EIKC +P  CSGE V V ITD N E IA YHFDLSG AFG+MAKKG+E  +
Sbjct  88   DGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQNV 147
Query  126  RKAGELTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSD 185
            R AGEL LQFRRVKCKYP  TK TFH+EK SN +YLA+LVKY  GDG++VAVDIK +  D
Sbjct  148  RSAGELELQFRRVKCKYPDDTKPTFHVEKASNPNYLAILVKYVDGDGDVVAVDIKEKGKD 207
Query  186  EFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTSK 241
            ++  +K SWGA+WRID    L GPF++R T+EGG     +DVIP  WK DT Y++K
Sbjct  208  KWTELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEFEDVIPEGWKADTSYSAK 263

Sequence Alignment: 25. Allergen Name: Sor h 1.0101 Sequence ID: ABC58726

 Score = 252.6 bits 1077,  Expect = 9e-69
 Identities = 155/231 67%, Positives = 184/231 79%, Gaps = 6/231 2%
Query  7    GPNITATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGNEPIFKD 66
            G NIT TYGS WLE +AT+YG  P GA PDD+GGACGYKDV+K PF+ M ACGN PIFKD
Sbjct  7    GKNITETYGSDWLERKATWYGK-PTGAGPDDNGGACGYKDVNKAPFNSMGACGNLPIFKD 65
Query  67   GLGCRACYEIKCKEP--VECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKGQEDK 124
            GL C +C+EIKC +P   ECSGE V+V ITD NYE+IAAYHFDL+G AFGAMAKKGQE+K
Sbjct  66   GL-CGSCFEIKCDKPKPAECSGEAVVVHITDMNYEQIAAYHFDLAGHAFGAMAKKGQEEK 124
Query  125  LRKAGELTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDS 184
            L KAG + ++FRRVKCKY  G K+TFH+EKGSN +YLALLVKY  GDG+IV VDIK +  
Sbjct  125  LAKAGIIDMKFRRVKCKY--GEKVTFHVEKGSNPNYLALLVKYVDGDGDIVGVDIKEKGG 182
Query  185  DEFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTSK 241
            D + P+K SWGAIWR D   P+K P ++++T+EGG     DDVIP  WK DT YT+K
Sbjct  183  DAYQPLKHSWGAIWRKDSPDPIKFPVTVQITTEGGTKTAYDDVIPEGWKADTTYTAK 239

Sequence Alignment: 26. Allergen Name: Ory s 1 Sequence ID: AAF72990

 Score = 250.5 bits 1068,  Expect = 4e-68
 Identities = 143/238 60%, Positives = 182/238 76%, Gaps = 1/238 0%
Query  6    PGPNITATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGNEPIFK 65
            PGPNIT  Y + WL ARAT+YG  P G+   D+GGACG K+V+ PP++GM +CGN PIFK
Sbjct  31   PGPNITTNYNAPWLPARATWYGQ-PYGSGSTDNGGACGIKNVNLPPYNGMISCGNVPIFK 89
Query  66   DGLGCRACYEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKGQEDKL 125
            DG GC +CYE+KC++P  CS +PV V ITD NYE I+AYHFD+SGKAFGAMA  G+E +L
Sbjct  90   DGRGCGSCYEVKCEQPAACSKQPVTVFITDMNYEPISAYHFDFSGKAFGAMACPGKETEL 149
Query  126  RKAGELTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSD 185
            RKAG + +QFRRV+CKYP G K+TFH+EKGSN +YLA+LVK+ A DG+++ +D++     
Sbjct  150  RKAGIIDMQFRRVRCKYPGGQKVTFHVEKGSNPNYLAVLVKFVADDGDVIQMDLQEAGLP 209
Query  186  EFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTSKLQF 244
             + PMK SWGAIWR+D   PLK PFSIR+T+E G  L+  DVIP NW PD +Y S +QF
Sbjct  210  AWRPMKLSWGAIWRMDTATPLKAPFSIRVTTESGKSLIAKDVIPVNWMPDAIYVSNVQF 268

Sequence Alignment: 27. Allergen Name: Ory s 1 Sequence ID: Q40638

 Score = 234.1 bits 996,  Expect = 4e-63
 Identities = 143/220 65%, Positives = 171/220 77%, Gaps = 4/220 1%
Query  6    PGPNITATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGNEPIFK 65
            PGPNIT +YG KWLEAR       PR  AP D+GGACGYKDVDK PF GM +CGN+PIFK
Sbjct  29   PGPNITTSYGDKWLEARPPGM-VRPRVLAPKDNGGACGYKDVDKAPFLGMNSCGNDPIFK 87
Query  66   DGLGCRACYEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKGQEDKL 125
            DG GC +C+EIKC +P  CS +P L+ +TD N E IAAYHFDLSG A   MAK G++++L
Sbjct  88   DGKGCGSCFEIKCSKPEACSDKPALIHVTDMNDEPIAAYHFDLSGLA---MAKDGKDEEL 144
Query  126  RKAGELTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSD 185
            RKAG +  QFRRVKCKYP+ TKITFHIEK SN +YLALLVKY AGDG++V V+IK + S+
Sbjct  145  RKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSE 204
Query  186  EFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIP 229
            E+  +K SWGAIWRID  KPLKGPFS+R+T+EG      +D IP
Sbjct  205  EWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGARRSSAEDAIP 248

Sequence Alignment: 28. Allergen Name: Ory s 1 Sequence ID: AAF72984

 Score = 221.1 bits 939,  Expect = 3e-59
 Identities = 133/241 55%, Positives = 173/241 71%, Gaps = 6/241 2%
Query  3    GDKPGPNITA---TYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACG 59
            G +PG N +A   T    W  ARAT+YG+ P GA PDD GGACG+K+ ++ PF  MT+CG
Sbjct  25   GARPG-NFSASDFTADPNWEVARATWYGA-PTGAGPDDDGGACGFKNTNQYPFSSMTSCG 82
Query  60   NEPIFKDGLGCRACYEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKK 119
            NEPIFKDG GC +CY+I+C     CSG P  V ITD NY  ++ YHFDLSG AFGAMAK 
Sbjct  83   NEPIFKDGKGCGSCYQIRCVNHPACSGNPETVIITDMNYYPVSKYHFDLSGTAFGAMAKP 142
Query  120  GQEDKLRKAGELTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDI 179
            GQ D+LR AG + +QF+RV C +P G K+TFH+E+GSN  Y+A+LV+Y  GDG++V VD+
Sbjct  143  GQNDQLRHAGIIDIQFKRVPCNFP-GLKVTFHVEEGSNPVYFAVLVEYEDGDGDVVQVDL 201
Query  180  KPRDSDEFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYT 239
               +S  + PM+ SWG+IWR+D    L  PFS+R+T+E G +LV   VIPANW P  VY 
Sbjct  202  MEANSQSWTPMRESWGSIWRLDSNHRLTAPFSLRITNESGKQLVASQVIPANWAPMAVYR 261
Query  240  SKLQFGA 246
            S +Q+ +
Sbjct  262  SFVQYSS 268

Sequence Alignment: 29. Allergen Name: Ory s 1 Sequence ID: AAF72987

 Score = 215.9 bits 916,  Expect = 1e-57
 Identities = 131/231 56%, Positives = 169/231 73%, Gaps = 8/231 3%
Query  12   ATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGNEPIFKDGLGCR 71
            + YGS WL ARAT+YG+ P GA PDD+GGACG+K+V++ PF  MT+CGNEPIFKDG GC 
Sbjct  38   SAYGSGWLPARATWYGA-PTGAGPDDNGGACGFKNVNQYPFSSMTSCGNEPIFKDGKGCG 96
Query  72   ACYEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKGQEDKLRKAGEL 131
            +CY+I+C +   CSG    V ITD NY  +A YHFDLSG AFGAMAK G  DKLR +G +
Sbjct  97   SCYQIRCNKDPSCSGNIETVIITDMNYYPVARYHFDLSGTAFGAMAKPGLNDKLRHSGII 156
Query  132  TLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSDE----- 186
             +QFRRV C YP G KI FH+E+GSN  Y+A+LV+Y   DG++V VD+    S       
Sbjct  157  DIQFRRVPCNYP-GLKINFHVEEGSNPVYFAVLVEYEDLDGDVVQVDLMESKSAYGGATG 215
Query  187  -FIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTSKLQF 244
             + PM+ SWG+IWR+D    L+ PFS+R+ S+ G  LV ++VIPANW P++ Y S +QF
Sbjct  216  VWTPMRESWGSIWRLDSNHRLQAPFSLRIRSDSGKTLVANNVIPANWSPNSNYRSIVQF 274

Sequence Alignment: 30. Allergen Name: Zea m 1 Sequence ID: Q07154

 Score = 209.9 bits 889,  Expect = 5e-56
 Identities = 124/190 65%, Positives = 150/190 78%, Gaps = 0/190 0%
Query  55   MTACGNEPIFKDGLGCRACYEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFG 114
            MTACGN PIFKDG GC +CYE++CKE  ECSG PV V ITD NYE IA YHFDLSGKAFG
Sbjct  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVFITDMNYEPIAPYHFDLSGKAFG 60
Query  115  AMAKKGQEDKLRKAGELTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNI 174
            ++AK G  DKLR  G + ++FRRV+CKYP+G KI FHIEKG N +Y+A+LVK+ A DG+I
Sbjct  61   SLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGDI 120
Query  175  VAVDIKPRDSDEFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKP 234
            V ++I+ + S E+ PMK SWGAIWR+D  K LKGPFSIRLTSE G  ++  D+IPANW+P
Sbjct  121  VLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDIIPANWRP 180
Query  235  DTVYTSKLQF 244
            D VYTS +QF
Sbjct  181  DAVYTSNVQF 190

Sequence Alignment: 31. Allergen Name: Tri a ps93 Sequence ID: AAD10496

 Score = 207.3 bits 878,  Expect = 4e-55
 Identities = 124/232 53%, Positives = 169/232 72%, Gaps = 10/232 4%
Query  10   ITATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGNEPIFKDGLG 69
            +  +Y S WL A+AT+YG+ P GA PDD+GGACG+K+V++ P   M ACGNEPIF  G G
Sbjct  32   VARSYTSGWLPAKATWYGA-PNGAGPDDNGGACGFKNVNQYPISSMGACGNEPIFAGGEG 90
Query  70   CRACYEIKCK---EPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKGQEDKLR 126
            C  CYEIKC+    P  CSG+P  + ITD NY  +A YH+DLSG AFG+MAK G  D+LR
Sbjct  91   CGMCYEIKCEYSNNP-SCSGQPRRIVITDMNYYPVARYHLDLSGTAFGSMAKYGLNDRLR 149
Query  127  KAGELTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDI----KPR 182
             AG + +QFRRV C +P G K+TFH+++GSN +YLA+LV+Y   DG +V +++      R
Sbjct  150  HAGIIDMQFRRVPCNFP-GMKVTFHVQRGSNPNYLAVLVEYVNVDGTVVRMELMQTMNGR 208
Query  183  DSDEFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTSKL 242
             +  +  M+ SWG++WR+D  +P++GPFSIR+TS+ G  LV ++ IPA W+ D  Y S L
Sbjct  209  PTGYWQDMRRSWGSVWRMDTNRPVQGPFSIRITSDTGKTLVANNAIPAYWQQDHAYWSNL 268
Query  243  QF 244
            QF
Sbjct  269  QF 270

Sequence Alignment: 32. Allergen Name: Ory s 1 Sequence ID: AAB61710

 Score = 206.6 bits 875,  Expect = 7e-55
 Identities = 123/229 53%, Positives = 164/229 71%, Gaps = 7/229 3%
Query  14   YGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGNEPIFKDGLGCRAC 73
            Y + WL A+AT+YG  P GA PDD+GGACG+K+ ++ PF  MT+CGNEP+F+DG GC AC
Sbjct  27   YTNDWLPAKATWYGQ-PNGAGPDDNGGACGFKNTNQYPFMSMTSCGNEPLFQDGKGCGAC 85
Query  74   YEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKGQEDKLRKAGELTL 133
            Y+I+C     CSG+P  V ITD NY  +A YHFDLSG AFGAMA+ G  D+LR AG + +
Sbjct  86   YQIRCTNNPSCSGQPRTVIITDMNYYPVARYHFDLSGTAFGAMARPGLNDQLRHAGIIDI 145
Query  134  QFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIK---P--RDSDEFI 188
            QFRRV C Y  G  + FH+E GSN  YLA+LV++A  DG +V +D+    P  + +  + 
Sbjct  146  QFRRVPC-YHRGLYVNFHVEAGSNPVYLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWT 204
Query  189  PMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTSKLQF 244
            PM+ SWG+IWR+D    L+GP S+R+ SE G  ++   VIPANW+ +T Y SK+QF
Sbjct  205  PMRRSWGSIWRLDANHRLQGPXSLRMVSESGQTVIAHQVIPANWRANTNYGSKVQF 260

Sequence Alignment: 33. Allergen Name: Ory s 1 Sequence ID: AAF72985

 Score = 202.5 bits 857,  Expect = 1e-53
 Identities = 120/231 51%, Positives = 165/231 71%, Gaps = 8/231 3%
Query  12   ATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGNEPIFKDGLGCR 71
            A Y   W +ARAT+YG  P GA PDD+GGACG+K  ++ PF  MT+CGN+P+FKDG GC 
Sbjct  49   AVYWGPWTKARATWYGQ-PNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCG 107
Query  72   ACYEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKGQEDKLRKAGEL 131
            +CY+I+C +   CSG    V ITD NY  +A +HFDLSG AFG +AK G  DKLR +G +
Sbjct  108  SCYKIRCTKDQSCSGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGII 167
Query  132  TLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDS------D 185
             ++F RV C++P G KI FH+E+ SN  Y+A+LV+Y  GDG++V VD+    +       
Sbjct  168  DIEFTRVPCEFP-GLKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTG 226
Query  186  EFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTSKLQF 244
            ++ PM+ SWG+IWR+D    L+ PFSIR+ +E G  LV ++VIPANW+P+T Y S +Q+
Sbjct  227  KWTPMRESWGSIWRLDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFYRSFVQY 285

Sequence Alignment: 34. Allergen Name: Ory s 1 Sequence ID: AAF72989

 Score = 195.9 bits 828,  Expect = 1e-51
 Identities = 114/227 50%, Positives = 158/227 69%, Gaps = 4/227 1%
Query  18   WLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGNEPIFKDGLGCRACYEIK 77
            W  A+AT+YG  P GA   D+GGACG+K V++ PF GMT+CGN+P++K G GC +CY ++
Sbjct  43   WGNAKATWYGQ-PNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRVR 101
Query  78   CKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKGQEDKLRKAGELTLQFRR 137
            C     CSG    V ITD NY  ++ YHFDLSG AFG +AK G+ D LR+AG + +QF R
Sbjct  102  CNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLRRAGIIDVQFAR 161
Query  138  VKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSD--EFIPMKSSWG 195
            V C++P G K+ FH+E+GS+  YLA+LV+Y  GDG++  VD+K   +    + PM+ SWG
Sbjct  162  VPCEFP-GLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWG 220
Query  196  AIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTSKLQFGA 246
            ++WR+D    L+ PFSIR+ S+ G  LV  DVIP NW P+T Y S +Q+ +
Sbjct  221  SVWRLDSNHRLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNTFYRSFVQYSS 271

Sequence Alignment: 35. Allergen Name: Gly m 2 Sequence ID: AAA50175

 Score = 171.1 bits 719,  Expect = 3e-44
 Identities = 110/224 49%, Positives = 148/224 66%, Gaps = 11/224 4%
Query  16   SKWLEARATFYG-SNPRGAAPDDHGGACGYKD-VDKPPFDGMTACGNEPIFKDGLGCRAC 73
            S W  A AT+YG +N  G+     GGACGY + V +PPF  + + G+  I+  G GC +C
Sbjct  46   SDWSPAVATWYGPANGDGS----EGGACGYGNAVGQPPFSSLISAGSPLIYDSGKGCGSC 101
Query  74   YEIKCKEPVECSGEPVLVKITDK--NYEHIAAYHFDLSGKAFGAMAKKGQEDKLRKAGEL 131
            YE+KC     CSG PV V ITD+       A YHFDLSG AFGAMA  GQ++ LR AG++
Sbjct  102  YEVKCTGNSACSGNPVKVVITDECAGCGSDAQYHFDLSGNAFGAMAISGQDENLRNAGKI 161
Query  132  TLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPR-DSDEFIPM 190
             +Q RR++C YP G  I FH++ GSN  Y+A LV+Y  GDG++  V++K   DS  +  M
Sbjct  162  NIQHRRIECNYP-GRSIAFHVDSGSNQEYFATLVEYEDGDGDLAKVELKEALDSGSWDSM 220
Query  191  KSSWGAIWRIDPKKPLKGPFSIRLTS-EGGAHLVQDDVIPANWKPDTVYTSKLQF 244
            + SWGA+W+ D   PL+ PFSI+LT+ E G  +V ++VIPA W P   Y S + F
Sbjct  221  QQSWGAVWKFDKGSPLRAPFSIKLTTLESGQTIVANNVIPAGWTPGQTYRSIVNF 275

Sequence Alignment: 36. Allergen Name: Ory s 1 Sequence ID: AAF72988

 Score = 170.3 bits 716,  Expect = 7e-44
 Identities = 136/237 57%, Positives = 180/237 75%, Gaps = 18/237 7%
Query  6    PGPNITATYGSK------WLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACG 59
            P P   ++ GS       WL ARAT+YG+ P GA PDD+GGACG+K+V+ PPF  MT+CG
Sbjct  74   PSPGTGSSNGSSGGGGGGWLNARATWYGA-PNGAGPDDNGGACGFKNVNLPPFSAMTSCG 132
Query  60   NEPIFKDGLGCRACYEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKK 119
            NEP+FKDG GC +CY+I+C     CSG P  V ITD NY  ++ YHFDLSG AFGAMAK 
Sbjct  133  NEPLFKDGKGCGSCYQIRCVGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMAKD 192
Query  120  GQEDKLRKAGELTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDI 179
             + D+LR AG + +QFRRV C+YP G  +TFH+E+GSN  Y+A+LV+Y  GDG++V VD+
Sbjct  193  NRNDELRHAGIIDIQFRRVPCQYP-GLTVTFHVEQGSNPVYMAILVEYENGDGDVVQVDL 251
Query  180  -KPRDSDEFI---------PMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIP 229
             + R S   +         PM+ SWG+IWR+D   PL+GPFS+R+T+E G  L+ D VIP
Sbjct  252  MESRYSTGGVDGTPTGVWTPMRESWGSIWRLDTNHPLQGPFSLRITNESGKTLIADQVIP 311
Query  230  ANWKPDTVYTSKLQF 244
            A+W+P+TVY+S +QF
Sbjct  312  ADWQPNTVYSSIVQF 326

Sequence Alignment: 37. Allergen Name: Ory s 1 Sequence ID: AAF72986

 Score = 164.3 bits 689,  Expect = 4e-42
 Identities = 109/227 48%, Positives = 145/227 63%, Gaps = 12/227 5%
Query  15   GSKWLEARATFYGSNPRGAAPDDHGGACGYKD-VDKPPFDGMTACGNEPIFKDGLGCRAC 73
            G  W    AT+YG  P+G   +  GGACGY+  V + PF  M A G   +FK+G GC +C
Sbjct  42   GYGWSSGGATWYGG-PQGDGSE--GGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSC 98
Query  74   YEIKCKEPVECSGEPVLVKITDKNYEHIA---AYHFDLSGKAFGAMAKKGQEDKLRKAGE 130
            Y+IKC     CSG PV V ITD     +    A HFD+SG AFGAMA +G  D+LR AG 
Sbjct  99   YQIKCTGNRACSGRPVTVVITDSCPGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGV 158
Query  131  LTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDI-KPRDSDEFIP 189
            L +Q++RV C++     + F ++ GSN +YLA+LV+YA GDG++ AV I K R    +  
Sbjct  159  LKIQYKRVPCRF--AMNVAFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKA 216
Query  190  MKSSWGAIWRIDPK--KPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTSKLQFGA 246
            M+ SWGA WR++    KPL  PFSIRLTS  G  LV ++VIP+ W+    Y S + + A
Sbjct  217  MQQSWGATWRLNSNTGKPLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTYRSTVNYAA 275

Sequence Alignment: 38. Allergen Name: Ara t expansin Sequence ID: CAB37496

 Score = 94.5 bits 382,  Expect = 4e-21
 Identities = 73/199 36%, Positives = 106/199 53%, Gaps = 11/199 5%
Query  40   GACGYKDVDKPPFDGMTACGNEPIFKDGLGCRACYEIKCKEPVECSGEPVLVKITDKNYE 99
            GAC Y  +    F G  A     I+KDG GC AC++++CK P  CS +   V +TD N  
Sbjct  43   GACAYGSMATGFFAGHIAAALPSIYKDGSGCGACFQVRCKNPTLCSSKGTTVIVTDLNKT 102
Query  100  HIAAYHFDLSGKAFGAMAKK--GQEDKLRKAGELTLQFRRVKCKYPSGTKITFHIEKGS- 156
            +     + LS +AF AMAK   G +  L K G + +++RRV C Y    K+   +E+ S 
Sbjct  103  NQT--DLVLSSRAFRAMAKPVVGADRDLLKQGIVDIEYRRVPCDY-GNKKMNVRVEESSK 159
Query  157  NDHYLALLVKYAAGDGNIVAVDIKPRDSDEFIPMKSSWGAIWRIDPKKPLKGPFSIRLTS 216
            N +YLA+ + Y  G   +VA+ I    S  +  M  S GA+W  D K P  G +  R+  
Sbjct  160  NPNYLAIKLLYQGGQTEVVAIYIAQVGSSHWSYMTRSHGAVWVTD-KVP-NGALQFRFVV 217
Query  217  EGG--AHLVQDD-VIPANWKPDTVYTSKLQ 243
              G    +V    V+PANW+    Y + +Q
Sbjct  218  TAGYDGKMVWSQRVLPANWEAGKSYDAGVQ 247

Sequence Alignment: 39. Allergen Name: Ory s 1 Sequence ID: AAG13596

 Score = 84.9 bits 340,  Expect = 3e-18
 Identities = 61/203 30%, Positives = 102/203 50%, Gaps = 8/203 3%
Query  38   HGGACGYKDVDKPPFDGMTACGNEPIFKDGLGCRACYEIKCKEPVECSGEPVLVKITDKN 97
            + G+CGY  +      G  A  +  +F+ G+GC AC++++CK+   CS     V +TD+ 
Sbjct  50   NAGSCGYGSLAASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTDEA 109
Query  98   YEHIAAYHFDLSGKAFGAMAKKGQEDKLRKAGELTLQFRRVKCKYPSGTKITFHIEKGSN 157
                    + LS  A+ AMA+ G   +LR    + ++++RV C+Y +G  ++  +E+ S 
Sbjct  110  -RSTNRTDLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEKSR 168
Query  158  D-HYLALLVKYAAGDGNIVAVDIKPRDSDEFIPMKSSWGAIWRIDPKKPLKGPFSIRLTS 216
                L++   Y  G  +IVAVD+    S  +  M   +G  W    + P  GP+  R+  
Sbjct  169  PPRELSIRFLYQGGQTDIVAVDVATVGSSNWKFMTRDYGPAWST-AQAP-AGPLQFRVVV 226
Query  217  EGG--AHLVQDD--VIPANWKPDTVYTSKLQ 243
             GG     V  D  V+P  W    VY + +Q
Sbjct  227  TGGYDGKWVWADGEVLPRRWTAGRVYDAGVQ 257

Sequence Alignment: 40. Allergen Name: Ory s 1 Sequence ID: BAA85432

 Score = 77.8 bits 309,  Expect = 4e-16
 Identities = 72/226 31%, Positives = 116/226 51%, Gaps = 34/226 15%
Query  5    KPGPNITATYG-SKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPP-FDGMTACGNEP 62
            +P P     Y  S W +  ATFYG +P G   DD GGACGY   D    +   TA  + P
Sbjct  38   QPAPGAVTPYKTSDWHDGSATFYG-DPSGMG-DDFGGACGYVSNDIVSLYSTKTAALSTP 95
Query  63   IFKDGLGCRACYEIKC-KEPVECSGEPVLVKIT--------------DKNYEHIAAYHFD 107
            +F DG GC  CYE++C K P    G P +V IT              D  + +   +HFD
Sbjct  96   LFADGNGCGQCYELRCVKSPWCNPGSPSVV-ITGTNLCPPNWYLPNDDGGWCNPPRHHFD 154
Query  108  LSGKAFGAMAKKGQEDKLRKAGELTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKY 167
            ++  +F  +A+       R AG + +Q+RRV C+   G +  ++     N ++L L V  
Sbjct  155  MAPPSFLKLAQ-------RVAGIVPVQYRRVPCQRTGGVRFCLQ----GNHYWLLLYVMN 203
Query  168  AAGDGNIVAVDIKPRDSD-EFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAH--LVQ 224
              G G++ ++ +K       +I    +WG  +++         ++++LT+    +  ++ 
Sbjct  204  VGGAGDVSSLSVKTSGGGGAWIQAAHNWGITYQVFAALDNSDGLTVKLTTYSTPQQTIIV 263
Query  225  DDVIPANWKPDTVYTSKLQF 244
             D I   W     Y     F
Sbjct  264  SDAISPWWITGLCYQGSNNF 283

Sequence Alignment: 41. Allergen Name: Cyn d 15 Sequence ID: AAP80171

 Score = 70.0 bits 273,  Expect = 4e-14
 Identities = 48/91 52%, Positives = 62/91 68%, Gaps = 7/91 7%
Query  148  ITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSDEFIPMKSSWGAIWRIDPKKPLK 207
            I FH+E+ S    +AL +K +A +  I  VD++   +D   PM  S G  W ID  KPLK
Sbjct  22   IIFHVEESSPK--FALSIKDSAKE--ITQVDVREHGADNMDPMTKS-GDSWTID--KPLK 74
Query  208  GPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTSKLQFG 245
            GP++IRL +EGG   VQDDVIP NWK  T Y +KL+FG
Sbjct  75   GPLNIRLRAEGGGSRVQDDVIPENWKAGTDYPTKLHFG 112

Sequence Alignment: 42. Allergen Name: Cyn d 2 Sequence ID: CAA10346

 Score = 67.7 bits 263,  Expect = 2e-13
 Identities = 39/90 43%, Positives = 58/90 64%, Gaps = 2/90 2%
Query  147  KITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSDEFIPMKSSWGAIWRIDPKKPL 206
            K+TF +EKGSN+ +LA+LVKY  GD  +  V+++   SDE++ M    G +W  D ++PL
Sbjct  29   KVTFTVEKGSNEKHLAVLVKYE-GD-TMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPL 86
Query  207  KGPFSIRLTSEGGAHLVQDDVIPANWKPDTVY 238
            KGPF+ R+ +E G   V DDV+P  +     Y
Sbjct  87   KGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 43. Allergen Name: Poa p 2 Sequence ID: CAA10348

 Score = 66.8 bits 259,  Expect = 4e-13
 Identities = 38/90 42%, Positives = 58/90 64%, Gaps = 2/90 2%
Query  147  KITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSDEFIPMKSSWGAIWRIDPKKPL 206
            K+TF +EKGSN+ +LA+LVKY  GD  +  V+++   SDE++ M    G +W  D ++PL
Sbjct  29   KVTFTVEKGSNEKHLAVLVKYE-GD-TMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPL 86
Query  207  KGPFSIRLTSEGGAHLVQDDVIPANWKPDTVY 238
            +GPF+ R+ +E G   V DDV+P  +     Y
Sbjct  87   QGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 44. Allergen Name: Dac g 2 Sequence ID: CAA10345

 Score = 66.8 bits 259,  Expect = 4e-13
 Identities = 38/90 42%, Positives = 58/90 64%, Gaps = 2/90 2%
Query  147  KITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSDEFIPMKSSWGAIWRIDPKKPL 206
            K+TF +EKGSN+ +LA+LVKY  GD  +  V+++   SDE++ M    G +W  D ++PL
Sbjct  29   KVTFTVEKGSNEKHLAVLVKYE-GD-TMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPL 86
Query  207  KGPFSIRLTSEGGAHLVQDDVIPANWKPDTVY 238
            +GPF+ R+ +E G   V DDV+P  +     Y
Sbjct  87   QGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 45. Allergen Name: Phl p 2 Sequence ID: P43214

 Score = 66.8 bits 259,  Expect = 4e-13
 Identities = 38/90 42%, Positives = 58/90 64%, Gaps = 2/90 2%
Query  147  KITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSDEFIPMKSSWGAIWRIDPKKPL 206
            K+TF +EKGSN+ +LA+LVKY  GD  +  V+++   SDE++ M    G +W  D ++PL
Sbjct  29   KVTFTVEKGSNEKHLAVLVKYE-GD-TMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPL 86
Query  207  KGPFSIRLTSEGGAHLVQDDVIPANWKPDTVY 238
            +GPF+ R+ +E G   V DDV+P  +     Y
Sbjct  87   QGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 46. Allergen Name: Lol p 2 Sequence ID: P14947

 Score = 65.5 bits 253,  Expect = 7e-13
 Identities = 37/91 40%, Positives = 57/91 62%, Gaps = 0/91 0%
Query  148  ITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSDEFIPMKSSWGAIWRIDPKKPLK 207
            + F +EKGS++  LAL +KY     ++  V++K   S+E++ +K +   +W I   KPLK
Sbjct  4    VEFTVEKGSDEKNLALSIKYNKEGDSMAEVELKEHGSNEWLALKKNGDGVWEIKSDKPLK 63
Query  208  GPFSIRLTSEGGAHLVQDDVIPANWKPDTVY 238
            GPF+ R+ SE G   V DDV+PA++K  T Y
Sbjct  64   GPFNFRFVSEKGMRNVFDDVVPADFKVGTTY 94

Sequence Alignment: 47. Allergen Name: Lol p 2 Sequence ID: CAA51775

 Score = 62.4 bits 239,  Expect = 6e-12
 Identities = 36/87 41%, Positives = 55/87 63%, Gaps = 0/87 0%
Query  150  FHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSDEFIPMKSSWGAIWRIDPKKPLKGP 209
            F +EKGS++  LAL +KY+     +  V++K   S+E++ +K +   +W I   KPLKGP
Sbjct  2    FTVEKGSDEKNLALSIKYSKEGDAMAEVELKEHGSNEWLALKKNGDGVWEIKSDKPLKGP 61
Query  210  FSIRLTSEGGAHLVQDDVIPANWKPDT 236
            F+ R+ SE G   V DDV+PA++K  T
Sbjct  62   FNFRFVSEKGMWNVFDDVVPADFKVGT 88

Sequence Alignment: 48. Allergen Name: Dac g 3 Sequence ID: P93124

 Score = 62.1 bits 238,  Expect = 8e-12
 Identities = 36/92 39%, Positives = 55/92 59%, Gaps = 1/92 1%
Query  147  KITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSDEFIPMKSSWGAIWRIDPKKPL 206
            K+TF +EKGS+   L L +KY      +  V+++   S+E+ P+ +  G +W +   KPL
Sbjct  2    KVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPL-TKKGNLWEVKSSKPL 60
Query  207  KGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYT 239
             GPF+ R+ S+GG   V D+VIP  +K  T YT
Sbjct  61   TGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYT 93

Sequence Alignment: 49. Allergen Name: Phl p 3.0101 Sequence ID: 2JNZ_A

 Score = 57.3 bits 217,  Expect = 2e-10
 Identities = 32/94 34%, Positives = 53/94 56%, Gaps = 1/94 1%
Query  144  SGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSDEFIPMKSSWGAIWRIDPK 203
            S  ++TF ++KGS+   L L +KY     ++  V+++   S+E+ P+    G +W +   
Sbjct  11   SAVQVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKK-GNVWEVKSS 69
Query  204  KPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVY 238
            KPL GPF+ R+ S+GG   V D+VIP  +     Y
Sbjct  70   KPLVGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTY 104

Sequence Alignment: 50. Allergen Name: Lol p 3 Sequence ID: P14948

 Score = 55.5 bits 209,  Expect = 7e-10
 Identities = 33/93 35%, Positives = 52/93 55%, Gaps = 1/93 1%
Query  146  TKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSDEFIPMKSSWGAIWRIDPKKP 205
            TK+ + +EKGS+   L L +KY      +  V+++   S+E+ PM +  G +W +   KP
Sbjct  1    TKVDLTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPM-TKKGNLWEVKSAKP 59
Query  206  LKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYT 239
            L GP + R+ S+GG   V D+VIP  +     YT
Sbjct  60   LTGPMNFRFLSKGGMKNVFDEVIPTAFTVGKTYT 93

Sequence Alignment: 51. Allergen Name: Tri a 3 Sequence ID: CAA90746

 Score = 50.2 bits 186,  Expect = 4e-08
 Identities = 28/91 30%, Positives = 52/91 57%, Gaps = 1/91 1%
Query  147  KITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSDEFIPMKSSWGAIWRIDPKKPL 206
            K+ + ++KGS+   LAL + Y   + ++  V+++   S+E+ P+ +  G +W +   KPL
Sbjct  24   KVKLTVQKGSDKKKLALKIDYTRPNDSLSEVELRQYGSEEWQPL-TKKGDVWEVSCSKPL 82
Query  207  KGPFSIRLTSEGGAHLVQDDVIPANWKPDTVY 238
             GPF+ R+ S+ G   V D+V   ++K    Y
Sbjct  83   VGPFNFRFLSKNGMKKVFDEVFSTDFKIGKTY 114

Sequence Alignment: 52. Allergen Name: Sor h 2.0201 Sequence ID: A0A077B2S0

 Score = 49.8 bits 184,  Expect = 5e-08
 Identities = 32/94 34%, Positives = 56/94 59%, Gaps = 6/94 6%
Query  145  GTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSDEFIP-MKSSWGAIWRIDPK 203
            GT +T  + K S    L+L+   A     I  V +KP+ + +F   +K S    + +D K
Sbjct  26   GTTLTIEVGKDSTSTKLSLITNVA-----ISEVSVKPKGATDFTDDLKESEPKTFTLDSK 80
Query  204  KPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTSKLQ 243
            +P++GP + R+ ++GG + V D+ IPA++K  +VY +  Q
Sbjct  81   EPIEGPIAFRFLAKGGGYRVVDNAIPADFKAGSVYKTTEQ 120

Sequence Alignment: 53. Allergen Name: Sor h 2.0101 Sequence ID: A0A077B7S9

 Score = 48.2 bits 177,  Expect = 2e-07
 Identities = 34/93 36%, Positives = 57/93 61%, Gaps = 6/93 6%
Query  146  TKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSDEFIP-MKSSWGAIWRIDPKK 204
            T +T+ I K S    L L+   A+ D  +  V +K + + +F   +K S    +  + K+
Sbjct  25   TLMTWTIGKDSTSTRLVLV---ASAD--VSEVAVKDKGATDFSDDLKESPAKTFTYESKE 79
Query  205  PLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTSKLQ 243
            P+KGP+S+R+  +G  +   DDVIPA++KP +VY +K Q
Sbjct  80   PIKGPLSVRFAVKGQGYRTTDDVIPADFKPGSVYKTKEQ 118

Sequence Alignment: 54. Allergen Name: Dac g 1.0101 Sequence ID: Q7M1X8

 Score = 42.6 bits 150,  Expect = 2e-06
 Identities = 21/29 72%, Positives = 25/29 86%, Gaps = 1/29 3%
Query  6    PGPNITATYGSKWLEARATFYGSNPRGAAP 35
            PGPNITATYG KWL+A++T+YG  P GA P
Sbjct  6    PGPNITATYGDKWLDAKSTWYGK-PTGAGP 34

Sequence Alignment: 55. Allergen Name: Ant o 1.0101 Sequence ID: Q7M1X6

 Score = 40.3 bits 140,  Expect = 9e-06
 Identities = 20/27 74%, Positives = 24/27 88%, Gaps = 1/27 3%
Query  6    PGPNITATYGSKWLEARATFYGSNPRGA 33
            PGPNITATYG KWL+A++T+YG  P GA
Sbjct  6    PGPNITATYGDKWLDAKSTWYGK-PTGA 32

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.