The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

AILGQDGSVWAQGLHLGGAKYVIAGEPGAVIRLGDYLLDQGL
Sequence Info Allergen Name Length Opt Bits Score E Value
C0HJX6 Pla l 2.0101 42 282 84.2 1.3e-19
Q9SQI9 Ara h 5 131 95 32.4 0.0016
O65809 Gly m 3 131 88 30.5 0.006
AAP13533 Cuc m 2 131 88 30.5 0.006
Q9STB6 Hev b 8.0102 131 87 30.2 0.0073
FG438715 Act d 9.0101 109 85 29.7 0.0087
ABU95412 Sin a 4.0101 131 86 29.9 0.0088
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Pla l 2.0101 Sequence ID: C0HJX6

 Score = 84.2 bits 282,  Expect = 1e-19
 Identities = 42/42 100%, Positives = 42/42 100%, Gaps = 0/42 0%
Query  1    AILGQDGSVWAQGLHLGGAKYVIAGEPGAVIRLGDYLLDQGL 42
            AILGQDGSVWAQGLHLGGAKYVIAGEPGAVIRLGDYLLDQGL
Sbjct  1    AILGQDGSVWAQGLHLGGAKYVIAGEPGAVIRLGDYLLDQGL 42

Sequence Alignment: 2. Allergen Name: Ara h 5 Sequence ID: Q9SQI9

 Score = 32.4 bits 95,  Expect = 0.002
 Identities = 26/31 83%, Positives = 28/31 90%, Gaps = 29/31 93%
Query  1    AILGQDGSVWAQ----------------------------GLHLGGAKY-VIAGEPGAVI 31
            AILGQDG VWAQ                            GL+LGG KY VI GEPGA+I
Sbjct  24   AILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSLAPTGLYLGGTKYMVIQGEPGAII 83

Sequence Alignment: 3. Allergen Name: Gly m 3 Sequence ID: O65809

 Score = 30.5 bits 88,  Expect = 0.006
 Identities = 28/32 87%, Positives = 30/32 93%, Gaps = 29/32 90%
Query  1    AILGQDGSVWAQ----------------------------GLHLGGAKY-VIAGEPGAVI 31
            AI+GQDGSVWAQ                            GL+LGG KY VI GEPGAVI
Sbjct  24   AIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVI 83
Query  32   R 32
            R
Sbjct  84   R 84

Sequence Alignment: 4. Allergen Name: Cuc m 2 Sequence ID: AAP13533

 Score = 30.5 bits 88,  Expect = 0.006
 Identities = 27/32 84%, Positives = 30/32 93%, Gaps = 29/32 90%
Query  1    AILGQDGSVWAQ----------------------------GLHLGGAKY-VIAGEPGAVI 31
            AI+GQDGSVWAQ                            GL++GG KY VI GEPGAVI
Sbjct  24   AIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTLAPTGLYIGGTKYMVIQGEPGAVI 83
Query  32   R 32
            R
Sbjct  84   R 84

Sequence Alignment: 5. Allergen Name: Hev b 8.0102 Sequence ID: Q9STB6

 Score = 30.2 bits 87,  Expect = 0.007
 Identities = 27/32 84%, Positives = 30/32 93%, Gaps = 29/32 90%
Query  1    AILGQDGSVWAQ----------------------------GLHLGGAKY-VIAGEPGAVI 31
            AI+GQDGSVWAQ                            GL++GG KY VI GEPGAVI
Sbjct  24   AIIGQDGSVWAQSANFPQFKSEEITGIMSDFHEPGTLAPTGLYIGGTKYMVIQGEPGAVI 83
Query  32   R 32
            R
Sbjct  84   R 84

Sequence Alignment: 6. Allergen Name: Act d 9.0101 Sequence ID: FG438715

 Score = 29.7 bits 85,  Expect = 0.009
 Identities = 26/32 81%, Positives = 29/32 90%, Gaps = 29/32 90%
Query  1    AILGQDGSVWAQ----------------------------GLHLGGAKY-VIAGEPGAVI 31
            AI+GQDGS+WAQ                            GL+LGG KY VI GE GAVI
Sbjct  24   AIIGQDGSIWAQSASFPQFKPEEITAIMNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVI 83
Query  32   R 32
            R
Sbjct  84   R 84

Sequence Alignment: 7. Allergen Name: Sin a 4.0101 Sequence ID: ABU95412

 Score = 29.9 bits 86,  Expect = 0.009
 Identities = 27/32 84%, Positives = 28/32 87%, Gaps = 29/32 90%
Query  1    AILGQDGSVWAQ----------------------------GLHLGGAKY-VIAGEPGAVI 31
            AILGQDGSVWAQ                            GL +GG KY VI GEP AVI
Sbjct  24   AILGQDGSVWAQSANFPQLKPEEIKGINNDFAEPGTLAPTGLFIGGTKYMVIQGEPNAVI 83
Query  32   R 32
            R
Sbjct  84   R 84

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.