The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG
SQINPNNAASLPGKCGVSIPYKISTSINCSSIK
Sequence Info Allergen Name Length Opt Bits Score E Value
A0A510A9S3 Ara h 17.0101 93 627 130.4 7.8e-33
Q9M5X7 Mal d 3 115 433 92.7 2.2e-21
Q4PLT9 Fra a 3.0102 117 427 91.5 4.9e-21
Q9M5X6 Pyr c 3 115 420 90.2 1.3e-20
Q8VX12 Fra a 3.0101 117 418 89.8 1.7e-20
Q0Z8V0 Rub i 3.0101 117 418 89.8 1.7e-20
XP_019446786 Lup an 3.0101 116 408 87.8 6.4e-20
CAB96876 Pru p 3 91 406 87.2 7.5e-20
ABX75045 Ara h 9.0201 92 404 86.9 9.9e-20
P81651 Pru ar 3 91 402 86.5 1.3e-19
Q4PLU0 Fra a 3.0201 117 399 86.1 2.2e-19
P81402 Pru p 3 91 396 85.3 2.9e-19
Q4PLT6 Fra a 3.0202 117 396 85.5 3.3e-19
ADC80503 Pha v 3.0201 118 395 85.3 3.8e-19
P82534 Pru d 3 91 394 84.9 3.8e-19
Q9M5X8 Pru av 3 117 390 84.3 7.4e-19
P85894 Mor n 3.0101 91 381 82.4 2.2e-18
W0U0V5 Can s 3.0101 91 375 81.2 5e-18
ABX56711 Ara h 9.0101 116 374 81.2 6.4e-18
A0AT29 Len c 3.0101 118 374 81.2 6.5e-18
ADC80502 Pha v 3.0101 115 369 80.2 1.3e-17
A0A161AT60 Pis s 3.0101 120 369 80.2 1.3e-17
ABY21307 Pla or 3.0101 118 365 79.4 2.2e-17
CAL07989 Pla a 3.0101 118 361 78.7 3.8e-17
AAK28533 Cor a 8 115 355 77.5 8.3e-17
P19656-1 Zea m 14.0101 120 355 77.5 8.5e-17
AAL25839 Hev b 12 116 353 77.1 1.1e-16
P19656-2 Zea m 14.0102 128 352 77.0 1.3e-16
A0A059STC4 Pun g 1.0101 120 351 76.7 1.5e-16
ANC85027 Art si 3.0102 116 344 75.3 3.7e-16
ANC85020 Art ar 3.0102 116 344 75.3 3.7e-16
ACE07187 Art v 3.0202 116 344 75.3 3.7e-16
ANC85017 Art an 3.0101 117 342 74.9 4.9e-16
ANC85021 Art ca 3.0101 117 342 74.9 4.9e-16
ANC85018 Art an 3.0102 117 340 74.6 6.4e-16
ANC85023 Art gm 3.0102 117 340 74.6 6.4e-16
ANC85022 Art gm 3.0101 117 340 74.6 6.4e-16
EU564845 Art v 3.0201 114 334 73.4 1.4e-15
ANC85019 Art ar 3.0101 116 334 73.4 1.4e-15
ANC85024 Art la 3.0101 116 334 73.4 1.4e-15
ACN11576 Pru du 3.0101 123 334 73.4 1.5e-15
A0A059SSZ0 Pun g 1.0201 120 333 73.2 1.7e-15
QIN55516 Art ca 3.0102 117 332 73.0 1.9e-15
CAH69206 Tri tu 14.0101 115 322 71.0 7.2e-15
AAB42069 Lyc e 3 114 321 70.8 8.3e-15
P93224 Sola l 3.0101 114 321 70.8 8.3e-15
ANC85026 Art si 3.0101 116 321 70.8 8.3e-15
A0A059ST23 Pun g 1.0301 120 318 70.3 1.3e-14
ANC85025 Art la 3.0102 115 317 70.0 1.4e-14
EU564847 Art v 3.0301 117 317 70.1 1.4e-14
19846220 Tri a 14.0101 90 314 69.3 1.9e-14
ABU95411 Sin a 3.0101 92 314 69.3 1.9e-14
AAA32970 Hor v 1 117 314 69.5 2.2e-14
ACV04796 Api g 2 118 311 68.9 3.3e-14
CAA42832 Hor v 1 134 310 68.8 4e-14
P82007 Hel a 3.0101 116 300 66.7 1.4e-13
NP_001316123 Sola l 7.0101 115 291 65.0 4.8e-13
O04004 Amb a 6 118 223 51.7 4.8e-09
O04403 Par j 2 133 174 42.2 3.9e-06
P55958 Par j 2 133 167 40.9 1e-05
P43217 Par j 1 139 163 40.1 1.8e-05
O04404 Par j 1 176 163 40.3 2e-05
CAI94601 Par j 1.0103 139 161 39.7 2.3e-05
Q40905 Par j 1 138 160 39.5 2.6e-05
CAA54587 Par j 1.0101 133 152 37.9 7.6e-05
P0C088 Art v 3.0101 37 143 35.2 0.00014
10998016 Cas s 8 36 118 30.3 0.004
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ara h 17.0101 Sequence ID: A0A510A9S3

 Score = 130.4 bits 627,  Expect = 8e-33
 Identities = 93/93 100%, Positives = 93/93 100%, Gaps = 0/93 0%
Query  1    AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
            AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG
Sbjct  1    AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
Query  61   SQINPNNAASLPGKCGVSIPYKISTSINCSSIK 93
            SQINPNNAASLPGKCGVSIPYKISTSINCSSIK
Sbjct  61   SQINPNNAASLPGKCGVSIPYKISTSINCSSIK 93

Sequence Alignment: 2. Allergen Name: Mal d 3 Sequence ID: Q9M5X7

 Score = 92.7 bits 433,  Expect = 2e-21
 Identities = 59/92 64%, Positives = 74/92 80%, Gaps = 1/92 1%
Query  1    AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
            AI C  VT S+APC GY++SGG V   CC+GI+ ING A+TT+DRQ  CNCLK+ A S+ 
Sbjct  24   AITCGQVTSSLAPCIGYVRSGGAVPPACCNGIRTINGLARTTADRQTACNCLKNLAGSI- 82
Query  61   SQINPNNAASLPGKCGVSIPYKISTSINCSSIK 93
            S +NPNNAA LPGKCGV++PYKISTS NC+++K
Sbjct  83   SGVNPNNAAGLPGKCGVNVPYKISTSTNCATVK 115

Sequence Alignment: 3. Allergen Name: Fra a 3.0102 Sequence ID: Q4PLT9

 Score = 91.5 bits 427,  Expect = 5e-21
 Identities = 59/92 64%, Positives = 72/92 78%, Gaps = 1/92 1%
Query  1    AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
            AI C  V  +I+PC  Y+KSGG V  PCCSGI+N+NG AKTT+DRQA CNCLK AA  + 
Sbjct  26   AITCGQVASNISPCVTYVKSGGAVPAPCCSGIRNLNGMAKTTADRQATCNCLKQAAGGI- 84
Query  61   SQINPNNAASLPGKCGVSIPYKISTSINCSSIK 93
              +NPN AA LPGKCGVS+PYKIST+ NC+++K
Sbjct  85   KGLNPNLAAGLPGKCGVSVPYKISTTTNCAAVK 117

Sequence Alignment: 4. Allergen Name: Pyr c 3 Sequence ID: Q9M5X6

 Score = 90.2 bits 420,  Expect = 1e-20
 Identities = 58/92 63%, Positives = 73/92 79%, Gaps = 1/92 1%
Query  1    AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
            AI CS V+ ++APC  Y++SGG V   CC+GI+ ING AKTT DRQA CNCLK+ A S+ 
Sbjct  24   AITCSQVSANLAPCINYVRSGGAVPPACCNGIKTINGLAKTTPDRQAACNCLKNLAGSV- 82
Query  61   SQINPNNAASLPGKCGVSIPYKISTSINCSSIK 93
            S +NP NA SLPGKCGV++PYKISTS NC+++K
Sbjct  83   SGVNPGNAESLPGKCGVNVPYKISTSTNCATVK 115

Sequence Alignment: 5. Allergen Name: Fra a 3.0101 Sequence ID: Q8VX12

 Score = 89.8 bits 418,  Expect = 2e-20
 Identities = 58/92 63%, Positives = 72/92 78%, Gaps = 1/92 1%
Query  1    AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
            AI C  V  +I+PC+ Y+KSGG V   CCSGI+N+NG AKTT+DRQA CNCLK AA  + 
Sbjct  26   AITCGQVASNISPCLTYVKSGGAVPAACCSGIRNLNGMAKTTADRQAACNCLKQAAGGI- 84
Query  61   SQINPNNAASLPGKCGVSIPYKISTSINCSSIK 93
              +NPN AA LPGKCGVS+PYKIST+ NC+++K
Sbjct  85   KGLNPNLAAGLPGKCGVSVPYKISTTTNCAAVK 117

Sequence Alignment: 6. Allergen Name: Rub i 3.0101 Sequence ID: Q0Z8V0

 Score = 89.8 bits 418,  Expect = 2e-20
 Identities = 56/92 60%, Positives = 74/92 80%, Gaps = 1/92 1%
Query  1    AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
            AI C  VT+++APCF Y+K+GG V   CC+G++N+N  AKTT+DRQ  CNCLK+AA S+ 
Sbjct  26   AITCGQVTQNVAPCFNYVKNGGAVPAACCNGVRNLNSQAKTTADRQQTCNCLKNAAGSIP 85
Query  61   SQINPNNAASLPGKCGVSIPYKISTSINCSSIK 93
              +NP+ AA LPGKCGVS+PYKISTS NC+++K
Sbjct  86   G-LNPSLAAGLPGKCGVSVPYKISTSTNCATVK 117

Sequence Alignment: 7. Allergen Name: Lup an 3.0101 Sequence ID: XP_019446786

 Score = 87.8 bits 408,  Expect = 6e-20
 Identities = 59/92 64%, Positives = 72/92 78%, Gaps = 1/92 1%
Query  1    AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
            AI C  VT ++A C+ YL+SGG V  PCC+GI+NI   AKTT DR+  CNCLK+AAA+  
Sbjct  25   AITCGQVTANLAQCLNYLRSGGAVPAPCCNGIKNILNLAKTTPDRRTACNCLKAAAANTP 84
Query  61   SQINPNNAASLPGKCGVSIPYKISTSINCSSIK 93
              +NP+NA SLPGKCGV+IPYKISTS NC+SIK
Sbjct  85   G-LNPSNAGSLPGKCGVNIPYKISTSTNCASIK 116

Sequence Alignment: 8. Allergen Name: Pru p 3 Sequence ID: CAB96876

 Score = 87.2 bits 406,  Expect = 7e-20
 Identities = 55/91 60%, Positives = 70/91 76%, Gaps = 1/91 1%
Query  2    IQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGS 61
            I C  V+ S+APC  Y++ GG V   CC+GI+N+N  A+TT DRQA CNCLK  +AS+  
Sbjct  1    ITCGQVSSSLAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
Query  62   QINPNNAASLPGKCGVSIPYKISTSINCSSIK 93
             +NPNNAA+LPGKCGVSIPYKIS S NC+++K
Sbjct  61   -VNPNNAAALPGKCGVSIPYKISASTNCATVK 91

Sequence Alignment: 9. Allergen Name: Ara h 9.0201 Sequence ID: ABX75045

 Score = 86.9 bits 404,  Expect = 1e-19
 Identities = 56/91 61%, Positives = 70/91 76%, Gaps = 1/91 1%
Query  2    IQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGS 61
            + C  V  ++APC  +L  GG  SGPCCSG++ + G AKTT+DRQA CNCLK+AA SL  
Sbjct  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
Query  62   QINPNNAASLPGKCGVSIPYKISTSINCSSIK 93
             +N  NAA+LPG+CGVSIPYKISTS NC++IK
Sbjct  61   -LNQGNAAALPGRCGVSIPYKISTSTNCATIK 91

Sequence Alignment: 10. Allergen Name: Pru ar 3 Sequence ID: P81651

 Score = 86.5 bits 402,  Expect = 1e-19
 Identities = 53/91 58%, Positives = 70/91 76%, Gaps = 1/91 1%
Query  2    IQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGS 61
            I C  V+ S+APC GY++ GG V   CC+GI+N+N  A+TT DR+  CNCLK  + S+ S
Sbjct  1    ITCGQVSSSLAPCIGYVRGGGAVPPACCNGIRNVNNLARTTPDRRTACNCLKQLSGSI-S 59
Query  62   QINPNNAASLPGKCGVSIPYKISTSINCSSIK 93
             +NPNNAA+LPGKCGV+IPYKIS S NC+++K
Sbjct  60   GVNPNNAAALPGKCGVNIPYKISASTNCATVK 91

Sequence Alignment: 11. Allergen Name: Fra a 3.0201 Sequence ID: Q4PLU0

 Score = 86.1 bits 399,  Expect = 2e-19
 Identities = 55/92 59%, Positives = 71/92 77%, Gaps = 1/92 1%
Query  1    AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
            AI C  V  SI+PC  Y+KSGG V   CC+GI+++N  AKTT+DRQA CNCLK A+ ++ 
Sbjct  26   AITCGQVASSISPCVNYVKSGGAVPAACCNGIRSLNSAAKTTADRQATCNCLKQASGAI- 84
Query  61   SQINPNNAASLPGKCGVSIPYKISTSINCSSIK 93
              +NP+ AA LPGKCGVS+PYKISTS NC+++K
Sbjct  85   KGLNPSLAAGLPGKCGVSVPYKISTSTNCAAVK 117

Sequence Alignment: 12. Allergen Name: Pru p 3 Sequence ID: P81402

 Score = 85.3 bits 396,  Expect = 3e-19
 Identities = 53/91 58%, Positives = 69/91 75%, Gaps = 1/91 1%
Query  2    IQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGS 61
            I C  V+ ++APC  Y++ GG V   CC+GI+N+N  A+TT DRQA CNCLK  +AS+  
Sbjct  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
Query  62   QINPNNAASLPGKCGVSIPYKISTSINCSSIK 93
             +NPNNAA+LPGKCGV IPYKIS S NC+++K
Sbjct  61   -VNPNNAAALPGKCGVHIPYKISASTNCATVK 91

Sequence Alignment: 13. Allergen Name: Fra a 3.0202 Sequence ID: Q4PLT6

 Score = 85.5 bits 396,  Expect = 3e-19
 Identities = 54/92 58%, Positives = 70/92 76%, Gaps = 1/92 1%
Query  1    AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
            AI C  V  SI+PC  Y+KSGG V   CC+GI+++N  AKTT+DRQ  CNCLK A+ ++ 
Sbjct  26   AITCGQVASSISPCVNYVKSGGAVPAACCNGIRSLNSAAKTTADRQTTCNCLKQASGAI- 84
Query  61   SQINPNNAASLPGKCGVSIPYKISTSINCSSIK 93
              +NPN AA LPGKCGV++PYKISTS NC+++K
Sbjct  85   KGLNPNLAAGLPGKCGVNVPYKISTSTNCAAVK 117

Sequence Alignment: 14. Allergen Name: Pha v 3.0201 Sequence ID: ADC80503

 Score = 85.3 bits 395,  Expect = 4e-19
 Identities = 58/92 63%, Positives = 68/92 73%, Gaps = 1/92 1%
Query  1    AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
            AI C  VT S+A C  +L  GG V   CCSG++++N  AKTT DRQAVCNCLKSAA ++ 
Sbjct  26   AISCGQVTSSLASCIPFLTKGGPVPASCCSGVRSLNAAAKTTPDRQAVCNCLKSAAGAIP 85
Query  61   SQINPNNAASLPGKCGVSIPYKISTSINCSSIK 93
               N NNA  LPGKCGVSIPYKISTS NC++IK
Sbjct  86   G-FNANNAGILPGKCGVSIPYKISTSTNCATIK 117

Sequence Alignment: 15. Allergen Name: Pru d 3 Sequence ID: P82534

 Score = 84.9 bits 394,  Expect = 4e-19
 Identities = 51/91 56%, Positives = 70/91 76%, Gaps = 1/91 1%
Query  2    IQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGS 61
            I C  V+ ++APC  Y+K GG V   CC+GI+N+N  A+TT+DR+A CNCLK  + S+  
Sbjct  1    ITCGQVSSNLAPCINYVKGGGAVPPACCNGIRNVNNLARTTADRRAACNCLKQLSGSIPG 60
Query  62   QINPNNAASLPGKCGVSIPYKISTSINCSSIK 93
             +NPNNAA+LPGKCGV++PYKIS S NC+++K
Sbjct  61   -VNPNNAAALPGKCGVNVPYKISASTNCATVK 91

Sequence Alignment: 16. Allergen Name: Pru av 3 Sequence ID: Q9M5X8

 Score = 84.3 bits 390,  Expect = 7e-19
 Identities = 52/92 56%, Positives = 70/92 76%, Gaps = 1/92 1%
Query  1    AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
            A+ C  V+ ++APC  Y++ GG V   CC+GI+NIN  AKTT+DRQ  CNCLK  +AS+ 
Sbjct  26   ALTCGQVSSNLAPCIAYVRGGGAVPPACCNGIRNINNLAKTTADRQTACNCLKQLSASVP 85
Query  61   SQINPNNAASLPGKCGVSIPYKISTSINCSSIK 93
              +N NNAA+LPGKCGV++PYKIS S NC+++K
Sbjct  86   G-VNANNAAALPGKCGVNVPYKISPSTNCATVK 117

Sequence Alignment: 17. Allergen Name: Mor n 3.0101 Sequence ID: P85894

 Score = 82.4 bits 381,  Expect = 2e-18
 Identities = 53/91 58%, Positives = 68/91 74%, Gaps = 1/91 1%
Query  2    IQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGS 61
            I C  V+ S+APC  YL++GG V   CC+G++++N  AKTT+DRQA CNCLKSA  S+  
Sbjct  1    ITCGQVSSSLAPCINYLRAGGVVPANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKG 60
Query  62   QINPNNAASLPGKCGVSIPYKISTSINCSSIK 93
             +N N AA LPGKCGVS+PYKIS S +C S+K
Sbjct  61   -LNLNLAAGLPGKCGVSVPYKISPSTDCKSVK 91

Sequence Alignment: 18. Allergen Name: Can s 3.0101 Sequence ID: W0U0V5

 Score = 81.2 bits 375,  Expect = 5e-18
 Identities = 54/91 59%, Positives = 68/91 74%, Gaps = 1/91 1%
Query  2    IQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGS 61
            I C  V  S+APC+ YLK GG V   CC+ I++++G AKT +DRQA C CLKSAA+S+  
Sbjct  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
Query  62   QINPNNAASLPGKCGVSIPYKISTSINCSSIK 93
             +N N A+ LPGKCGVSIPYKIS S +CSS+K
Sbjct  61   -VNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91

Sequence Alignment: 19. Allergen Name: Ara h 9.0101 Sequence ID: ABX56711

 Score = 81.2 bits 374,  Expect = 6e-18
 Identities = 53/92 57%, Positives = 67/92 72%, Gaps = 1/92 1%
Query  1    AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
            AI C  V  ++APC  +L  GG     CCSG++ + G  +TT+DRQA CNCLK+AA SL 
Sbjct  24   AISCGQVNSALAPCIPFLTKGGAPPPACCSGVRGLLGALRTTADRQAACNCLKAAAGSL- 82
Query  61   SQINPNNAASLPGKCGVSIPYKISTSINCSSIK 93
              +N  NAA+LPG+CGVSIPYKISTS NC++IK
Sbjct  83   RGLNQGNAAALPGRCGVSIPYKISTSTNCATIK 115

Sequence Alignment: 20. Allergen Name: Len c 3.0101 Sequence ID: A0AT29

 Score = 81.2 bits 374,  Expect = 6e-18
 Identities = 52/92 56%, Positives = 68/92 73%, Gaps = 1/92 1%
Query  1    AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
            AI C  VT  ++PC+ YL  G   S  CC G++ +   A TT DRQA CNCLKSAA S+ 
Sbjct  26   AISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSI- 84
Query  61   SQINPNNAASLPGKCGVSIPYKISTSINCSSIK 93
            +++N NNAA+LPGKCGV+IPYKIST+ NC+++K
Sbjct  85   TKLNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117

Sequence Alignment: 21. Allergen Name: Pha v 3.0101 Sequence ID: ADC80502

 Score = 80.2 bits 369,  Expect = 1e-17
 Identities = 48/90 53%, Positives = 70/90 77%, Gaps = 1/90 1%
Query  2    IQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGS 61
            + C  V  ++ PC  +L++GG V   CC+G++NI  +A++T+DR+ +CNCLK+AA ++  
Sbjct  25   MTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMNSARSTADRRGICNCLKTAAGAV-R 83
Query  62   QINPNNAASLPGKCGVSIPYKISTSINCSSI 92
             +NPNNA +LPGKCGV+IPYKISTS NC+SI
Sbjct  84   GLNPNNAQALPGKCGVNIPYKISTSTNCASI 114

Sequence Alignment: 22. Allergen Name: Pis s 3.0101 Sequence ID: A0A161AT60

 Score = 80.2 bits 369,  Expect = 1e-17
 Identities = 52/92 56%, Positives = 69/92 75%, Gaps = 3/92 3%
Query  1    AIQCSFVTKSIAPCFGYLKSGGTVSGP--CCSGIQNINGTAKTTSDRQAVCNCLKSAAAS 58
            A+ C  V+  +APC  YL++    S P  CC+G++ +   A TT DRQA CNCLKSAA S
Sbjct  26   ALSCGTVSADMAPCVTYLQAPNNASPPPPCCAGVKKLLAAATTTPDRQAACNCLKSAAGS 85
Query  59   LGSQINPNNAASLPGKCGVSIPYKISTSINCSSIK 93
            +  ++N NNAA+LPGKCGVSIPYKISTS NC++++
Sbjct  86   I-PKLNTNNAAALPGKCGVSIPYKISTSTNCNTVR 119

Sequence Alignment: 23. Allergen Name: Pla or 3.0101 Sequence ID: ABY21307

 Score = 79.4 bits 365,  Expect = 2e-17
 Identities = 51/92 55%, Positives = 67/92 72%, Gaps = 1/92 1%
Query  1    AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
            AI C  V   + PC+ YL+SGG V+  CC+G++ +N  AKTT DRQA C CLK+A+ S+ 
Sbjct  27   AITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALNNDAKTTPDRQAACGCLKTASTSI- 85
Query  61   SQINPNNAASLPGKCGVSIPYKISTSINCSSIK 93
            S I   NAASL GKCGV++PYKIS +I+CS +K
Sbjct  86   SGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118

Sequence Alignment: 24. Allergen Name: Pla a 3.0101 Sequence ID: CAL07989

 Score = 78.7 bits 361,  Expect = 4e-17
 Identities = 50/92 54%, Positives = 67/92 72%, Gaps = 1/92 1%
Query  1    AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
            AI C  V   + PC+ +L+SGG V+  CC+G++ +N  AKTT DRQA C CLK+A+ S+ 
Sbjct  27   AITCGTVVTRLTPCLTFLRSGGAVAPACCNGVKALNNDAKTTPDRQAACGCLKTASTSI- 85
Query  61   SQINPNNAASLPGKCGVSIPYKISTSINCSSIK 93
            S I   NAASL GKCGV++PYKIS +I+CS +K
Sbjct  86   SGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118

Sequence Alignment: 25. Allergen Name: Cor a 8 Sequence ID: AAK28533

 Score = 77.5 bits 355,  Expect = 8e-17
 Identities = 46/92 50%, Positives = 65/92 70%, Gaps = 1/92 1%
Query  1    AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
            ++ C  +  ++ PC  YLK+GG +   CC G++ +N  ++TTSDRQ+ CNCLK  A  + 
Sbjct  24   SLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVNDASRTTSDRQSACNCLKDTAKGIA 83
Query  61   SQINPNNAASLPGKCGVSIPYKISTSINCSSIK 93
              +NPN AA LPGKCGV+IPYKIS S NC+++K
Sbjct  84   G-LNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115

Sequence Alignment: 26. Allergen Name: Zea m 14.0101 Sequence ID: P19656-1

 Score = 77.5 bits 355,  Expect = 9e-17
 Identities = 53/89 59%, Positives = 68/89 76%, Gaps = 6/89 6%
Query  1    AIQCSFVTKSIAPCFGYLKSGGTVSGP---CCSGIQNINGTAKTTSDRQAVCNCLKSAAA 57
            AI C  V  +IAPC  Y +  G  SGP   CCSG++++N  A+TT+DR+A CNCLK+AAA
Sbjct  28   AISCGQVASAIAPCISYARGQG--SGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAA 85
Query  58   SLGSQINPNNAASLPGKCGVSIPYKISTSINCSSI 92
             + S +N  NAAS+P KCGVSIPY ISTS +CS +
Sbjct  86   GV-SGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119

Sequence Alignment: 27. Allergen Name: Hev b 12 Sequence ID: AAL25839

 Score = 77.1 bits 353,  Expect = 1e-16
 Identities = 50/92 54%, Positives = 65/92 70%, Gaps = 2/92 2%
Query  1    AIQCSFVTKSIAPCFGYLKSGG-TVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASL 59
            AI C  V  ++ PC+ YLK+ G T    CC+G++ IN  AKTT+DR+  C CLKSAA S+
Sbjct  24   AITCGQVQSALVPCLSYLKTTGPTPPATCCNGVRTINNAAKTTADRRTACQCLKSAAGSV 83
Query  60   GSQINPNNAASLPGKCGVSIPYKISTSINCSSIK 93
               +NP   A LPGKCGV+IPYKIS S NC+++K
Sbjct  84   -KGLNPTTVAGLPGKCGVNIPYKISLSTNCATVK 116

Sequence Alignment: 28. Allergen Name: Zea m 14.0102 Sequence ID: P19656-2

 Score = 77.0 bits 352,  Expect = 1e-16
 Identities = 53/87 60%, Positives = 67/87 77%, Gaps = 6/87 6%
Query  1    AIQCSFVTKSIAPCFGYLKSGGTVSGP---CCSGIQNINGTAKTTSDRQAVCNCLKSAAA 57
            AI C  V  +IAPC  Y +  G  SGP   CCSG++++N  A+TT+DR+A CNCLK+AAA
Sbjct  28   AISCGQVASAIAPCISYARGQG--SGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAA 85
Query  58   SLGSQINPNNAASLPGKCGVSIPYKISTSINCS 90
             + S +N  NAAS+P KCGVSIPY ISTS +CS
Sbjct  86   GV-SGLNAGNAASIPSKCGVSIPYTISTSTDCS 117

Sequence Alignment: 29. Allergen Name: Pun g 1.0101 Sequence ID: A0A059STC4

 Score = 76.7 bits 351,  Expect = 1e-16
 Identities = 52/92 56%, Positives = 65/92 70%, Gaps = 2/92 2%
Query  1    AIQCSFVTKSIAPCFGYLKS-GGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASL 59
            A+ C  V  S+APC  Y +S GG V   CCSGI+ ++G A+TT DRQA C CLKSA+ S+
Sbjct  28   AVTCGQVASSLAPCIPYARSAGGAVPPACCSGIKTLDGMARTTPDRQATCKCLKSASTSI 87
Query  60   GSQINPNNAASLPGKCGVSIPYKISTSINCSSIK 93
             S IN    ASLP KCGV+IPYKIS S +C+ +K
Sbjct  88   -SGINYGLVASLPAKCGVNIPYKISPSTDCARVK 120

Sequence Alignment: 30. Allergen Name: Art si 3.0102 Sequence ID: ANC85027

 Score = 75.3 bits 344,  Expect = 4e-16
 Identities = 47/92 51%, Positives = 62/92 67%, Gaps = 1/92 1%
Query  1    AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
            A+ CS V+  I PC+ YLK GG V   CC+G++ +N  AKTT DRQ  CNCLK++  S  
Sbjct  25   ALTCSDVSNKITPCLNYLKQGGEVPADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKS-N 83
Query  61   SQINPNNAASLPGKCGVSIPYKISTSINCSSIK 93
              +  + AASLP KCGV+IPYKIS   +C+ +K
Sbjct  84   KDLKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 31. Allergen Name: Art ar 3.0102 Sequence ID: ANC85020

 Score = 75.3 bits 344,  Expect = 4e-16
 Identities = 47/92 51%, Positives = 62/92 67%, Gaps = 1/92 1%
Query  1    AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
            A+ CS V+  I PC+ YLK GG V   CC+G++ +N  AKTT DRQ  CNCLK++  S  
Sbjct  25   ALTCSDVSNKITPCLNYLKQGGEVPADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKS-N 83
Query  61   SQINPNNAASLPGKCGVSIPYKISTSINCSSIK 93
              +  + AASLP KCGV+IPYKIS   +C+ +K
Sbjct  84   KDLKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 32. Allergen Name: Art v 3.0202 Sequence ID: ACE07187

 Score = 75.3 bits 344,  Expect = 4e-16
 Identities = 47/92 51%, Positives = 62/92 67%, Gaps = 1/92 1%
Query  1    AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
            A+ CS V+  I PC+ YLK GG V   CC+G++ +N  AKTT DRQ  CNCLK++  S  
Sbjct  25   ALTCSDVSNKITPCLNYLKQGGEVPADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKS-N 83
Query  61   SQINPNNAASLPGKCGVSIPYKISTSINCSSIK 93
              +  + AASLP KCGV+IPYKIS   +C+ +K
Sbjct  84   KDLKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 33. Allergen Name: Art an 3.0101 Sequence ID: ANC85017

 Score = 74.9 bits 342,  Expect = 5e-16
 Identities = 47/92 51%, Positives = 60/92 65%, Gaps = 1/92 1%
Query  1    AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
            A+ CS V+  I PC  +LK GG VS  CC+G++ +N  AKTT DRQA CNCLK+   S  
Sbjct  26   ALTCSDVSNKILPCTSFLKQGGEVSADCCTGVKGLNDAAKTTPDRQAACNCLKTTFKS-N 84
Query  61   SQINPNNAASLPGKCGVSIPYKISTSINCSSIK 93
                 +NA  LP KCGV+IPYKIS   +C+ +K
Sbjct  85   KDFKSDNAVVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 34. Allergen Name: Art ca 3.0101 Sequence ID: ANC85021

 Score = 74.9 bits 342,  Expect = 5e-16
 Identities = 47/92 51%, Positives = 60/92 65%, Gaps = 1/92 1%
Query  1    AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
            A+ CS V+  I PC  +LK GG VS  CC+G++ +N  AKTT DRQA CNCLK+   S  
Sbjct  26   ALTCSDVSNKILPCTSFLKQGGEVSADCCTGVKGLNDAAKTTPDRQAACNCLKTTFKS-N 84
Query  61   SQINPNNAASLPGKCGVSIPYKISTSINCSSIK 93
                 +NA  LP KCGV+IPYKIS   +C+ +K
Sbjct  85   KDFKSDNAVVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 35. Allergen Name: Art an 3.0102 Sequence ID: ANC85018

 Score = 74.6 bits 340,  Expect = 6e-16
 Identities = 47/92 51%, Positives = 63/92 68%, Gaps = 1/92 1%
Query  1    AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
            A+ C+ VTK I+PC  +L+ GG V   CC+G++ +N  AKTT DRQA CNCLK++  S  
Sbjct  26   ALTCNDVTKKISPCTSFLEKGGEVPVDCCTGVKGLNDAAKTTPDRQAACNCLKTSFKS-S 84
Query  61   SQINPNNAASLPGKCGVSIPYKISTSINCSSIK 93
            +     NAA LP KCGV+IPYKIS   +C+ +K
Sbjct  85   NNFKEENAAVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 36. Allergen Name: Art gm 3.0102 Sequence ID: ANC85023

 Score = 74.6 bits 340,  Expect = 6e-16
 Identities = 45/92 48%, Positives = 62/92 67%, Gaps = 1/92 1%
Query  1    AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
            A+ CS V+  I+PC+ +LK GG V   CC+G++ +N  AKTT DRQ  CNCLK++  S  
Sbjct  26   ALTCSDVSNKISPCLSFLKQGGEVPADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKS-N 84
Query  61   SQINPNNAASLPGKCGVSIPYKISTSINCSSIK 93
              +  +NA  LP KCGV+IPYKIS   +C+ +K
Sbjct  85   KDLKSDNAVVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 37. Allergen Name: Art gm 3.0101 Sequence ID: ANC85022

 Score = 74.6 bits 340,  Expect = 6e-16
 Identities = 46/92 50%, Positives = 61/92 66%, Gaps = 1/92 1%
Query  1    AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
            A+ CS V+  I+PC  +LK GG V   CC+G++ +N  AKTT DRQ  CNCLK++  S  
Sbjct  26   ALTCSDVSNKISPCTSFLKQGGEVPADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKS-N 84
Query  61   SQINPNNAASLPGKCGVSIPYKISTSINCSSIK 93
                 +NAA LP KCGV+IPYKIS   +C+ +K
Sbjct  85   KDFKSDNAAVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 38. Allergen Name: Art v 3.0201 Sequence ID: EU564845

 Score = 73.4 bits 334,  Expect = 1e-15
 Identities = 46/92 50%, Positives = 61/92 66%, Gaps = 1/92 1%
Query  1    AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
            A++CS V+  I+ C+ YLK GG V   CC+G++ +N  AKTT DRQ  CNCLK+   S  
Sbjct  23   ALKCSDVSNKISACLSYLKQGGEVPADCCTGVKGLNDAAKTTPDRQTACNCLKTTFKS-N 81
Query  61   SQINPNNAASLPGKCGVSIPYKISTSINCSSIK 93
                 + AASLP KCGV+IPYKIS   +C+ +K
Sbjct  82   KDFKSDFAASLPSKCGVNIPYKISLETDCNKVK 114

Sequence Alignment: 39. Allergen Name: Art ar 3.0101 Sequence ID: ANC85019

 Score = 73.4 bits 334,  Expect = 1e-15
 Identities = 46/92 50%, Positives = 61/92 66%, Gaps = 1/92 1%
Query  1    AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
            A++CS V+  I+ C+ YLK GG V   CC+G++ +N  AKTT DRQ  CNCLK+   S  
Sbjct  25   ALKCSDVSNKISACLSYLKQGGEVPADCCTGVKGLNDAAKTTPDRQTACNCLKTTFKS-N 83
Query  61   SQINPNNAASLPGKCGVSIPYKISTSINCSSIK 93
                 + AASLP KCGV+IPYKIS   +C+ +K
Sbjct  84   KDFKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 40. Allergen Name: Art la 3.0101 Sequence ID: ANC85024

 Score = 73.4 bits 334,  Expect = 1e-15
 Identities = 46/92 50%, Positives = 61/92 66%, Gaps = 1/92 1%
Query  1    AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
            A++CS V+  I+ C+ YLK GG V   CC+G++ +N  AKTT DRQ  CNCLK+   S  
Sbjct  25   ALKCSDVSNKISACLSYLKQGGEVPADCCTGVKGLNDAAKTTPDRQTACNCLKTTFKS-N 83
Query  61   SQINPNNAASLPGKCGVSIPYKISTSINCSSIK 93
                 + AASLP KCGV+IPYKIS   +C+ +K
Sbjct  84   KDFKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 41. Allergen Name: Pru du 3.0101 Sequence ID: ACN11576

 Score = 73.4 bits 334,  Expect = 1e-15
 Identities = 43/93 46%, Positives = 64/93 68%, Gaps = 1/93 1%
Query  1    AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
            A+ C  V  ++ PC  Y+ +GG ++  CC+G++++   A+TT+DRQ++CNCLK A   + 
Sbjct  30   AVSCGQVVNNLTPCINYVANGGALNPSCCTGVRSLYSLAQTTADRQSICNCLKQAVNGIP 89
Query  61   -SQINPNNAASLPGKCGVSIPYKISTSINCSSIK 93
             +  N   AA LPGKCGV+IPYKIS S +C +IK
Sbjct  90   YTNANAGLAAGLPGKCGVNIPYKISPSTDCKTIK 123

Sequence Alignment: 42. Allergen Name: Pun g 1.0201 Sequence ID: A0A059SSZ0

 Score = 73.2 bits 333,  Expect = 2e-15
 Identities = 50/90 55%, Positives = 63/90 70%, Gaps = 6/90 6%
Query  1    AIQCSFVTKSIAPCFGYLKSGGTVSGP---CCSGIQNINGTAKTTSDRQAVCNCLKSAAA 57
            A+ C  VT S+ PC  Y +  G V+ P   CCSG++++N  AKTT DRQ  CNCLK  A 
Sbjct  28   AVTCGQVTSSLTPCIPYAR--GVVAAPSAACCSGVRSLNNAAKTTPDRQTACNCLKVIAR 85
Query  58   SLGSQINPNNAASLPGKCGVSIPYKISTSINCSSIK 93
            S+ + IN     +LPGKCGVSIPYKIS S +CS +K
Sbjct  86   SI-TGINYGRVGALPGKCGVSIPYKISPSTDCSRVK 120

Sequence Alignment: 43. Allergen Name: Art ca 3.0102 Sequence ID: QIN55516

 Score = 73.0 bits 332,  Expect = 2e-15
 Identities = 44/92 47%, Positives = 60/92 65%, Gaps = 1/92 1%
Query  1    AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
            A+ CS V+  I PC+ +LK GG V   CC+G++ +N  AKT  DRQ  CNCLK+   S  
Sbjct  26   ALTCSDVSNKITPCLSFLKQGGEVPADCCTGVKGLNDAAKTGPDRQKACNCLKTTFKS-N 84
Query  61   SQINPNNAASLPGKCGVSIPYKISTSINCSSIK 93
              +  +NA  LP KCGV+IPYKIS   +C+++K
Sbjct  85   KDLKSDNAVVLPSKCGVNIPYKISLETDCNTVK 117

Sequence Alignment: 44. Allergen Name: Tri tu 14.0101 Sequence ID: CAH69206

 Score = 71.0 bits 322,  Expect = 7e-15
 Identities = 42/89 47%, Positives = 66/89 74%, Gaps = 5/89 5%
Query  1    AIQCSFVTKSIAPCFGYLK-SGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASL 59
            A+ C  V+ +++PC  Y + +G + S  CCSG++++  +A++T+D+QA C C+KSAAA L
Sbjct  26   AVSCGQVSSALSPCISYARGNGASPSAACCSGVRSLASSARSTADKQAACKCIKSAAAGL 85
Query  60   GSQINPNNAASLPGKCGVSIPYKISTSINCSSIK 93
                N   AA +P KCGVS+PY IS+S++CS I+
Sbjct  86   ----NAGKAAGIPTKCGVSVPYAISSSVDCSKIR 115

Sequence Alignment: 45. Allergen Name: Lyc e 3 Sequence ID: AAB42069

 Score = 70.8 bits 321,  Expect = 8e-15
 Identities = 45/91 49%, Positives = 62/91 68%, Gaps = 2/91 2%
Query  1    AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
            ++ C  VT  +APC+ YL+  G + G CC G++ + G AKT  DR+  C CLKSAA S+ 
Sbjct  24   SLSCGEVTSGLAPCLPYLEGRGPLGG-CCGGVKGLLGAAKTPEDRKTACTCLKSAANSI- 81
Query  61   SQINPNNAASLPGKCGVSIPYKISTSINCSSIK 93
              I+   AA LPG CGV+IPYKIS S +CS+++
Sbjct  82   KGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114

Sequence Alignment: 46. Allergen Name: Sola l 3.0101 Sequence ID: P93224

 Score = 70.8 bits 321,  Expect = 8e-15
 Identities = 45/91 49%, Positives = 62/91 68%, Gaps = 2/91 2%
Query  1    AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
            ++ C  VT  +APC+ YL+  G + G CC G++ + G AKT  DR+  C CLKSAA S+ 
Sbjct  24   SLSCGEVTSGLAPCLPYLEGRGPLGG-CCGGVKGLLGAAKTPEDRKTACTCLKSAANSI- 81
Query  61   SQINPNNAASLPGKCGVSIPYKISTSINCSSIK 93
              I+   AA LPG CGV+IPYKIS S +CS+++
Sbjct  82   KGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114

Sequence Alignment: 47. Allergen Name: Art si 3.0101 Sequence ID: ANC85026

 Score = 70.8 bits 321,  Expect = 8e-15
 Identities = 42/92 45%, Positives = 60/92 65%, Gaps = 1/92 1%
Query  1    AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
            A+ CS V+  I+PC+ YLK GG V   CC+G++ +N  AKTT DRQ  C CLK++  +  
Sbjct  25   ALTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGLNDAAKTTPDRQTACTCLKNSFKT-N 83
Query  61   SQINPNNAASLPGKCGVSIPYKISTSINCSSIK 93
              +  + A  LP KCGV+IPYK+S   +C+ +K
Sbjct  84   KDLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116

Sequence Alignment: 48. Allergen Name: Pun g 1.0301 Sequence ID: A0A059ST23

 Score = 70.3 bits 318,  Expect = 1e-14
 Identities = 50/89 56%, Positives = 63/89 70%, Gaps = 7/89 7%
Query  2    IQCSFVTKSIAPCFGYLKSGGTVSGP----CCSGIQNINGTAKTTSDRQAVCNCLKSAAA 57
            I C  V+ S+A C  Y +  G  +GP    CC+GI+++N  AKTT DRQA C CLKS A+
Sbjct  28   ITCGQVSSSLAGCIQYARGNG--AGPVPQACCNGIRSLNSAAKTTPDRQAACRCLKSLAS 85
Query  58   SLGSQINPNNAASLPGKCGVSIPYKISTSINCSSIK 93
            S+ S IN    A  PGKCGVSIPYKI+ S NC ++K
Sbjct  86   SI-SGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120

Sequence Alignment: 49. Allergen Name: Art la 3.0102 Sequence ID: ANC85025

 Score = 70.0 bits 317,  Expect = 1e-14
 Identities = 41/92 44%, Positives = 60/92 65%, Gaps = 1/92 1%
Query  1    AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
            A+ CS V+  I+PC+ YLK GG V   CC+G++ +N   KTT DRQ  CNCLK++  S  
Sbjct  24   ALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLNDATKTTPDRQTACNCLKASFKS-N 82
Query  61   SQINPNNAASLPGKCGVSIPYKISTSINCSSIK 93
              +  + A  LP KCG+++PYK+S   +C+ +K
Sbjct  83   KDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 115

Sequence Alignment: 50. Allergen Name: Art v 3.0301 Sequence ID: EU564847

 Score = 70.1 bits 317,  Expect = 1e-14
 Identities = 41/92 44%, Positives = 60/92 65%, Gaps = 1/92 1%
Query  1    AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
            A+ CS V+  I+PC+ YLK GG V   CC+G++ +N   KTT DRQ  CNCLK++  S  
Sbjct  26   ALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLNDATKTTPDRQTACNCLKASFKS-N 84
Query  61   SQINPNNAASLPGKCGVSIPYKISTSINCSSIK 93
              +  + A  LP KCG+++PYK+S   +C+ +K
Sbjct  85   KDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117

Sequence Alignment: 51. Allergen Name: Tri a 14.0101 Sequence ID: 19846220

 Score = 69.3 bits 314,  Expect = 2e-14
 Identities = 40/90 44%, Positives = 60/90 66%, Gaps = 1/90 1%
Query  2    IQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGS 61
            I C  V   + PC+ Y++ G   SG CC G++N++  A++ SDRQ+ CNCLK  A  +  
Sbjct  1    IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGI-H 59
Query  62   QINPNNAASLPGKCGVSIPYKISTSINCSSI 92
             +N +NA S+P KCGV++PY IS +I+CS +
Sbjct  60   NLNEDNARSIPPKCGVNLPYTISLNIDCSRV 90

Sequence Alignment: 52. Allergen Name: Sin a 3.0101 Sequence ID: ABU95411

 Score = 69.3 bits 314,  Expect = 2e-14
 Identities = 44/92 47%, Positives = 59/92 64%, Gaps = 1/92 1%
Query  1    AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
            A+ C  V  ++A C GYL     +   CC+G+ N+N  A+TT DRQ  C CL  AA S+ 
Sbjct  1    ALSCGTVNSNLAACIGYLTQNAPLPKGCCTGVTNLNNMARTTPDRQQACRCLVGAANSFP 60
Query  61   SQINPNNAASLPGKCGVSIPYKISTSINCSSIK 93
            S +N   AA+LP  CGV+IPYKIS S NC+S++
Sbjct  61   S-LNAARAAALPKACGVNIPYKISKSTNCNSVR 92

Sequence Alignment: 53. Allergen Name: Hor v 1 Sequence ID: AAA32970

 Score = 69.5 bits 314,  Expect = 2e-14
 Identities = 41/91 45%, Positives = 61/91 67%, Gaps = 1/91 1%
Query  1    AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
            A+ C  V   + PC+ Y++ G   SG CC+G+++++  A+++ DRQ VCNCLK  A  + 
Sbjct  26   ALNCGQVDSKMKPCLTYVQGGPGPSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGI- 84
Query  61   SQINPNNAASLPGKCGVSIPYKISTSINCSSI 92
              +N NNAAS+P KC V++PY IS  I+CS I
Sbjct  85   HNLNLNNAASIPSKCNVNVPYTISPDIDCSRI 116

Sequence Alignment: 54. Allergen Name: Api g 2 Sequence ID: ACV04796

 Score = 68.9 bits 311,  Expect = 3e-14
 Identities = 43/90 47%, Positives = 58/90 64%, Gaps = 1/90 1%
Query  2    IQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGS 61
            + C  VT  +  C+GYLK GG  S  CC G++ +N  AKT +DR+  C CLK+ A S+  
Sbjct  28   LTCGQVTGKLGGCLGYLKGGGYPSPACCGGVKGLNSLAKTPADRKQACACLKTLAGSV-K 86
Query  62   QINPNNAASLPGKCGVSIPYKISTSINCSSI 92
             IN   A++LPGKCG+ IPY IS S +CS +
Sbjct  87   GINYGAASALPGKCGIRIPYPISPSTDCSRV 117

Sequence Alignment: 55. Allergen Name: Hor v 1 Sequence ID: CAA42832

 Score = 68.8 bits 310,  Expect = 4e-14
 Identities = 40/89 44%, Positives = 61/89 68%, Gaps = 1/89 1%
Query  1    AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
            A+ C  V   + PC+ Y++ G   SG CC+G+++++  A+++ DRQ VCNCLK  A  + 
Sbjct  26   ALNCGQVDSKMKPCLTYVQGGPGPSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIH 85
Query  61   SQINPNNAASLPGKCGVSIPYKISTSINCS 90
            + +N NNAAS+P KC V++PY IS  I+CS
Sbjct  86   N-LNLNNAASIPSKCNVNVPYTISPDIDCS 114

Sequence Alignment: 56. Allergen Name: Hel a 3.0101 Sequence ID: P82007

 Score = 66.7 bits 300,  Expect = 1e-13
 Identities = 39/90 43%, Positives = 62/90 68%, Gaps = 2/90 2%
Query  1    AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
            AI C+ VT ++ PC+ YL+SGG  +  CC+G + + G  +T +DR+  C C K+AA  L 
Sbjct  26   AITCNDVTGNLTPCLPYLRSGGKPTPACCAGAKKLLGATRTQADRRTACKCAKTAAPQL- 84
Query  61   SQINPNNAASLPGKCGVSIPYKISTSINCSSI 92
             ++ P+ A+SLPGKCG+S    I+ ++NC++I
Sbjct  85   -KVRPDMASSLPGKCGISTSIPINPNVNCNTI 115

Sequence Alignment: 57. Allergen Name: Sola l 7.0101 Sequence ID: NP_001316123

 Score = 65.0 bits 291,  Expect = 5e-13
 Identities = 38/91 41%, Positives = 57/91 62%, Gaps = 1/91 1%
Query  1    AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
            AI C  V  ++APC  +L  GG     CCSG++ +NG  +++ DR+  CNC+K AAA+  
Sbjct  24   AITCGQVDANLAPCVPFLTQGGEPGAACCSGVRTLNGNTQSSDDRRTACNCVK-AAANRY 82
Query  61   SQINPNNAASLPGKCGVSIPYKISTSINCSSI 92
              +  + A SLP KCG+S+   IS ++NC +I
Sbjct  83   PNLKDDAAQSLPSKCGISLTVPISRTVNCDTI 114

Sequence Alignment: 58. Allergen Name: Amb a 6 Sequence ID: O04004

 Score = 51.7 bits 223,  Expect = 5e-09
 Identities = 33/86 38%, Positives = 50/86 58%, Gaps = 4/86 4%
Query  4    CSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQI 63
            C  V   +APC G+L +G   S  CC+G+ N+N + KT +DR AVCNC+K    S+    
Sbjct  30   CDTVQNILAPCAGFL-TGQEPSKACCTGVNNLNNSRKTKADRVAVCNCIKELTKSIA--Y 86
Query  64   NPNNAASLPGKCGVSIPYK-ISTSINCSSI 92
            +P     L  KCGV   +  +  +++CS +
Sbjct  87   DPKRMPLLSTKCGVKPDFPAVDKNLDCSKL 116

Sequence Alignment: 59. Allergen Name: Par j 2 Sequence ID: O04403

 Score = 42.2 bits 174,  Expect = 4e-06
 Identities = 30/86 34%, Positives = 48/86 55%, Gaps = 9/86 10%
Query  4    CSFVTKSIAPCFGYLKSGGTVSGP---CCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
            C  V   I PC+ ++K  G    P   CCSG + ++   KTT  ++  C C+ +A   + 
Sbjct  35   CGKVVHHIMPCLKFVK--GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGI- 91
Query  61   SQINPNNAASLPGKCGVS--IPYKISTSINCSSIK 93
            S I     A +P KCG++  +P  I+   +CS I+
Sbjct  92   SGIKNELVAEVPKKCGITTTLP-PITADFDCSKIE 125

Sequence Alignment: 60. Allergen Name: Par j 2 Sequence ID: P55958

 Score = 40.9 bits 167,  Expect = 1e-05
 Identities = 29/86 33%, Positives = 47/86 54%, Gaps = 9/86 10%
Query  4    CSFVTKSIAPCFGYLKSGGTVSGP---CCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
            C  V + I PC+ ++K  G    P   CCSG + ++   KTT  ++  C C+  A   + 
Sbjct  35   CGKVVQDIMPCLHFVK--GEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGI- 91
Query  61   SQINPNNAASLPGKCGV--SIPYKISTSINCSSIK 93
            S I     A +P KC +  ++P  I+   +CS I+
Sbjct  92   SGIKNELVAEVPKKCDIKTTLP-PITADFDCSKIQ 125

Sequence Alignment: 61. Allergen Name: Par j 1 Sequence ID: P43217

 Score = 40.1 bits 163,  Expect = 2e-05
 Identities = 24/85 28%, Positives = 49/85 57%, Gaps = 10/85 11%
Query  4    CSFVTKSIAPCFGYLKSGGTVSGP---CCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
            C  + +++ PC+ +++  G    P   CCSG + ++G  KT   R   C C+++A  +  
Sbjct  4    CGTMVRALMPCLPFVQ--GKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTY- 60
Query  61   SQINPNNAASLPGKCGV---SIPYKISTSINCSSI 92
            S I+    + +P  CG+    +P  I  +++C ++
Sbjct  61   SDIDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94

Sequence Alignment: 62. Allergen Name: Par j 1 Sequence ID: O04404

 Score = 40.3 bits 163,  Expect = 2e-05
 Identities = 25/85 29%, Positives = 49/85 57%, Gaps = 10/85 11%
Query  4    CSFVTKSIAPCFGYLKSGGTVSGP---CCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
            C  V +++ PC+ +++  G    P   CCSG + ++G  KT   R   C C+++A  +  
Sbjct  41   CGTVVRALMPCLPFVQ--GKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTY- 97
Query  61   SQINPNNAASLPGKCGV---SIPYKISTSINCSSI 92
            S I+    + +P  CG+    +P  I  +++C ++
Sbjct  98   SDIDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTL 131

Sequence Alignment: 63. Allergen Name: Par j 1.0103 Sequence ID: CAI94601

 Score = 39.7 bits 161,  Expect = 2e-05
 Identities = 24/85 28%, Positives = 49/85 57%, Gaps = 10/85 11%
Query  4    CSFVTKSIAPCFGYLKSGGTVSGP---CCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
            C  + +++ PC+ +++  G    P   CCSG + ++G  KT   R   C C+++A  +  
Sbjct  4    CGTMVRALMPCLPFVQ--GKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTY- 60
Query  61   SQINPNNAASLPGKCGV---SIPYKISTSINCSSI 92
            S I+    + +P  CG+    +P  I  +++C ++
Sbjct  61   SDIDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTL 94

Sequence Alignment: 64. Allergen Name: Par j 1 Sequence ID: Q40905

 Score = 39.5 bits 160,  Expect = 3e-05
 Identities = 25/85 29%, Positives = 48/85 56%, Gaps = 10/85 11%
Query  4    CSFVTKSIAPCFGYLKSGGTVSGP---CCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
            C  V  ++ PC+ +++  G    P   CCSG + ++G  KT   R   C C+++A  +  
Sbjct  40   CGTVVGALMPCLPFVQ--GKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTY- 96
Query  61   SQINPNNAASLPGKCGV---SIPYKISTSINCSSI 92
            S I+    + +P  CG+    +P  I  +++C ++
Sbjct  97   SDIDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTL 130

Sequence Alignment: 65. Allergen Name: Par j 1.0101 Sequence ID: CAA54587

 Score = 37.9 bits 152,  Expect = 8e-05
 Identities = 23/82 28%, Positives = 48/82 58%, Gaps = 10/82 12%
Query  7    VTKSIAPCFGYLKSGGTVSGP---CCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQI 63
            + +++ PC+ +++  G    P   CCSG + ++G  KT   R   C C+++A  +  S I
Sbjct  1    MVRALMPCLPFVQ--GKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTY-SDI 57
Query  64   NPNNAASLPGKCGV---SIPYKISTSINCSSI 92
            +    + +P  CG+    +P  I  +++C ++
Sbjct  58   DGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 88

Sequence Alignment: 66. Allergen Name: Art v 3.0101 Sequence ID: P0C088

 Score = 35.2 bits 143,  Expect = 0.0001
 Identities = 17/36 47%, Positives = 25/36 69%, Gaps = 0/36 0%
Query  1    AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNIN 36
            A+ CS V+  I+PC+ YLK GG V   CC+G++ +N
Sbjct  1    ALTCSDVSNKISPCLSYLKQGGEVPADCCAGVKGLN 36

Sequence Alignment: 67. Allergen Name: Cas s 8 Sequence ID: 10998016

 Score = 30.3 bits 118,  Expect = 0.004
 Identities = 16/33 48%, Positives = 23/33 69%, Gaps = 2/33 6%
Query  1    AIQCSFVTKSIAPCFGYLKSGGTVSGP--CCSGIQ 33
            +I C+ V+KS+ PC+ YLKS G    P  CC G++
Sbjct  1    SITCTQVSKSLMPCLTYLKSNGGSPPPGTCCQGVK 35

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.