The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

DKGPGFVVTGRVYCDPCRAGFETNVSHNVQGATVAVDCRPFNGGESKLKAEATTDGLGWY
KIEIDQDHQEEICEVVLAKSPDTTCSEIEEFRDRARVPLTSNNGIKQQGIRYANPIAFFR
KEPLKECGGILQAYDLRDAPETP
Sequence Info Allergen Name Length Opt Bits Score E Value
AAN32987 Phl p 11.0101 143 990 261.2 7.8e-72
Q7M1X5 Lol p 11.0101 134 880 233.0 2.3e-63
ADK22842 Sal k 5.0101 151 422 115.3 7.1e-28
AAL07319 Che a 1 168 416 113.7 2.3e-27
A0A0K1SC24 Aca f 1 150 408 111.7 8.5e-27
A0A0K1SC10 Ama r 1.0101 168 408 111.6 9.7e-27
AKV72167 Pro j 1.0101 150 396 108.6 7.2e-26
A0A0K1SC44 Koc s 1.0101 167 375 103.2 3.4e-24
CAA33854 Lyc e LAT52 161 344 95.2 8.2e-22
AAV74343 Fra e 1.0102 145 284 79.8 3.2e-17
AAQ08947 Fra e 1.0101 145 283 79.5 3.8e-17
AAQ83588 Fra e 1.0201 146 273 77.0 2.3e-16
X76395 Ole e 1.0102 145 272 76.7 2.7e-16
P19963 Ole e 1 145 272 76.7 2.7e-16
CAA73037 Ole e 1.0106 146 271 76.5 3.3e-16
CAA73038 Ole e 1.0105 146 267 75.4 6.7e-16
AAB32652 Ole e 1.0101 130 260 73.7 2e-15
X76396 Ole e 1.0103 145 260 73.6 2.3e-15
CAA73036 Ole e 1.0107 146 259 73.4 2.8e-15
CAA54819 Lig v 1.0102 145 258 73.1 3.3e-15
X76397 Ole e 1.0104 145 256 72.6 4.7e-15
O82015 Lig v 1 145 254 72.1 6.7e-15
P82242 Pla l 1 131 173 51.3 1.1e-08
CAC41635 Pla l 1.0103 131 163 48.7 6.5e-08
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Phl p 11.0101 Sequence ID: AAN32987

 Score = 261.2 bits 990,  Expect = 8e-72
 Identities = 143/143 100%, Positives = 143/143 100%, Gaps = 0/143 0%
Query  1    DKGPGFVVTGRVYCDPCRAGFETNVSHNVQGATVAVDCRPFNGGESKLKAEATTDGLGWY 60
            DKGPGFVVTGRVYCDPCRAGFETNVSHNVQGATVAVDCRPFNGGESKLKAEATTDGLGWY
Sbjct  1    DKGPGFVVTGRVYCDPCRAGFETNVSHNVQGATVAVDCRPFNGGESKLKAEATTDGLGWY 60
Query  61   KIEIDQDHQEEICEVVLAKSPDTTCSEIEEFRDRARVPLTSNNGIKQQGIRYANPIAFFR 120
            KIEIDQDHQEEICEVVLAKSPDTTCSEIEEFRDRARVPLTSNNGIKQQGIRYANPIAFFR
Sbjct  61   KIEIDQDHQEEICEVVLAKSPDTTCSEIEEFRDRARVPLTSNNGIKQQGIRYANPIAFFR 120
Query  121  KEPLKECGGILQAYDLRDAPETP 143
            KEPLKECGGILQAYDLRDAPETP
Sbjct  121  KEPLKECGGILQAYDLRDAPETP 143

Sequence Alignment: 2. Allergen Name: Lol p 11.0101 Sequence ID: Q7M1X5

 Score = 233.0 bits 880,  Expect = 2e-63
 Identities = 127/134 94%, Positives = 130/134 97%, Gaps = 0/134 0%
Query  1    DKGPGFVVTGRVYCDPCRAGFETNVSHNVQGATVAVDCRPFNGGESKLKAEATTDGLGWY 60
            DKGPGFVVTGRVYCDPCRAGFETNVSHNV+GATVAVDCRPF+GGESKLKAEATTD  GWY
Sbjct  1    DKGPGFVVTGRVYCDPCRAGFETNVSHNVEGATVAVDCRPFDGGESKLKAEATTDKDGWY 60
Query  61   KIEIDQDHQEEICEVVLAKSPDTTCSEIEEFRDRARVPLTSNNGIKQQGIRYANPIAFFR 120
            KIEIDQDHQEEICEVVLAKSPD +CSEIEEFRDRARVPLTSN GIKQQGIRYANPIAFFR
Sbjct  61   KIEIDQDHQEEICEVVLAKSPDKSCSEIEEFRDRARVPLTSNXGIKQQGIRYANPIAFFR 120
Query  121  KEPLKECGGILQAY 134
            KEPLKECGGILQAY
Sbjct  121  KEPLKECGGILQAY 134

Sequence Alignment: 3. Allergen Name: Sal k 5.0101 Sequence ID: ADK22842

 Score = 115.3 bits 422,  Expect = 7e-28
 Identities = 67/138 48%, Positives = 93/138 67%, Gaps = 8/138 5%
Query  2    KGPG----FVVTGRVYCDPCRAGFETNVSHNVQGATVAVDCRPFNGGESKLKAEATTDGL 57
            KG G    + V G VYCD CR  F T VS  ++GATV++ CR +  G   +KAEA TD L
Sbjct  1    KGKGGHNLYHVKGMVYCDTCRIQFITRVSTMMEGATVSLQCRNLTAGTETFKAEAVTDKL 60
Query  58   GWYKIEIDQDHQEEICEVVLAKSPDTTCSEIEE--FRDRA-RVPLTSNNGIKQQGIRYAN 114
            G Y I++D DH+++IC++VL KSP   CSEI    + ++A +V LTSNNG +   +R AN
Sbjct  61   GMYTIKVDGDHEDDICQIVLVKSPGQECSEIPNDVYSEQAAKVTLTSNNG-EASDVRNAN 119
Query  115  PIAFFRKEPLKECGGILQAYDLRDAP 140
             + F++K PL EC  +L+  D+ D P
Sbjct  120  ALGFLKKAPLPECPEVLKELDMYDVP 145

Sequence Alignment: 4. Allergen Name: Che a 1 Sequence ID: AAL07319

 Score = 113.7 bits 416,  Expect = 2e-27
 Identities = 64/132 48%, Positives = 86/132 65%, Gaps = 4/132 3%
Query  6    FVVTGRVYCDPCRAGFETNVSHNVQGATVAVDCRPFNGGESKLKAEATTDGLGWYKIEID 65
            F V G VYCD CR  F T +S  ++GATV ++CR    G   +KAEA TD +G Y I ++
Sbjct  30   FKVQGMVYCDTCRIQFMTRISTIMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSIPVN 89
Query  66   QDHQEEICEVVLAKSPDTTCSEIEE---FRDRARVPLTSNNGIKQQGIRYANPIAFFRKE 122
             D +++ICE+ L KSP++ CSE+      +  A+V LTSNNG +   IR AN + F RKE
Sbjct  90   GDFEDDICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSNNG-EASDIRSANALGFMRKE 148
Query  123  PLKECGGILQAYDLRD 138
            PLKEC  +L+  DL D
Sbjct  149  PLKECPEVLKELDLYD 164

Sequence Alignment: 5. Allergen Name: Aca f 1 Sequence ID: A0A0K1SC24

 Score = 111.7 bits 408,  Expect = 9e-27
 Identities = 65/132 49%, Positives = 84/132 63%, Gaps = 5/132 3%
Query  6    FVVTGRVYCDPCRAGFETNVSHNVQGATVAVDCRPFNGGESKLKAEATTDGLGWYKIEID 65
            F V G VYCD CR  F T  S  ++GATV ++CR    G   +KAEA TD +G Y I +D
Sbjct  11   FHVQGLVYCDTCRYPFITEASPIMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSIPVD 70
Query  66   QDHQEEICEVVLAKSPDTTCSEIEE---FRDRARVPLTSNNGIKQQGIRYANPIAFFRKE 122
             DH+++ICE+ L KSPD  CSEI      +  A+V LTSNNG +   +R AN + F RKE
Sbjct  71   GDHEDDICEIELVKSPDNQCSEIPHDVYAKQSAKVSLTSNNG-EASDVRSANALGFMRKE 129
Query  123  PLKECGGILQA-YDLRD 138
            PL EC  +L+   D+ D
Sbjct  130  PLPECPEVLKEKLDMYD 146

Sequence Alignment: 6. Allergen Name: Ama r 1.0101 Sequence ID: A0A0K1SC10

 Score = 111.6 bits 408,  Expect = 1e-26
 Identities = 62/132 46%, Positives = 86/132 65%, Gaps = 4/132 3%
Query  6    FVVTGRVYCDPCRAGFETNVSHNVQGATVAVDCRPFNGGESKLKAEATTDGLGWYKIEID 65
            F + G VYCD CR  F T +S  ++GATV ++CR    G   +KAEA TD +G Y I ++
Sbjct  30   FHIQGLVYCDTCRIQFMTRISTIMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSIPVN 89
Query  66   QDHQEEICEVVLAKSPDTTCSEIEE---FRDRARVPLTSNNGIKQQGIRYANPIAFFRKE 122
             D +++ICE+ L KSP++ CSE+      +  A+V LTSNNG +   IR AN + F RKE
Sbjct  90   GDFEDDICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSNNG-EASDIRSANALGFMRKE 148
Query  123  PLKECGGILQAYDLRD 138
            PL+EC  +L+  DL D
Sbjct  149  PLEECPEVLKELDLYD 164

Sequence Alignment: 7. Allergen Name: Pro j 1.0101 Sequence ID: AKV72167

 Score = 108.6 bits 396,  Expect = 7e-26
 Identities = 64/131 48%, Positives = 86/131 65%, Gaps = 8/131 6%
Query  6    FVVTGRVYCDPCRAGFETNVSHNVQGATVAVDCRPFNGGESKLKAEATTDGLGWYKIEID 65
            F + G VYCD CR  F T VS  ++GATV ++CR    G   +KAEA TD +G Y I ++
Sbjct  11   FHIQGLVYCDTCRIQFMTRVSTIMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSIPVN 70
Query  66   QDHQEEICEVVLAKSPDTTCSEIEE---FRDRARVPLTSNNGIKQQGIRYANPIAFFRKE 122
             D +++ICE+ L KSP++ CSEI      +  A+V LTSNNG +   IR AN + F RKE
Sbjct  71   GDFEDDICEIELVKSPNSDCSEIPHDVYAKQSAKVSLTSNNG-EASDIRSANALGFMRKE 129
Query  123  PLKECGGI----LQAYDLR 137
            PLKEC  +    L  YD++
Sbjct  130  PLKECPEVSKEPLDMYDVK 148

Sequence Alignment: 8. Allergen Name: Koc s 1.0101 Sequence ID: A0A0K1SC44

 Score = 103.2 bits 375,  Expect = 3e-24
 Identities = 60/131 45%, Positives = 82/131 62%, Gaps = 5/131 3%
Query  6    FVVTGRVYCDPCRAGFETNVSHNVQGATVAVDCRPFNGGESKLKAEATTDGLGWYKIEID 65
            F + G VYCD C     + V   ++GATV ++CR    G   +KAEA TD +G Y I +D
Sbjct  30   FHIQGLVYCDTCPYP-SSYVLPMLEGATVKLECRNITAGTQTFKAEAVTDKVGQYSIPVD 88
Query  66   QDHQEEICEVVLAKSPDTTCSEIEE---FRDRARVPLTSNNGIKQQGIRYANPIAFFRKE 122
             D +++ICE+ L KSPD  CSE+      +  A+V LTSNNG +   +R AN + F RKE
Sbjct  89   GDFEDDICEIELLKSPDNQCSEVSHDVYAKQSAKVSLTSNNG-EASDVRSANALGFMRKE 147
Query  123  PLKECGGILQAYDLRD 138
            PL+EC  +L+  DL D
Sbjct  148  PLEECPEVLKELDLYD 163

Sequence Alignment: 9. Allergen Name: Lyc e LAT52 Sequence ID: CAA33854

 Score = 95.2 bits 344,  Expect = 8e-22
 Identities = 51/130 39%, Positives = 75/130 57%, Gaps = 1/130 0%
Query  6    FVVTGRVYCDPCRAGFETNVSHNVQGATVAVDCRPFNGGESKLKAEATTDGLGWYKIEID 65
            F V G+VYCD CR  FET +S N++GATV + CR  +     +  E  TD  G YK+ ++
Sbjct  27   FDVEGKVYCDTCRVQFETKLSENLEGATVKLQCRNISTEAETFSVEGVTDKDGKYKLTVN 86
Query  66   QDHQEEICEVVLAKSPDTTCSEIEEFRDRARVPLTSNNGIKQQGIRYANPIAFFRKEPLK 125
             DH+ +ICEV + KSP   C E     ++AR+  + N GI +  +R+ANP+ F + E ++
Sbjct  87   GDHENDICEVTVVKSPREDCKESVSGYEKARIECSDNVGI-HNAVRFANPLFFMKAESVQ 145
Query  126  ECGGILQAYDL 136
             C   L    L
Sbjct  146  GCKEALDELGL 156

Sequence Alignment: 10. Allergen Name: Fra e 1.0102 Sequence ID: AAV74343

 Score = 79.8 bits 284,  Expect = 3e-17
 Identities = 47/118 39%, Positives = 65/118 55%, Gaps = 7/118 5%
Query  6    FVVTGRVYCDPCRAGFETNVSHNVQGATVAVDCRPFNGGESKLKAEATTDGLGWYKIEID 65
            F V G+VYCD CRAGF T +S  +QGA V + C+    G+  +     T   G Y + I+
Sbjct  11   FYVQGQVYCDTCRAGFITELSEFIQGAGVRLQCKEKENGKVTFTEVGYTRAEGLYSMVIE 70
Query  66   QDHQEEICEVVLAKSPDTTCSEIEE---FRDRARVPLTSNNGIKQQGIRYANPIAFFRKE 122
            +DH+ E CE+VL  S    C EI      +   +  L + NG      R  NP+ FF+KE
Sbjct  71   RDHKNEFCEIVLLSSSRKDCHEIPTEGWVKPSLKFILNTVNGTT----RTINPLGFFKKE 126
Query  123  PLKEC 127
             L +C
Sbjct  127  ALPKC 131

Sequence Alignment: 11. Allergen Name: Fra e 1.0101 Sequence ID: AAQ08947

 Score = 79.5 bits 283,  Expect = 4e-17
 Identities = 47/118 39%, Positives = 65/118 55%, Gaps = 7/118 5%
Query  6    FVVTGRVYCDPCRAGFETNVSHNVQGATVAVDCRPFNGGESKLKAEATTDGLGWYKIEID 65
            F V G+VYCD CRAGF T +S  +QGA V + C+    G+  +     T   G Y + I+
Sbjct  11   FYVQGQVYCDTCRAGFITELSEFIQGAGVRLQCKDKENGKVTFTEVGYTRAEGLYSMVIE 70
Query  66   QDHQEEICEVVLAKSPDTTCSEIEE---FRDRARVPLTSNNGIKQQGIRYANPIAFFRKE 122
            +DH+ E CE+VL  S    C EI      +   +  L + NG      R  NP+ FF+KE
Sbjct  71   RDHKNEFCEIVLLSSSRKDCDEIPTEGWVKPSLKFILNTVNGTT----RTINPLGFFKKE 126
Query  123  PLKEC 127
             L +C
Sbjct  127  VLPKC 131

Sequence Alignment: 12. Allergen Name: Fra e 1.0201 Sequence ID: AAQ83588

 Score = 77.0 bits 273,  Expect = 2e-16
 Identities = 44/121 36%, Positives = 66/121 54%, Gaps = 7/121 5%
Query  6    FVVTGRVYCDPCRAGFETNVSHNVQGATVAVDCRPFNGGESKLKAEATTDGLGWYKIEID 65
            F + G+VYCD CRA F T +S  + GA+V + CR    G+  +     T G G Y + ++
Sbjct  12   FHIQGQVYCDTCRARFITKLSEFITGASVRLQCRDKENGDVTFTEIGYTRGEGLYSMFVE 71
Query  66   QDHQEEICEVVLAKSPDTTCSEIE---EFRDRARVPLTSNNGIKQQGIRYANPIAFFRKE 122
            +DH+ E CE+ L  S    C+EI      +   +  L + NG      R  NP+ FF+KE
Sbjct  72   RDHKNEFCEITLLSSGRKDCNEIPIEGWVKPSLKFILNTVNGTT----RTINPLGFFKKE 127
Query  123  PLKECGGI 130
             L +C  +
Sbjct  128  ALPQCAQV 135

Sequence Alignment: 13. Allergen Name: Ole e 1.0102 Sequence ID: X76395

 Score = 76.7 bits 272,  Expect = 3e-16
 Identities = 42/121 34%, Positives = 66/121 54%, Gaps = 7/121 5%
Query  6    FVVTGRVYCDPCRAGFETNVSHNVQGATVAVDCRPFNGGESKLKAEATTDGLGWYKIEID 65
            F + G+VYCD CRAGF T +S  + GA++ + C+    G+  +     T   G Y + ++
Sbjct  11   FHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTRAEGLYSMLVE 70
Query  66   QDHQEEICEVVLAKSPDTTCSEIEE---FRDRARVPLTSNNGIKQQGIRYANPIAFFRKE 122
            +DH+ E CE+ L  S    C+EI      +   +  L + NG      R  NP+ FF+KE
Sbjct  71   RDHKNEFCEITLISSGRKDCNEIPTEGWVKPSLKFILNTVNGTT----RTVNPLGFFKKE 126
Query  123  PLKECGGI 130
             L +C  +
Sbjct  127  ALPKCAQV 134

Sequence Alignment: 14. Allergen Name: Ole e 1 Sequence ID: P19963

 Score = 76.7 bits 272,  Expect = 3e-16
 Identities = 42/121 34%, Positives = 66/121 54%, Gaps = 7/121 5%
Query  6    FVVTGRVYCDPCRAGFETNVSHNVQGATVAVDCRPFNGGESKLKAEATTDGLGWYKIEID 65
            F + G+VYCD CRAGF T +S  + GA++ + C+    G+  +     T   G Y + ++
Sbjct  11   FHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTRAEGLYSMLVE 70
Query  66   QDHQEEICEVVLAKSPDTTCSEIEEF---RDRARVPLTSNNGIKQQGIRYANPIAFFRKE 122
            +DH+ E CE+ L  S    C+EI      +   +  L + NG      R  NP+ FF+KE
Sbjct  71   RDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFKLNTVNGTT----RTVNPLGFFKKE 126
Query  123  PLKECGGI 130
             L +C  +
Sbjct  127  ALPKCAQV 134

Sequence Alignment: 15. Allergen Name: Ole e 1.0106 Sequence ID: CAA73037

 Score = 76.5 bits 271,  Expect = 3e-16
 Identities = 42/121 34%, Positives = 67/121 55%, Gaps = 7/121 5%
Query  6    FVVTGRVYCDPCRAGFETNVSHNVQGATVAVDCRPFNGGESKLKAEATTDGLGWYKIEID 65
            F + G+VYCD CRAGF T +S  + GA+V + C+    G+  +     T   G Y + ++
Sbjct  12   FHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYTRAEGLYSMLVE 71
Query  66   QDHQEEICEVVLAKSPDTTCSEIEEF---RDRARVPLTSNNGIKQQGIRYANPIAFFRKE 122
            +DH+ E CE+ L  S    C+EI      +   +  L++ NG      R  NP+ F++KE
Sbjct  72   RDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILSTVNGTT----RTVNPLGFYKKE 127
Query  123  PLKECGGI 130
             L +C  +
Sbjct  128  ALPKCAQV 135

Sequence Alignment: 16. Allergen Name: Ole e 1.0105 Sequence ID: CAA73038

 Score = 75.4 bits 267,  Expect = 7e-16
 Identities = 42/121 34%, Positives = 66/121 54%, Gaps = 7/121 5%
Query  6    FVVTGRVYCDPCRAGFETNVSHNVQGATVAVDCRPFNGGESKLKAEATTDGLGWYKIEID 65
            F + G+VYCD CRAGF T +S  + GA+V + C+    G+  +     T   G Y + ++
Sbjct  12   FHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYTRAEGLYSMLVE 71
Query  66   QDHQEEICEVVLAKSPDTTCSEIEEF---RDRARVPLTSNNGIKQQGIRYANPIAFFRKE 122
            +DH+ E CE+ L  S    C+EI      +   +  L + NG      R  NP+ F++KE
Sbjct  72   RDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILNTVNGTT----RTVNPLRFYKKE 127
Query  123  PLKECGGI 130
             L +C  +
Sbjct  128  ALPKCAQV 135

Sequence Alignment: 17. Allergen Name: Ole e 1.0101 Sequence ID: AAB32652

 Score = 73.7 bits 260,  Expect = 2e-15
 Identities = 41/116 35%, Positives = 63/116 54%, Gaps = 7/116 6%
Query  11   RVYCDPCRAGFETNVSHNVQGATVAVDCRPFNGGESKLKAEATTDGLGWYKIEIDQDHQE 70
            +VYCD CRAGF T +S  + GA+V + C+    G+  +     T   G Y + +++DH+ 
Sbjct  1    QVYCDTCRAGFITELSEFIPGASVRLQCKEKKNGDITFTEVGYTRAEGLYSMLVERDHKN 60
Query  71   EICEVVLAKSPDTTCSEIEEF---RDRARVPLTSNNGIKQQGIRYANPIAFFRKEPLKEC 127
            E CE+ L  S    C+EI      +   +  L + NG      R  NP+ FF+KE L +C
Sbjct  61   EFCEITLISSGSKDCNEIPTEGWAKPSLKFILNTVNGTT----RTVNPLGFFKKEALPKC 116
Query  128  GGI 130
              +
Sbjct  117  AQV 119

Sequence Alignment: 18. Allergen Name: Ole e 1.0103 Sequence ID: X76396

 Score = 73.6 bits 260,  Expect = 2e-15
 Identities = 43/122 35%, Positives = 65/122 53%, Gaps = 7/122 5%
Query  6    FVVTGRVYCDPCRAGFETNVSHNVQGATVAVDCRPFNGGESKLKAEATTDGLGWYKIEID 65
            F + G+VYCD CRA F T +S  + GA+V + C+    G   +     T   G Y + I+
Sbjct  11   FHIQGQVYCDTCRARFITELSEFIPGASVRLQCKDGENGSITFTEVGYTRAEGLYSMLIE 70
Query  66   QDHQEEICEVVLAKSPDTTCSEIEE---FRDRARVPLTSNNGIKQQGIRYANPIAFFRKE 122
            +DH++E CE+ L  S    C EI      +   +  L + NG      R  NP+ FF+KE
Sbjct  71   RDHKDEFCEITLISSSRKDCDEIPVEGWVKPSLKFMLNTVNGTT----RTINPLGFFKKE 126
Query  123  PLKECGGIL 131
             L +C  ++
Sbjct  127  ALPKCPQVF 135

Sequence Alignment: 19. Allergen Name: Ole e 1.0107 Sequence ID: CAA73036

 Score = 73.4 bits 259,  Expect = 3e-15
 Identities = 43/121 35%, Positives = 66/121 54%, Gaps = 7/121 5%
Query  6    FVVTGRVYCDPCRAGFETNVSHNVQGATVAVDCRPFNGGESKLKAEATTDGLGWYKIEID 65
            F + G+VYCD CR+ F T +S  + GA+V + CR    G+  +     T   G Y + ++
Sbjct  12   FHIQGQVYCDTCRSRFITELSEFIPGASVRLQCREKENGDITFTEIGYTRAEGLYSMLVE 71
Query  66   QDHQEEICEVVLAKSPDTTCSEI--EEF-RDRARVPLTSNNGIKQQGIRYANPIAFFRKE 122
            +DH+ E CE+ L  S    C EI  E + +   +  L + NG      R  NP+ FF+KE
Sbjct  72   RDHKNEFCEITLISSGRKDCDEIPIEGWAKPSLKFILNTVNGTT----RTVNPLGFFKKE 127
Query  123  PLKECGGI 130
             L +C  +
Sbjct  128  ALPKCAQV 135

Sequence Alignment: 20. Allergen Name: Lig v 1.0102 Sequence ID: CAA54819

 Score = 73.1 bits 258,  Expect = 3e-15
 Identities = 43/122 35%, Positives = 64/122 52%, Gaps = 7/122 5%
Query  6    FVVTGRVYCDPCRAGFETNVSHNVQGATVAVDCRPFNGGESKLKAEATTDGLGWYKIEID 65
            F + G+VYCD CRA F T +S  + GA V + C+    G+  +     T   G Y + I+
Sbjct  11   FYIQGQVYCDTCRARFITELSEFIPGAGVRLQCKDGENGKITFTEVGYTRAEGLYSMLIE 70
Query  66   QDHQEEICEVVLAKSPDTTCSEIE---EFRDRARVPLTSNNGIKQQGIRYANPIAFFRKE 122
            +DH+ E CE+ L  S    C EI      +   +  L + NG      R  NP+ FF+KE
Sbjct  71   RDHKNEFCEITLLSSSRKDCDEIPIEGWVKPSLKFMLNTVNGTT----RTINPLGFFKKE 126
Query  123  PLKECGGIL 131
             L +C  ++
Sbjct  127  ALPKCPQVF 135

Sequence Alignment: 21. Allergen Name: Ole e 1.0104 Sequence ID: X76397

 Score = 72.6 bits 256,  Expect = 5e-15
 Identities = 43/122 35%, Positives = 62/122 50%, Gaps = 7/122 5%
Query  6    FVVTGRVYCDPCRAGFETNVSHNVQGATVAVDCRPFNGGESKLKAEATTDGLGWYKIEID 65
            F V G+VYCD CR  F T  S  + GA V + C+    G+  +     T   G Y + I+
Sbjct  11   FYVQGQVYCDTCRTRFITEFSEFIPGAGVRLQCKDGENGKITFTEVGYTRAEGLYSMLIE 70
Query  66   QDHQEEICEVVLAKSPDTTCSEIEE---FRDRARVPLTSNNGIKQQGIRYANPIAFFRKE 122
            +DH+ E CE+ L  S    C EI      +   +  L + NG      R  NP+ FF+KE
Sbjct  71   RDHKNEFCEITLLSSSRKDCDEIPTEGWVKPSVKFILNTVNGTT----RTINPLGFFKKE 126
Query  123  PLKECGGIL 131
             L +C  ++
Sbjct  127  ALPKCPQVF 135

Sequence Alignment: 22. Allergen Name: Lig v 1 Sequence ID: O82015

 Score = 72.1 bits 254,  Expect = 7e-15
 Identities = 42/122 34%, Positives = 64/122 52%, Gaps = 7/122 5%
Query  6    FVVTGRVYCDPCRAGFETNVSHNVQGATVAVDCRPFNGGESKLKAEATTDGLGWYKIEID 65
            F + G+VYCD CRA F T +S  + GA V + C+    G+  +     T   G Y + I+
Sbjct  11   FYIQGQVYCDTCRARFITELSEFIPGAGVRLQCKDGENGKVTFTEVGYTKAEGLYNMLIE 70
Query  66   QDHQEEICEVVLAKSPDTTCSEIEE---FRDRARVPLTSNNGIKQQGIRYANPIAFFRKE 122
            +DH+ E CE+ L  S    C EI      +   +  L + NG      R  NP+ F++KE
Sbjct  71   RDHKNEFCEITLISSSRKDCDEIPTEGWVKPSLKFVLNTVNGTT----RTINPLGFLKKE 126
Query  123  PLKECGGIL 131
             L +C  ++
Sbjct  127  VLPKCPQVF 135

Sequence Alignment: 23. Allergen Name: Pla l 1 Sequence ID: P82242

 Score = 51.3 bits 173,  Expect = 1e-08
 Identities = 36/118 30%, Positives = 61/118 51%, Gaps = 9/118 7%
Query  6    FVVTGRVYCDPCRA-GFETNVSHNVQGATVAVDCRPFNGGESKLKAEATTDGLGWYKIEI 64
            F V G VYC+ C +  +   +S  + GA V +DC+  +  +        TD  G Y++ +
Sbjct  9    FHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKD-DSKKVIYSIGGETDQDGVYRLPV 67
Query  65   DQDHQEEICEVVLAKSPDTTCSEIEEFR----DRARVPLTSNNGIKQQGIRYANPIAFFR 120
               H++  CE+ L KS    CSEI ++       ++V L+ N  I ++  R+  P++F  
Sbjct  68   VGYHED--CEIKLVKSSRPDCSEIPKLAKGTIQTSKVDLSKNTTITEK-TRHVKPLSFRA 124
Query  121  KEPLKEC 127
            K     C
Sbjct  125  KTDAPGC 131

Sequence Alignment: 24. Allergen Name: Pla l 1.0103 Sequence ID: CAC41635

 Score = 48.7 bits 163,  Expect = 7e-08
 Identities = 35/118 29%, Positives = 60/118 50%, Gaps = 9/118 7%
Query  6    FVVTGRVYCDPCRA-GFETNVSHNVQGATVAVDCRPFNGGESKLKAEATTDGLGWYKIEI 64
            F V G VYC+ C +  +   +S  + GA V +DC+  +  +        T   G Y++ +
Sbjct  9    FHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKD-DSKKVIYSIGGETGQDGVYRLPV 67
Query  65   DQDHQEEICEVVLAKSPDTTCSEIEEFR----DRARVPLTSNNGIKQQGIRYANPIAFFR 120
               H++  CE+ L KS    CSEI ++       ++V L+ N  I ++  R+  P++F  
Sbjct  68   VGYHED--CEIKLVKSGRPDCSEIPKLAKGTIQTSKVDLSKNTTITEK-TRHVKPLSFRA 124
Query  121  KEPLKEC 127
            K     C
Sbjct  125  KTDAPGC 131

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.