The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Input Sequence

DNRWISSFPSDPNILMKIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNV
LGAKIYEIKK
Sequence Info Allergen Name Length Opt Bits Score E Value
AAY32926 Sol g 3.0101 70 501 146.4 6.7e-38
P35778 Sol i 3 234 477 139.5 2.6e-35
P35779 Sol r 3 211 443 130.1 1.7e-32
C0ITL3 Pac c 3.0101 199 275 83.2 2.1e-18
P86686 Poly p 5.0102 207 262 79.5 2.7e-17
P35781 Vesp c 5 202 259 78.7 4.7e-17
P81657 Vesp m 5 202 257 78.1 6.9e-17
P35782 Vesp c 5 202 254 77.3 1.2e-16
P0DMB9 Vesp v 5.0101 202 250 76.2 2.7e-16
P10737 Dol m 5.02 215 247 75.3 5.1e-16
P35760 Ves m 5 204 245 74.8 7.1e-16
P35786 Ves s 5 205 245 74.8 7.1e-16
P35784 Ves g 5 204 242 74.0 1.3e-15
P10736 Dol m 5.0101 227 242 73.9 1.4e-15
P35787 Ves vi 5 206 241 73.7 1.6e-15
Q05108 Dol a 5 203 240 73.4 1.9e-15
AAA28302 Dol m 5.02 212 239 73.1 2.4e-15
P35783 Ves f 5 204 236 72.3 4e-15
Q05110 Ves v 5 227 236 72.3 4.6e-15
P35785 Ves p 5 204 232 71.2 8.8e-15
C0HJV9 Poly p 5.0101 206 230 70.6 1.3e-14
Q7Z156 Poly s 5.0101 207 230 70.6 1.3e-14
Q05109 Pol a 5 209 224 68.9 4.2e-14
P35780 Pol f 5 205 222 68.4 6.1e-14
P83377 Pol g 5 206 219 67.5 1.1e-13
P81656 Pol d 5 206 219 67.5 1.1e-13
P35759 Pol e 5.0101 205 216 66.7 2e-13
AAT95009 Pol e 5.0101 226 214 66.1 3.2e-13
A0A2L1DGQ3 Art ar 2.0101 163 187 58.6 4.2e-11
AVD29827 Art si 2.0101 163 187 58.6 4.2e-11
AVD29826 Art la 2.0101 163 187 58.6 4.2e-11
AVD29824 Art ca 2.0101 163 187 58.6 4.2e-11
AVD29825 Art gm 2.0101 163 187 58.6 4.2e-11
AVD29822 Art an 2.0101 163 187 58.6 4.2e-11
QEA69430 Sco m 5.0101 210 163 51.9 5.7e-09
AAU15051 Cyn d 24.0101 153 141 45.8 2.8e-07
AAF65314 Cte f 2 264 144 46.6 2.9e-07
XP_007199020 Pru p 9.0101 161 117 39.1 3.1e-05
AAF82096 Glo m 5 259 92 32.0 0.0067
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Sol g 3.0101 Sequence ID: AAY32926

 Score = 146.4 bits 501,  Expect = 7e-38
 Identities = 70/70 100%, Positives = 70/70 100%, Gaps = 0/70 0%
Query  1    DNRWISSFPSDPNILMKIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNV 60
            DNRWISSFPSDPNILMKIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNV
Sbjct  1    DNRWISSFPSDPNILMKIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNV 60
Query  61   LGAKIYEIKK 70
            LGAKIYEIKK
Sbjct  61   LGAKIYEIKK 70

Sequence Alignment: 2. Allergen Name: Sol i 3 Sequence ID: P35778

 Score = 139.5 bits 477,  Expect = 3e-35
 Identities = 66/70 94%, Positives = 67/70 95%, Gaps = 0/70 0%
Query  1    DNRWISSFPSDPNILMKIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNV 60
            DNRWISSFPSD NILMK+GHYTQIVWAKT KIGCGRIMFKEPDNWTKHYLVCNYGPAGNV
Sbjct  165  DNRWISSFPSDDNILMKVGHYTQIVWAKTTKIGCGRIMFKEPDNWTKHYLVCNYGPAGNV 224
Query  61   LGAKIYEIKK 70
            LGA IYEIKK
Sbjct  225  LGAPIYEIKK 234

Sequence Alignment: 3. Allergen Name: Sol r 3 Sequence ID: P35779

 Score = 130.1 bits 443,  Expect = 2e-32
 Identities = 63/69 91%, Positives = 65/69 94%, Gaps = 1/69 1%
Query  1    DNRWISSFPSDPNILMKIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNV 60
            DNRWISSFPSD NILM +GHYTQIVWAKT KIGCGRIMFKE DNW KHYLVCNYGPAGNV
Sbjct  143  DNRWISSFPSDGNILMHVGHYTQIVWAKTKKIGCGRIMFKE-DNWNKHYLVCNYGPAGNV 201
Query  61   LGAKIYEIKK 70
            LGA+IYEIKK
Sbjct  202  LGAQIYEIKK 211

Sequence Alignment: 4. Allergen Name: Pac c 3.0101 Sequence ID: C0ITL3

 Score = 83.2 bits 275,  Expect = 2e-18
 Identities = 39/62 62%, Positives = 48/62 77%, Gaps = 1/62 1%
Query  5    ISSFPSDPNILMKIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAK 64
            +SS PSD N +MKIGHYTQ+VW KT K+GCG I F +   + K YL CNYGPAGN++GA 
Sbjct  138  VSSMPSDGNYFMKIGHYTQLVWGKTTKVGCGIIQFLD-GKFYKCYLACNYGPAGNMFGAP 196
Query  65   IYE 67
            IY+
Sbjct  197  IYQ 199

Sequence Alignment: 5. Allergen Name: Poly p 5.0102 Sequence ID: P86686

 Score = 79.5 bits 262,  Expect = 3e-17
 Identities = 37/52 71%, Positives = 43/52 82%, Gaps = 1/52 1%
Query  17   KIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAKIYEIK 69
            K+GHYTQ+VWAKT ++GCG I + E      HYLVCNYGPAGNVLGA+IYEIK
Sbjct  156  KVGHYTQVVWAKTKEVGCGSIKYIEK-GMKSHYLVCNYGPAGNVLGAQIYEIK 207

Sequence Alignment: 6. Allergen Name: Vesp c 5 Sequence ID: P35781

 Score = 78.7 bits 259,  Expect = 5e-17
 Identities = 38/61 62%, Positives = 45/61 73%, Gaps = 1/61 1%
Query  8    FPSDPNILMKIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAKIYE 67
            + S  N L K+GHYTQ+VWAKT +IGCG I + E + W +HYLVCNYGPAGNV    IYE
Sbjct  142  YGSPKNKLNKVGHYTQMVWAKTKEIGCGSIKYIE-NGWHRHYLVCNYGPAGNVGNEPIYE 200
Query  68   IK 69
             K
Sbjct  201  RK 202

Sequence Alignment: 7. Allergen Name: Vesp m 5 Sequence ID: P81657

 Score = 78.1 bits 257,  Expect = 7e-17
 Identities = 36/61 59%, Positives = 46/61 75%, Gaps = 1/61 1%
Query  8    FPSDPNILMKIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAKIYE 67
            + S  N L+++GHYTQ+VWAKT +IGCG I + E + W +HYLVCNYGPAGN+    IYE
Sbjct  142  YGSTKNKLIEVGHYTQMVWAKTKEIGCGSIKYIE-NGWHRHYLVCNYGPAGNIGNEPIYE 200
Query  68   IK 69
             K
Sbjct  201  RK 202

Sequence Alignment: 8. Allergen Name: Vesp c 5 Sequence ID: P35782

 Score = 77.3 bits 254,  Expect = 1e-16
 Identities = 38/61 62%, Positives = 44/61 72%, Gaps = 1/61 1%
Query  8    FPSDPNILMKIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAKIYE 67
            + S  N L K+GHYTQ+VWAKT +IGCG   + E D W +HYLVCNYGPAGNV    IYE
Sbjct  142  YGSPKNKLNKVGHYTQMVWAKTKEIGCGSEDYIE-DGWHRHYLVCNYGPAGNVGNEPIYE 200
Query  68   IK 69
             K
Sbjct  201  RK 202

Sequence Alignment: 9. Allergen Name: Vesp v 5.0101 Sequence ID: P0DMB9

 Score = 76.2 bits 250,  Expect = 3e-16
 Identities = 36/61 59%, Positives = 43/61 70%, Gaps = 1/61 1%
Query  8    FPSDPNILMKIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAKIYE 67
            + S  N L  +GHYTQ+VWAKT +IGCG I + E + W  HYLVCNYGPAGN+    IYE
Sbjct  142  YGSSKNKLNDVGHYTQMVWAKTKEIGCGNIKYIE-NGWHHHYLVCNYGPAGNIGNEPIYE 200
Query  68   IK 69
             K
Sbjct  201  KK 202

Sequence Alignment: 10. Allergen Name: Dol m 5.02 Sequence ID: P10737

 Score = 75.3 bits 247,  Expect = 5e-16
 Identities = 34/56 60%, Positives = 42/56 75%, Gaps = 1/56 1%
Query  13   NILMKIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAKIYEIK 69
            N + K+GHYTQ+VW KT +IGCG + + E +NW  HYLVCNYGPAGN +   IYE K
Sbjct  160  NNFSKVGHYTQMVWGKTKEIGCGSVKYIE-NNWHTHYLVCNYGPAGNYMDQPIYERK 215

Sequence Alignment: 11. Allergen Name: Ves m 5 Sequence ID: P35760

 Score = 74.8 bits 245,  Expect = 7e-16
 Identities = 32/56 57%, Positives = 44/56 78%, Gaps = 1/56 1%
Query  13   NILMKIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAKIYEIK 69
            N ++KIGHYTQ+VWA T ++GCG I + + +NW KHYLVCNYGP+GN    ++Y+ K
Sbjct  149  NNFLKIGHYTQMVWANTKEVGCGSIKYIQ-ENWHKHYLVCNYGPSGNFQNEELYQTK 204

Sequence Alignment: 12. Allergen Name: Ves s 5 Sequence ID: P35786

 Score = 74.8 bits 245,  Expect = 7e-16
 Identities = 35/58 60%, Positives = 44/58 75%, Gaps = 1/58 1%
Query  11   DPNILMKIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAKIYEIK 69
            + N + KIGHYTQ+VWAKT +IGCG I + + +NW  HYLVCNYGPAGN    ++YE K
Sbjct  148  EQNEFKKIGHYTQMVWAKTKEIGCGSIKYVD-NNWYTHYLVCNYGPAGNFGNQEVYERK 205

Sequence Alignment: 13. Allergen Name: Ves g 5 Sequence ID: P35784

 Score = 74.0 bits 242,  Expect = 1e-15
 Identities = 32/56 57%, Positives = 43/56 76%, Gaps = 1/56 1%
Query  13   NILMKIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAKIYEIK 69
            N ++KIGHYTQ+VWA T ++GCG I + + D W KHYLVCNYGP+GN    ++Y+ K
Sbjct  149  NNFLKIGHYTQMVWANTKEVGCGSIKYIQ-DKWHKHYLVCNYGPSGNFGNEELYQTK 204

Sequence Alignment: 14. Allergen Name: Dol m 5.0101 Sequence ID: P10736

 Score = 73.9 bits 242,  Expect = 1e-15
 Identities = 34/52 65%, Positives = 39/52 75%, Gaps = 1/52 1%
Query  17   KIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAKIYEIK 69
            K+GHYTQ+VW KT +IGCG I + E DNW  HYLVCNYGP GN +   IYE K
Sbjct  176  KVGHYTQMVWGKTKEIGCGSIKYIE-DNWYTHYLVCNYGPGGNDFNQPIYERK 227

Sequence Alignment: 15. Allergen Name: Ves vi 5 Sequence ID: P35787

 Score = 73.7 bits 241,  Expect = 2e-15
 Identities = 34/56 60%, Positives = 41/56 73%, Gaps = 1/56 1%
Query  13   NILMKIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAKIYEIK 69
            N L K GHYTQ+VWAKT +IGCG + + + D W  HYLVCNYGP+GN    K+YE K
Sbjct  151  NNLKKTGHYTQMVWAKTKEIGCGSVKYVK-DEWYTHYLVCNYGPSGNFRNEKLYEKK 206

Sequence Alignment: 16. Allergen Name: Dol a 5 Sequence ID: Q05108

 Score = 73.4 bits 240,  Expect = 2e-15
 Identities = 32/56 57%, Positives = 41/56 73%, Gaps = 1/56 1%
Query  13   NILMKIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAKIYEIK 69
            N + K+GHYTQ+VW KT +IGCG + + E + W  HYLVCNYGPAGN +   +YE K
Sbjct  148  NNFSKVGHYTQMVWGKTKEIGCGSVKYIE-NKWHTHYLVCNYGPAGNYMNQPVYERK 203

Sequence Alignment: 17. Allergen Name: Dol m 5.02 Sequence ID: AAA28302

 Score = 73.1 bits 239,  Expect = 2e-15
 Identities = 32/53 60%, Positives = 40/53 75%, Gaps = 1/53 1%
Query  13   NILMKIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAKIY 66
            N + K+GHYTQ+VW KT +IGCG + + E +NW  HYLVCNYGPAGN +   IY
Sbjct  160  NNFSKVGHYTQMVWGKTKEIGCGSVKYIE-NNWHTHYLVCNYGPAGNYMDQPIY 212

Sequence Alignment: 18. Allergen Name: Ves f 5 Sequence ID: P35783

 Score = 72.3 bits 236,  Expect = 4e-15
 Identities = 31/56 55%, Positives = 42/56 75%, Gaps = 1/56 1%
Query  13   NILMKIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAKIYEIK 69
            N ++K GHYTQ+VWA T ++GCG I F + + W KHYLVCNYGP+GN    ++Y+ K
Sbjct  149  NNFLKTGHYTQMVWANTKEVGCGSIKFIQ-EKWHKHYLVCNYGPSGNFQNEELYQTK 204

Sequence Alignment: 19. Allergen Name: Ves v 5 Sequence ID: Q05110

 Score = 72.3 bits 236,  Expect = 5e-15
 Identities = 30/56 53%, Positives = 43/56 76%, Gaps = 1/56 1%
Query  13   NILMKIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAKIYEIK 69
            N ++K GHYTQ+VWA T ++GCG I + + + W KHYLVCNYGP+GN +  ++Y+ K
Sbjct  172  NDFLKTGHYTQMVWANTKEVGCGSIKYIQ-EKWHKHYLVCNYGPSGNFMNEELYQTK 227

Sequence Alignment: 20. Allergen Name: Ves p 5 Sequence ID: P35785

 Score = 71.2 bits 232,  Expect = 9e-15
 Identities = 32/56 57%, Positives = 42/56 75%, Gaps = 1/56 1%
Query  13   NILMKIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAKIYEIK 69
            N + KIGHYTQ+VWA T +IGCG I + + + W KHYLVCNYGP+GN    ++Y+ K
Sbjct  149  NNFNKIGHYTQMVWANTKEIGCGSIKYIQ-NEWHKHYLVCNYGPSGNFGNEELYQTK 204

Sequence Alignment: 21. Allergen Name: Poly p 5.0101 Sequence ID: C0HJV9

 Score = 70.6 bits 230,  Expect = 1e-14
 Identities = 32/52 61%, Positives = 38/52 73%, Gaps = 1/52 1%
Query  17   KIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAKIYEIK 69
            K+GHYTQ+VWAKT ++GCG I + E      HYLVCNYGPAGN +G  IY  K
Sbjct  155  KVGHYTQVVWAKTKEVGCGSIKYIEK-GMKSHYLVCNYGPAGNYMGQPIYTKK 206

Sequence Alignment: 22. Allergen Name: Poly s 5.0101 Sequence ID: Q7Z156

 Score = 70.6 bits 230,  Expect = 1e-14
 Identities = 32/52 61%, Positives = 38/52 73%, Gaps = 1/52 1%
Query  17   KIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAKIYEIK 69
            K+GHYTQ+VWAKT ++GCG I + E      HYLVCNYGPAGN +G  IY  K
Sbjct  156  KVGHYTQVVWAKTKEVGCGSIKYIEK-GMKSHYLVCNYGPAGNYMGQPIYTKK 207

Sequence Alignment: 23. Allergen Name: Pol a 5 Sequence ID: Q05109

 Score = 68.9 bits 224,  Expect = 4e-14
 Identities = 32/52 61%, Positives = 38/52 73%, Gaps = 1/52 1%
Query  17   KIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAKIYEIK 69
            KIGHYTQ+VW KT +IGCG + + E +N   HYL+CNYGPAGN LG   Y  K
Sbjct  158  KIGHYTQMVWGKTKEIGCGSLKYME-NNMQNHYLICNYGPAGNYLGQLPYTKK 209

Sequence Alignment: 24. Allergen Name: Pol f 5 Sequence ID: P35780

 Score = 68.4 bits 222,  Expect = 6e-14
 Identities = 30/52 57%, Positives = 39/52 75%, Gaps = 1/52 1%
Query  17   KIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAKIYEIK 69
            K+GHYTQ++WAKT +IGCG + + + +N   HYL+CNYGPAGN LG   Y  K
Sbjct  154  KVGHYTQMIWAKTKEIGCGSLKYMK-NNMQHHYLICNYGPAGNYLGQLPYTKK 205

Sequence Alignment: 25. Allergen Name: Pol g 5 Sequence ID: P83377

 Score = 67.5 bits 219,  Expect = 1e-13
 Identities = 30/52 57%, Positives = 37/52 71%, Gaps = 1/52 1%
Query  17   KIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAKIYEIK 69
            K+GHYTQ+VW  T ++GCG + + E  N   HYL+CNYGPAGN LG  IY  K
Sbjct  155  KVGHYTQMVWGNTKEVGCGSLKYVEK-NMKIHYLICNYGPAGNYLGQPIYTKK 206

Sequence Alignment: 26. Allergen Name: Pol d 5 Sequence ID: P81656

 Score = 67.5 bits 219,  Expect = 1e-13
 Identities = 30/52 57%, Positives = 37/52 71%, Gaps = 1/52 1%
Query  17   KIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAKIYEIK 69
            K+GHYTQ+VW  T ++GCG + + E  N   HYL+CNYGPAGN LG  IY  K
Sbjct  155  KVGHYTQMVWGNTKEVGCGSLKYVEK-NMQIHYLICNYGPAGNYLGQPIYTKK 206

Sequence Alignment: 27. Allergen Name: Pol e 5.0101 Sequence ID: P35759

 Score = 66.7 bits 216,  Expect = 2e-13
 Identities = 31/52 59%, Positives = 37/52 71%, Gaps = 1/52 1%
Query  17   KIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAKIYEIK 69
            KIGHYTQ+VW KT +IGCG + + E +    HYL+CNYGPAGN LG   Y  K
Sbjct  154  KIGHYTQMVWGKTKEIGCGSLKYIE-NKMQNHYLICNYGPAGNYLGQLPYTKK 205

Sequence Alignment: 28. Allergen Name: Pol e 5.0101 Sequence ID: AAT95009

 Score = 66.1 bits 214,  Expect = 3e-13
 Identities = 29/45 64%, Positives = 35/45 77%, Gaps = 1/45 2%
Query  17   KIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLG 62
            KIGHYTQ+VW KT +IGCG + + E +    HYL+CNYGPAGN LG
Sbjct  175  KIGHYTQMVWGKTKEIGCGSLKYME-NKMQNHYLICNYGPAGNYLG 219

Sequence Alignment: 29. Allergen Name: Art ar 2.0101 Sequence ID: A0A2L1DGQ3

 Score = 58.6 bits 187,  Expect = 4e-11
 Identities = 28/60 46%, Positives = 41/60 68%, Gaps = 7/60 11%
Query  4    WIS---SFPSDPNILMKI-GHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGN 59
            W+     +  + N  +K+ GHYTQIVWA + ++GCGR +    + W  + +VCNY P GN
Sbjct  100  WLDERLDYDYNENKCIKMCGHYTQIVWANSERVGCGRALCS--NGWA-YIIVCNYDPPGN 156
Query  60   VLGAKIY 66
            V+G K Y
Sbjct  157  VVGQKPY 163

Sequence Alignment: 30. Allergen Name: Art si 2.0101 Sequence ID: AVD29827

 Score = 58.6 bits 187,  Expect = 4e-11
 Identities = 28/60 46%, Positives = 41/60 68%, Gaps = 7/60 11%
Query  4    WIS---SFPSDPNILMKI-GHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGN 59
            W+     +  + N  +K+ GHYTQIVWA + ++GCGR +    + W  + +VCNY P GN
Sbjct  100  WLDERLDYDYNENKCIKMCGHYTQIVWANSERVGCGRALCS--NGWA-YIIVCNYDPPGN 156
Query  60   VLGAKIY 66
            V+G K Y
Sbjct  157  VVGQKPY 163

Sequence Alignment: 31. Allergen Name: Art la 2.0101 Sequence ID: AVD29826

 Score = 58.6 bits 187,  Expect = 4e-11
 Identities = 28/60 46%, Positives = 41/60 68%, Gaps = 7/60 11%
Query  4    WIS---SFPSDPNILMKI-GHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGN 59
            W+     +  + N  +K+ GHYTQIVWA + ++GCGR +    + W  + +VCNY P GN
Sbjct  100  WLDERLDYDYNENKCIKMCGHYTQIVWANSERVGCGRALCS--NGWA-YIIVCNYDPPGN 156
Query  60   VLGAKIY 66
            V+G K Y
Sbjct  157  VVGQKPY 163

Sequence Alignment: 32. Allergen Name: Art ca 2.0101 Sequence ID: AVD29824

 Score = 58.6 bits 187,  Expect = 4e-11
 Identities = 28/60 46%, Positives = 41/60 68%, Gaps = 7/60 11%
Query  4    WIS---SFPSDPNILMKI-GHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGN 59
            W+     +  + N  +K+ GHYTQIVWA + ++GCGR +    + W  + +VCNY P GN
Sbjct  100  WLDERLDYDYNENKCIKMCGHYTQIVWANSERVGCGRALCS--NGWA-YIIVCNYDPPGN 156
Query  60   VLGAKIY 66
            V+G K Y
Sbjct  157  VVGQKPY 163

Sequence Alignment: 33. Allergen Name: Art gm 2.0101 Sequence ID: AVD29825

 Score = 58.6 bits 187,  Expect = 4e-11
 Identities = 29/60 48%, Positives = 40/60 66%, Gaps = 7/60 11%
Query  4    WIS---SFPSDPNILMKI-GHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGN 59
            W+     +  + N  +K+ GHYTQIVWA T ++GCGR +    + W  +  VCNY P GN
Sbjct  100  WLDERLDYDYNENKCIKMCGHYTQIVWANTERVGCGRALCS--NGWA-YITVCNYDPPGN 156
Query  60   VLGAKIY 66
            V+G K Y
Sbjct  157  VVGQKPY 163

Sequence Alignment: 34. Allergen Name: Art an 2.0101 Sequence ID: AVD29822

 Score = 58.6 bits 187,  Expect = 4e-11
 Identities = 29/60 48%, Positives = 40/60 66%, Gaps = 7/60 11%
Query  4    WIS---SFPSDPNILMKI-GHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGN 59
            W+     +  + N  +K+ GHYTQIVWA T ++GCGR +    + W  +  VCNY P GN
Sbjct  100  WLDERLDYDYNENKCIKMCGHYTQIVWANTERVGCGRALCS--NGWA-YITVCNYDPPGN 156
Query  60   VLGAKIY 66
            V+G K Y
Sbjct  157  VVGQKPY 163

Sequence Alignment: 35. Allergen Name: Sco m 5.0101 Sequence ID: QEA69430

 Score = 51.9 bits 163,  Expect = 6e-09
 Identities = 23/46 50%, Positives = 31/46 67%, Gaps = 4/46 8%
Query  18   IGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAKIYE 67
            IGHYTQ+VWA T  +GCG +   + +     Y+ C YGP+GN  G  IY+
Sbjct  144  IGHYTQMVWANTEALGCGLVTASDKNT----YIFCQYGPSGNYPGEPIYK 189

Sequence Alignment: 36. Allergen Name: Cyn d 24.0101 Sequence ID: AAU15051

 Score = 45.8 bits 141,  Expect = 3e-07
 Identities = 19/45 42%, Positives = 27/45 60%, Gaps = 3/45 6%
Query  19   GHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAKIY 66
            GHYT +VW  T  +GCGR++    D+     ++C+Y P GN    K Y
Sbjct  109  GHYTAVVWKDTTSVGCGRVLC---DDKKDTMIMCSYWPPGNYENQKPY 153

Sequence Alignment: 37. Allergen Name: Cte f 2 Sequence ID: AAF65314

 Score = 46.6 bits 144,  Expect = 3e-07
 Identities = 22/51 43%, Positives = 32/51 62%, Gaps = 4/51 7%
Query  18   IGHYTQIVWAKTVKIGCGRIMFKEPDN---WTKHYLVCNYGPAGNVLGAKIYEIK 69
            IGHYTQ++W  T K+GC    +K+  N   +    + CNY   GN+L   +Y+IK
Sbjct  188  IGHYTQLIWGNTTKVGCAVSTYKKHSNGNMFNMTLVACNYR-GGNMLEEAVYQIK 241

Sequence Alignment: 38. Allergen Name: Pru p 9.0101 Sequence ID: XP_007199020

 Score = 39.1 bits 117,  Expect = 3e-05
 Identities = 16/34 47%, Positives = 25/34 73%, Gaps = 4/34 11%
Query  19   GHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGP 56
            GHY  +VW KT ++GCG     + +N  ++Y+VC+Y P
Sbjct  118  GHYLAVVWGKTTEVGCG---ISKCNN-GQNYVVCSYDP 151

Sequence Alignment: 39. Allergen Name: Glo m 5 Sequence ID: AAF82096

 Score = 32.0 bits 92,  Expect = 0.007
 Identities = 16/62 25%, Positives = 31/62 50%, Gaps = 2/62 3%
Query  4    WISSFPSDPNILMKIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGA 63
            +I S+P +      IGH+T +V  +   +GC    + + + +    + CNY    N++  
Sbjct  158  YIDSYPMNYRG-PAIGHFTVMVAERNTHVGCAASEYTKSNGFQYFLMACNYATT-NMMEF 215
Query  64   KIYE 67
             IY+
Sbjct  216  PIYK 219

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.