The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

DQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDG
LEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLACA
IATHAKIRD
Sequence Info Allergen Name Length Opt Bits Score E Value
ABA39437 Der p 2.0109 129 885 208.8 3.8e-56
CAQ68249 Der p 2.0115 129 883 208.3 5.2e-56
P49278 Der p 2 146 875 206.5 2.1e-55
CAK22338 Der p 2.0114 146 867 204.7 7.4e-55
Q00855 Der f 2 146 809 191.4 7.2e-51
BAA01241 Der f 2 138 807 191.0 9.3e-51
BAA01239 Der f 2 138 803 190.1 1.8e-50
AAC82350 Eur m 2.0102 135 796 188.5 5.2e-50
Q9TZZ2 Eur m 2 145 795 188.3 6.5e-50
ABA39438 Der f 2.0109 129 785 186.0 2.8e-49
AAK30133 Der f 2 170 749 177.8 1.1e-46
BAX34757 Der f 35.0101 143 386 94.9 8.1e-22
CAB76459 Gly d 2.0201 125 366 90.3 1.7e-20
O02380 Tyr p 2 141 364 89.9 2.6e-20
A6XEN8 Blo t 2.0104 142 364 89.9 2.6e-20
A6XEN9 Blo t 2.0104 142 364 89.9 2.6e-20
A6XEP2 Blo t 2.0104 142 357 88.3 8e-20
A6XEP1 Blo t 2.0104 142 357 88.3 8e-20
A6XEP6 Blo t 2.0104 142 357 88.3 8e-20
AAQ73483 Blo t 2.0101 144 357 88.3 8.1e-20
A6XEP3 Blo t 2.0104 142 356 88.0 9.3e-20
A6XEP5 Blo t 2.0104 142 353 87.4 1.5e-19
P80384 Lep d 2 141 350 86.7 2.4e-19
A6XEP4 Blo t 2.0104 142 350 86.7 2.4e-19
CAD32314 Lep d 2.0202 141 348 86.2 3.3e-19
AAQ73482 Blo t 2.0102 142 347 86.0 3.9e-19
A6XEP0 Blo t 2.0104 142 347 86.0 3.9e-19
CAD32313 Lep d 2.0102 141 345 85.5 5.3e-19
CAA58755 Lep d 2.0201 141 343 85.1 7.2e-19
CAB59976 Gly d 2.0101 128 336 83.5 2e-18
AAQ73481 Blo t 2.0103 141 328 81.7 7.8e-18
CAA57160 Lep d 2.0101 98 279 70.5 1.3e-14
ABG76195 Der f 22.0101 155 240 61.6 9.5e-12
Q28895 Can f 7.0101 149 172 46.1 4.3e-07
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Der p 2.0109 Sequence ID: ABA39437

 Score = 208.8 bits 885,  Expect = 4e-56
 Identities = 129/129 100%, Positives = 129/129 100%, Gaps = 0/129 0%
Query  1    DQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDG 60
            DQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDG
Sbjct  1    DQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDG 60
Query  61   LEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLACA 120
            LEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLACA
Sbjct  61   LEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLACA 120
Query  121  IATHAKIRD 129
            IATHAKIRD
Sbjct  121  IATHAKIRD 129

Sequence Alignment: 2. Allergen Name: Der p 2.0115 Sequence ID: CAQ68249

 Score = 208.3 bits 883,  Expect = 5e-56
 Identities = 128/129 99%, Positives = 129/129 100%, Gaps = 0/129 0%
Query  1    DQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDG 60
            DQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDG
Sbjct  1    DQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDG 60
Query  61   LEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLACA 120
            LEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKV+GDNGVLACA
Sbjct  61   LEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVMGDNGVLACA 120
Query  121  IATHAKIRD 129
            IATHAKIRD
Sbjct  121  IATHAKIRD 129

Sequence Alignment: 3. Allergen Name: Der p 2 Sequence ID: P49278

 Score = 206.5 bits 875,  Expect = 2e-55
 Identities = 126/129 97%, Positives = 129/129 100%, Gaps = 0/129 0%
Query  1    DQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDG 60
            DQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQN+KTAKIEIKASIDG
Sbjct  18   DQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNTKTAKIEIKASIDG 77
Query  61   LEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLACA 120
            LEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKV+GD+GVLACA
Sbjct  78   LEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVMGDDGVLACA 137
Query  121  IATHAKIRD 129
            IATHAKIRD
Sbjct  138  IATHAKIRD 146

Sequence Alignment: 4. Allergen Name: Der p 2.0114 Sequence ID: CAK22338

 Score = 204.7 bits 867,  Expect = 7e-55
 Identities = 125/129 96%, Positives = 128/129 99%, Gaps = 0/129 0%
Query  1    DQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDG 60
            DQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEA+FEANQN+K AKIEIKASIDG
Sbjct  18   DQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEALFEANQNTKNAKIEIKASIDG 77
Query  61   LEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLACA 120
            LEVDVPGIDPNACHY+KCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLACA
Sbjct  78   LEVDVPGIDPNACHYVKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLACA 137
Query  121  IATHAKIRD 129
            IATHAKIRD
Sbjct  138  IATHAKIRD 146

Sequence Alignment: 5. Allergen Name: Der f 2 Sequence ID: Q00855

 Score = 191.4 bits 809,  Expect = 7e-51
 Identities = 114/129 88%, Positives = 125/129 96%, Gaps = 0/129 0%
Query  1    DQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDG 60
            DQVDVKDCAN+EIKKV+V GCHGS+PCIIHRGKPF LEA+F+ANQN+KTAKIEIKAS+DG
Sbjct  18   DQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDG 77
Query  61   LEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLACA 120
            LE+DVPGID NACH+MKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVK++GDNGVLACA
Sbjct  78   LEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACA 137
Query  121  IATHAKIRD 129
            IATH KIRD
Sbjct  138  IATHGKIRD 146

Sequence Alignment: 6. Allergen Name: Der f 2 Sequence ID: BAA01241

 Score = 191.0 bits 807,  Expect = 9e-51
 Identities = 114/129 88%, Positives = 125/129 96%, Gaps = 0/129 0%
Query  1    DQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDG 60
            DQVDVKDCAN+EIKKV+V GCHGS+PCIIHRGKPF LEA+F+ANQN+KTAKIEIKAS+DG
Sbjct  10   DQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDG 69
Query  61   LEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLACA 120
            LE+DVPGID NACH+MKCPLVKGQQYD KYTWNVPKIAPKSENVVVTVK++GDNGVLACA
Sbjct  70   LEIDVPGIDTNACHFMKCPLVKGQQYDAKYTWNVPKIAPKSENVVVTVKLVGDNGVLACA 129
Query  121  IATHAKIRD 129
            IATHAKIRD
Sbjct  130  IATHAKIRD 138

Sequence Alignment: 7. Allergen Name: Der f 2 Sequence ID: BAA01239

 Score = 190.1 bits 803,  Expect = 2e-50
 Identities = 113/129 87%, Positives = 125/129 96%, Gaps = 0/129 0%
Query  1    DQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDG 60
            DQVDVKDCAN+EIKKV+V GCHGS+PCIIHRGKPF LEA+F+ANQN+KTAKIEIKAS+DG
Sbjct  10   DQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDG 69
Query  61   LEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLACA 120
            LE+DVPGID NACH++KCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVK++GDNGVLACA
Sbjct  70   LEIDVPGIDTNACHFVKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACA 129
Query  121  IATHAKIRD 129
            IATH KIRD
Sbjct  130  IATHGKIRD 138

Sequence Alignment: 8. Allergen Name: Eur m 2.0102 Sequence ID: AAC82350

 Score = 188.5 bits 796,  Expect = 5e-50
 Identities = 112/129 86%, Positives = 122/129 94%, Gaps = 0/129 0%
Query  1    DQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDG 60
            DQVDVKDCANHEIKKV+VPGC GSEPC+IHRG  FQLEAVF+ANQNS  AKIEIKA+IDG
Sbjct  7    DQVDVKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEIKATIDG 66
Query  61   LEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLACA 120
            +E+DVPGID N CH+MKCPLVKGQ+YDIKYTWNVP+IAPKSENVVVTVK+LGDNGVLACA
Sbjct  67   VEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDNGVLACA 126
Query  121  IATHAKIRD 129
            IATHAKIRD
Sbjct  127  IATHAKIRD 135

Sequence Alignment: 9. Allergen Name: Eur m 2 Sequence ID: Q9TZZ2

 Score = 188.3 bits 795,  Expect = 7e-50
 Identities = 111/129 86%, Positives = 122/129 94%, Gaps = 0/129 0%
Query  1    DQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDG 60
            DQVD+KDCANHEIKKV+VPGC GSEPC+IHRG  FQLEAVF+ANQNS  AKIEIKA+IDG
Sbjct  17   DQVDIKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEIKATIDG 76
Query  61   LEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLACA 120
            +E+DVPGID N CH+MKCPLVKGQ+YDIKYTWNVP+IAPKSENVVVTVK+LGDNGVLACA
Sbjct  77   VEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDNGVLACA 136
Query  121  IATHAKIRD 129
            IATHAKIRD
Sbjct  137  IATHAKIRD 145

Sequence Alignment: 10. Allergen Name: Der f 2.0109 Sequence ID: ABA39438

 Score = 186.0 bits 785,  Expect = 3e-49
 Identities = 113/129 87%, Positives = 125/129 96%, Gaps = 0/129 0%
Query  1    DQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDG 60
            DQVDVKDCAN+EIKKV+V G HGS+PCIIHRGKPF LEA+F+ANQN+KTAKIEIKA+I+G
Sbjct  1    DQVDVKDCANNEIKKVMVDGRHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKANING 60
Query  61   LEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLACA 120
            LEVDVPGID NACH++KCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVK++GDNGVLACA
Sbjct  61   LEVDVPGIDTNACHFVKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACA 120
Query  121  IATHAKIRD 129
            IATHAKIRD
Sbjct  121  IATHAKIRD 129

Sequence Alignment: 11. Allergen Name: Der f 2 Sequence ID: AAK30133

 Score = 177.8 bits 749,  Expect = 1e-46
 Identities = 106/121 87%, Positives = 117/121 96%, Gaps = 0/121 0%
Query  9    ANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDGLEVDVPGI 68
            AN+EIKKV+V GCHGS+PCIIHRGKPF LEA+F+ANQN+KTAKIEIKAS+DGLE+DVPGI
Sbjct  50   ANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGI 109
Query  69   DPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLACAIATHAKIR 128
            D NACH+MKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVK++GDNGVLACAIATH KIR
Sbjct  110  DTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIR 169
Query  129  D 129
            D
Sbjct  170  D 170

Sequence Alignment: 12. Allergen Name: Der f 35.0101 Sequence ID: BAX34757

 Score = 94.9 bits 386,  Expect = 8e-22
 Identities = 51/120 42%, Positives = 84/120 70%, Gaps = 3/120 2%
Query  7    DCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDGLEVDVP 66
            DC + E+  + V GC G + C++H+GK   L+   ++NQ+S+  K+ I A ++G+E++VP
Sbjct  24   DCGHKEVISLDVSGCEG-DYCVLHKGKTIDLDMKCKSNQDSEHLKLIISADVNGIEIEVP 82
Query  67   GIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLACAIATHAK 126
            G D + CHY++CP+ KGQ YDIKY++NVP + P  +  + T KV+GDNG++ C +  + +
Sbjct  83   GFDQDGCHYVQCPIHKGQDYDIKYSYNVPAVLPNIKGTL-TAKVIGDNGLVGC-LKLNGE 140
Query  127  IRD 129
            I D
Sbjct  141  IAD 143

Sequence Alignment: 13. Allergen Name: Gly d 2.0201 Sequence ID: CAB76459

 Score = 90.3 bits 366,  Expect = 2e-20
 Identities = 51/116 43%, Positives = 77/116 66%, Gaps = 2/116 1%
Query  2    QVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDGL 61
            ++  KDC   E+ ++ +  C G + C+IHRGKP+ LEA F ANQ++  A I++ A + G 
Sbjct  2    KMKFKDCGKGEVTELDITDCSG-DFCVIHRGKPLTLEAKFAANQDTTKATIKVLAKVAGT 60
Query  62   EVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLAC 119
             + VPG++ + C ++KCP+ KG   D KYT  VP I PK +   VT +++GD+GVLAC
Sbjct  61   PIQVPGLETDGCKFVKCPIKKGDPIDFKYTTTVPAILPKVK-AEVTAELVGDHGVLAC 117

Sequence Alignment: 14. Allergen Name: Tyr p 2 Sequence ID: O02380

 Score = 89.9 bits 364,  Expect = 3e-20
 Identities = 54/121 44%, Positives = 80/121 66%, Gaps = 7/121 5%
Query  2    QVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDGL 61
            QV   DC   EI  V V GC G + C+IH+ KP ++ A F ANQ++   ++++   ++GL
Sbjct  17   QVKFTDCGKKEIASVAVDGCEG-DLCVIHKSKPVHVIAEFTANQDTCKIEVKVTGQLNGL 75
Query  62   EVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVL--GDNGVLAC 119
            EV +PGI+ + C  +KCPL KG +Y + Y+ NVP + P   N+   VK+L  G++GVLAC
Sbjct  76   EVPIPGIETDGCKVLKCPLKKGTKYTMNYSVNVPSVVP---NIKTVVKLLATGEHGVLAC 132
Query  120  -AIATHAK 126
             A+ T  K
Sbjct  133  GAVNTDVK 140

Sequence Alignment: 15. Allergen Name: Blo t 2.0104 Sequence ID: A6XEN8

 Score = 89.9 bits 364,  Expect = 3e-20
 Identities = 52/114 45%, Positives = 80/114 70%, Gaps = 4/114 3%
Query  4    DVK--DCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDGL 61
            DVK  DCA+ E+  + + GC G + C IH+GK F L+  F ANQ+S+  +I+I A+++G+
Sbjct  18   DVKFTDCAHGEVTSLDLSGCSG-DHCTIHKGKSFTLKTFFIANQDSEKLEIKISATMNGI 76
Query  62   EVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLAC 119
            EV VPG+D + C +  CPL KGQ+Y++ Y+  +P I P  + V  T  ++GD+GV+AC
Sbjct  77   EVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT-TASLVGDHGVVAC 133

Sequence Alignment: 16. Allergen Name: Blo t 2.0104 Sequence ID: A6XEN9

 Score = 89.9 bits 364,  Expect = 3e-20
 Identities = 51/114 44%, Positives = 80/114 70%, Gaps = 4/114 3%
Query  4    DVK--DCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDGL 61
            DVK  DCA+ E+  + + GC G + C IH+GK F L+  F ANQ+S+  +I+I A+++G+
Sbjct  18   DVKFTDCAHGEVTSLDLSGCSG-DHCTIHKGKSFTLKTFFIANQDSEKLEIKISATMNGI 76
Query  62   EVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLAC 119
            EV VPG+D + C +  CPL KGQ+Y++ Y+  +P + P  + V  T  ++GD+GV+AC
Sbjct  77   EVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTVLPNVKTVT-TASLVGDHGVVAC 133

Sequence Alignment: 17. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP2

 Score = 88.3 bits 357,  Expect = 8e-20
 Identities = 52/114 45%, Positives = 79/114 69%, Gaps = 4/114 3%
Query  4    DVK--DCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDGL 61
            DVK  DCA+ E+  + + GC G + CIIH+GK F L+  F ANQ+S+  +I+I A ++ +
Sbjct  18   DVKFTDCAHGEVTSLDLSGCSG-DHCIIHKGKSFTLKTFFIANQDSEKLEIKISAIMNNI 76
Query  62   EVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLAC 119
            EV VPG+D + C +  CPL KGQ+Y++ Y+  +P I P  + V  T  ++GD+GV+AC
Sbjct  77   EVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT-TASLVGDHGVVAC 133

Sequence Alignment: 18. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP1

 Score = 88.3 bits 357,  Expect = 8e-20
 Identities = 52/114 45%, Positives = 79/114 69%, Gaps = 4/114 3%
Query  4    DVK--DCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDGL 61
            DVK  DCA+ E+  + + GC G + CIIH+GK F L+  F ANQ+S+  +I+I A ++ +
Sbjct  18   DVKFTDCAHGEVTSLDLSGCSG-DHCIIHKGKSFTLKTFFIANQDSEKLEIKISAIMNNI 76
Query  62   EVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLAC 119
            EV VPG+D + C +  CPL KGQ+Y++ Y+  +P I P  + V  T  ++GD+GV+AC
Sbjct  77   EVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT-TASLVGDHGVVAC 133

Sequence Alignment: 19. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP6

 Score = 88.3 bits 357,  Expect = 8e-20
 Identities = 52/114 45%, Positives = 79/114 69%, Gaps = 4/114 3%
Query  4    DVK--DCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDGL 61
            DVK  DCA+ E+  + + GC G + CIIH+GK F L+  F ANQ+S+  +I+I A ++ +
Sbjct  18   DVKFTDCAHGEVTSLDLSGCSG-DHCIIHKGKSFTLKTFFIANQDSEKLEIKISAIMNNI 76
Query  62   EVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLAC 119
            EV VPG+D + C +  CPL KGQ+Y++ Y+  +P I P  + V  T  ++GD+GV+AC
Sbjct  77   EVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT-TASLVGDHGVVAC 133

Sequence Alignment: 20. Allergen Name: Blo t 2.0101 Sequence ID: AAQ73483

 Score = 88.3 bits 357,  Expect = 8e-20
 Identities = 52/114 45%, Positives = 79/114 69%, Gaps = 4/114 3%
Query  4    DVK--DCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDGL 61
            DVK  DCA+ E+  + + GC G + CIIH+GK F L+  F ANQ+S+  +I+I A ++ +
Sbjct  20   DVKFTDCAHGEVTSLDLSGCSG-DHCIIHKGKSFTLKTFFIANQDSEKLEIKISAIMNNI 78
Query  62   EVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLAC 119
            EV VPG+D + C +  CPL KGQ+Y++ Y+  +P I P  + V  T  ++GD+GV+AC
Sbjct  79   EVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT-TASLVGDHGVVAC 135

Sequence Alignment: 21. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP3

 Score = 88.0 bits 356,  Expect = 9e-20
 Identities = 51/114 44%, Positives = 79/114 69%, Gaps = 4/114 3%
Query  4    DVK--DCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDGL 61
            DVK  DCA+ E+  + + GC G + CIIH+GK F L+  F ANQ+S+  +I+I A ++ +
Sbjct  18   DVKFTDCAHGEVTSLDLSGCSG-DHCIIHKGKSFTLKTFFIANQDSEKLEIKISAIMNNI 76
Query  62   EVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLAC 119
            EV VPG+D + C +  CPL KGQ+Y++ Y+  +P I P  + +  T  ++GD+GV+AC
Sbjct  77   EVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTIT-TASLVGDHGVVAC 133

Sequence Alignment: 22. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP5

 Score = 87.4 bits 353,  Expect = 1e-19
 Identities = 50/114 43%, Positives = 79/114 69%, Gaps = 4/114 3%
Query  4    DVK--DCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDGL 61
            DVK  DCA+ E+  + +  C G + C IH+GK F L+  F ANQ+S+  +I+I A+++G+
Sbjct  18   DVKFTDCAHGEVTSLDLSRCSG-DHCTIHKGKSFTLKTFFIANQDSEKLEIKISATMNGI 76
Query  62   EVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLAC 119
            EV VPG+D + C +  CPL KGQ+Y++ Y+  +P + P  + V  T  ++GD+GV+AC
Sbjct  77   EVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTVLPNVKTVT-TASLVGDHGVVAC 133

Sequence Alignment: 23. Allergen Name: Lep d 2 Sequence ID: P80384

 Score = 86.7 bits 350,  Expect = 2e-19
 Identities = 46/123 37%, Positives = 79/123 64%, Gaps = 3/123 2%
Query  2    QVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDGL 61
            ++  KDC + E+ ++ + GC G + C+IHRG+   LEA F ANQ++    I++ A + G 
Sbjct  18   KMTFKDCGHGEVTELDITGCSG-DTCVIHRGEKMTLEAKFAANQDTAKVTIKVLAKVAGT 76
Query  62   EVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLACAI 121
             + VPG++ + C ++KCP+ KG+  D  Y+  +P I PK +   VT +++GD+GV+AC  
Sbjct  77   TIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVK-ADVTAELIGDHGVMACG- 134
Query  122  ATHAKI 127
              H ++
Sbjct  135  TVHGQV 140

Sequence Alignment: 24. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP4

 Score = 86.7 bits 350,  Expect = 2e-19
 Identities = 51/114 44%, Positives = 78/114 68%, Gaps = 4/114 3%
Query  4    DVK--DCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDGL 61
            DVK  DCA+ E+  + + GC   + CIIH+GK F L+  F ANQ+S+  +I+I A ++ +
Sbjct  18   DVKFTDCAHGEVTSLDLSGC-SDDHCIIHKGKSFTLKTFFIANQDSEKLEIKISAIMNNI 76
Query  62   EVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLAC 119
            EV VPG+D + C +  CPL KGQ+Y++ Y+  +P I P  + V  T  ++GD+GV+AC
Sbjct  77   EVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT-TASLVGDHGVVAC 133

Sequence Alignment: 25. Allergen Name: Lep d 2.0202 Sequence ID: CAD32314

 Score = 86.2 bits 348,  Expect = 3e-19
 Identities = 46/123 37%, Positives = 78/123 63%, Gaps = 3/123 2%
Query  2    QVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDGL 61
            ++  KDC + E+ ++ + GC G + C+IHRG+   L+A F ANQ++    I++ A + G 
Sbjct  18   KMTFKDCGHGEVTELDISGCSG-DTCVIHRGQKMTLDAKFAANQDTNKVTIKVLAKVAGT 76
Query  62   EVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLACAI 121
             + VPG++ + C  +KCP+ KG+  D  Y   +P I PK + V VT +++GD+GV+AC  
Sbjct  77   TIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIK-VDVTAELVGDHGVMACG- 134
Query  122  ATHAKI 127
              H ++
Sbjct  135  TIHGQV 140

Sequence Alignment: 26. Allergen Name: Blo t 2.0102 Sequence ID: AAQ73482

 Score = 86.0 bits 347,  Expect = 4e-19
 Identities = 51/114 44%, Positives = 78/114 68%, Gaps = 4/114 3%
Query  4    DVK--DCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDGL 61
            DVK   CA+ E+  + + GC G + CIIH+GK F L+  F ANQ+S+  +I+I A ++ +
Sbjct  18   DVKFTACAHGEVTSLDLSGCSG-DHCIIHKGKSFTLKTFFIANQDSEKLEIKISAIMNNI 76
Query  62   EVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLAC 119
            EV VPG+D + C +  CPL KGQ+Y++ Y+  +P I P  + V  T  ++GD+GV+AC
Sbjct  77   EVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT-TASLVGDHGVVAC 133

Sequence Alignment: 27. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP0

 Score = 86.0 bits 347,  Expect = 4e-19
 Identities = 51/114 44%, Positives = 78/114 68%, Gaps = 4/114 3%
Query  4    DVK--DCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDGL 61
            DVK  DCA+ E+  + + GC G + CII +GK F L+  F ANQ+S+  +I+I A ++ +
Sbjct  18   DVKFTDCAHGEVTSLDLSGCSG-DHCIIRKGKSFTLKTFFIANQDSEKLEIKISAIMNNI 76
Query  62   EVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLAC 119
            EV VPG+D + C +  CPL KGQ+Y++ Y+  +P I P  + V  T  ++GD+GV+AC
Sbjct  77   EVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT-TASLVGDHGVVAC 133

Sequence Alignment: 28. Allergen Name: Lep d 2.0102 Sequence ID: CAD32313

 Score = 85.5 bits 345,  Expect = 5e-19
 Identities = 45/123 36%, Positives = 78/123 63%, Gaps = 3/123 2%
Query  2    QVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDGL 61
            ++  KDC + E+ ++ + GC G + C+IHRG+   LEA F ANQ++    I++   + G 
Sbjct  18   KMTFKDCGHGEVTELDITGCSG-DTCVIHRGEKMTLEAKFAANQDTAKVTIKVLTKVAGT 76
Query  62   EVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLACAI 121
             + VPG++ + C ++KCP+ KG+  D  Y+  +P I PK +   VT +++GD+GV+AC  
Sbjct  77   TIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVK-ADVTAELIGDHGVMACG- 134
Query  122  ATHAKI 127
              H ++
Sbjct  135  TVHGQV 140

Sequence Alignment: 29. Allergen Name: Lep d 2.0201 Sequence ID: CAA58755

 Score = 85.1 bits 343,  Expect = 7e-19
 Identities = 45/123 36%, Positives = 77/123 62%, Gaps = 3/123 2%
Query  2    QVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDGL 61
            ++  KDC + E+ ++ + GC G + C+IHRG+   L+A F ANQ++    I++ A + G 
Sbjct  18   KMTFKDCGHGEVTELDISGCSG-DTCVIHRGQKMTLDAKFAANQDTNKVTIKVLAKVAGT 76
Query  62   EVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLACAI 121
             + VPG++ + C  +KCP+ KG+  D  Y   +P I PK +   VT +++GD+GV+AC  
Sbjct  77   TIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIK-ADVTAELVGDHGVMACG- 134
Query  122  ATHAKI 127
              H ++
Sbjct  135  TIHGQV 140

Sequence Alignment: 30. Allergen Name: Gly d 2.0101 Sequence ID: CAB59976

 Score = 83.5 bits 336,  Expect = 2e-18
 Identities = 47/116 40%, Positives = 82/116 70%, Gaps = 4/116 3%
Query  2    QVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDG- 60
            +++  DC ++EIK++ V  C G+  C+IHRGKP+ L+A F+ANQ++ +  + + A IDG 
Sbjct  2    KMNFTDCGHNEIKELSVSNCTGNY-CVIHRGKPLTLDAKFDANQDTASVGLVLTAIIDGD 60
Query  61   LEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWN-VPKIAPKSENVVVTVKVLGDNGVLAC 119
            + +D+PG++ NAC  MKCP+ KG++ ++ Y    +P   P+ +   V  +++G++GVLAC
Sbjct  61   IAIDIPGLETNACKLMKCPIRKGEHQELIYNIGEIPDATPEIK-AKVKAQLIGEHGVLAC 119

Sequence Alignment: 31. Allergen Name: Blo t 2.0103 Sequence ID: AAQ73481

 Score = 81.7 bits 328,  Expect = 8e-18
 Identities = 47/111 42%, Positives = 74/111 66%, Gaps = 3/111 2%
Query  6    KDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDGLEVDV 65
            + C   E+  + + GC G + CIIH+GK F L+  F ANQ+S+  +I+I A ++ +EV V
Sbjct  22   RSCT-WEVTSLDLSGCSG-DHCIIHKGKSFTLKTFFIANQDSEKLEIKISAIMNNIEVPV 79
Query  66   PGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLAC 119
            PG+D + C +  CPL KGQ+Y++ Y+  +P I P  + V  T  ++GD+GV+AC
Sbjct  80   PGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT-TASLVGDHGVVAC 132

Sequence Alignment: 32. Allergen Name: Lep d 2.0101 Sequence ID: CAA57160

 Score = 70.5 bits 279,  Expect = 1e-14
 Identities = 38/97 39%, Positives = 62/97 63%, Gaps = 2/97 2%
Query  29   IHRGKPFQLEAVFEANQNSKTAKIEIKASIDGLEVDVPGIDPNACHYMKCPLVKGQQYDI 88
            IHRG+   LEA F ANQ++    I++ A + G  + VPG++ + C ++KCP+ KG+  D 
Sbjct  1    IHRGEKMTLEAKFAANQDTAKVTIKVLAKVAGTTIQVPGLETDGCKFIKCPVKKGEALDF 60
Query  89   KYTWNVPKIAPKSENVVVTVKVLGDNGVLACAIATHAKI 127
             Y+  +P I PK +   VT +++GD+GV+AC    H ++
Sbjct  61   IYSGTIPAITPKVK-ADVTAELIGDHGVMACG-TVHGQV 97

Sequence Alignment: 33. Allergen Name: Der f 22.0101 Sequence ID: ABG76195

 Score = 61.6 bits 240,  Expect = 9e-12
 Identities = 46/115 40%, Positives = 69/115 60%, Gaps = 9/115 7%
Query  3    VDVKDCANHEIKKVLVPGCHGSEP-CIIHRGKPFQLEAVFEANQNSKTAKIEIK--ASID 59
            V  KDC ++EIK  +V G + ++  C+IH+    QL   F AN+N+   KI  +   ++ 
Sbjct  25   VQYKDCGHNEIKSFFVTGGNPNQKSCVIHKHSKNQLRISFVANENTGN-KINTRFICNLG 83
Query  60   GLEVDVPGID-PNAC--HYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVL-GDNG 115
            G+E+  PGID  +AC  H + CPL KGQ Y+    +N+    P + NV  TV++  G  G
Sbjct  84   GIELGWPGIDGTDACQGHGLSCPLTKGQTYNYHLDFNLGDDVP-TANVTATVRLENGHGG 142
Query  116  VLAC 119
             L C
Sbjct  143  DLLC 146

Sequence Alignment: 34. Allergen Name: Can f 7.0101 Sequence ID: Q28895

 Score = 46.1 bits 172,  Expect = 4e-07
 Identities = 35/109 32%, Positives = 59/109 54%, Gaps = 7/109 6%
Query  3    VDVKDC--ANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDG 60
            V  KDC  A   IK++ V  C  ++PC +H+G+ + +   F +N  S+++K  +   + G
Sbjct  22   VHFKDCGSAVGVIKELNVNPCP-AQPCKLHKGQSYSVNVTFTSNIPSQSSKAVVHGIVLG 80
Query  61   LEVDVPGIDPNACHY-MKCPLVKGQQYDIKYTWNVP-KIAPKSENVVVTVKVLGDN 114
            + V  P  + + C   + CP+ K + Y   Y   +P K    S  +VV   +LGDN
Sbjct  81   VAVPFPIPEADGCKSGINCPIQKDKTYS--YLNKLPVKNEYPSIKLVVQWMLLGDN 134

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.