The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

EDVPQPPVSLFYVQGQVYCDTCRAGFITELSEFIQGAGVRLQCKDKENGKVTFTEVGYTR
AEGLYSMVIERDHKNEFCEIVLLSSSRKDCDEIPTEGWVKPSLKFILNTVNGTTRTINPL
GFFKKEVLPKCPQVYNKLGMYPPNM
Sequence Info Allergen Name Length Opt Bits Score E Value
AAQ08947 Fra e 1.0101 145 998 296.6 1.7e-82
AAV74343 Fra e 1.0102 145 978 290.8 9.8e-81
CAA54819 Lig v 1.0102 145 935 278.3 5.8e-77
O82015 Lig v 1 145 931 277.1 1.3e-76
X76397 Ole e 1.0104 145 931 277.1 1.3e-76
X76395 Ole e 1.0102 145 916 272.7 2.7e-75
X76396 Ole e 1.0103 145 908 270.4 1.4e-74
CAA73037 Ole e 1.0106 146 904 269.2 3.1e-74
P19963 Ole e 1 145 902 268.7 4.6e-74
CAA73038 Ole e 1.0105 146 899 267.8 8.4e-74
CAA73036 Ole e 1.0107 146 889 264.9 6.3e-73
AAQ83588 Fra e 1.0201 146 887 264.3 9.5e-73
AAB32652 Ole e 1.0101 130 802 239.5 2.4e-65
A0A0K1SC24 Aca f 1 150 439 133.8 1.9e-33
AKV72167 Pro j 1.0101 150 401 122.7 4.1e-30
ADK22842 Sal k 5.0101 151 386 118.3 8.5e-29
A0A0K1SC10 Ama r 1.0101 168 382 117.2 2.1e-28
AAL07319 Che a 1 168 348 107.3 2.1e-25
CAA33854 Lyc e LAT52 161 346 106.7 2.9e-25
A0A0K1SC44 Koc s 1.0101 167 337 104.0 1.9e-24
Q7M1X5 Lol p 11.0101 134 284 88.6 6.6e-20
AAN32987 Phl p 11.0101 143 283 88.3 8.7e-20
P82242 Pla l 1 131 273 85.4 5.9e-19
CAC41635 Pla l 1.0103 131 267 83.7 2e-18
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Fra e 1.0101 Sequence ID: AAQ08947

 Score = 296.6 bits 998,  Expect = 2e-82
 Identities = 145/145 100%, Positives = 145/145 100%, Gaps = 0/145 0%
Query  1    EDVPQPPVSLFYVQGQVYCDTCRAGFITELSEFIQGAGVRLQCKDKENGKVTFTEVGYTR 60
            EDVPQPPVSLFYVQGQVYCDTCRAGFITELSEFIQGAGVRLQCKDKENGKVTFTEVGYTR
Sbjct  1    EDVPQPPVSLFYVQGQVYCDTCRAGFITELSEFIQGAGVRLQCKDKENGKVTFTEVGYTR 60
Query  61   AEGLYSMVIERDHKNEFCEIVLLSSSRKDCDEIPTEGWVKPSLKFILNTVNGTTRTINPL 120
            AEGLYSMVIERDHKNEFCEIVLLSSSRKDCDEIPTEGWVKPSLKFILNTVNGTTRTINPL
Sbjct  61   AEGLYSMVIERDHKNEFCEIVLLSSSRKDCDEIPTEGWVKPSLKFILNTVNGTTRTINPL 120
Query  121  GFFKKEVLPKCPQVYNKLGMYPPNM 145
            GFFKKEVLPKCPQVYNKLGMYPPNM
Sbjct  121  GFFKKEVLPKCPQVYNKLGMYPPNM 145

Sequence Alignment: 2. Allergen Name: Fra e 1.0102 Sequence ID: AAV74343

 Score = 290.8 bits 978,  Expect = 1e-80
 Identities = 142/145 97%, Positives = 143/145 98%, Gaps = 0/145 0%
Query  1    EDVPQPPVSLFYVQGQVYCDTCRAGFITELSEFIQGAGVRLQCKDKENGKVTFTEVGYTR 60
            EDVPQPPVSLFYVQGQVYCDTCRAGFITELSEFIQGAGVRLQCK+KENGKVTFTEVGYTR
Sbjct  1    EDVPQPPVSLFYVQGQVYCDTCRAGFITELSEFIQGAGVRLQCKEKENGKVTFTEVGYTR 60
Query  61   AEGLYSMVIERDHKNEFCEIVLLSSSRKDCDEIPTEGWVKPSLKFILNTVNGTTRTINPL 120
            AEGLYSMVIERDHKNEFCEIVLLSSSRKDC EIPTEGWVKPSLKFILNTVNGTTRTINPL
Sbjct  61   AEGLYSMVIERDHKNEFCEIVLLSSSRKDCHEIPTEGWVKPSLKFILNTVNGTTRTINPL 120
Query  121  GFFKKEVLPKCPQVYNKLGMYPPNM 145
            GFFKKE LPKCPQVYNKLGMYPPNM
Sbjct  121  GFFKKEALPKCPQVYNKLGMYPPNM 145

Sequence Alignment: 3. Allergen Name: Lig v 1.0102 Sequence ID: CAA54819

 Score = 278.3 bits 935,  Expect = 6e-77
 Identities = 133/145 91%, Positives = 138/145 95%, Gaps = 0/145 0%
Query  1    EDVPQPPVSLFYVQGQVYCDTCRAGFITELSEFIQGAGVRLQCKDKENGKVTFTEVGYTR 60
            EDVPQPPVS FY+QGQVYCDTCRA FITELSEFI GAGVRLQCKD ENGK+TFTEVGYTR
Sbjct  1    EDVPQPPVSQFYIQGQVYCDTCRARFITELSEFIPGAGVRLQCKDGENGKITFTEVGYTR 60
Query  61   AEGLYSMVIERDHKNEFCEIVLLSSSRKDCDEIPTEGWVKPSLKFILNTVNGTTRTINPL 120
            AEGLYSM+IERDHKNEFCEI LLSSSRKDCDEIP EGWVKPSLKF+LNTVNGTTRTINPL
Sbjct  61   AEGLYSMLIERDHKNEFCEITLLSSSRKDCDEIPIEGWVKPSLKFMLNTVNGTTRTINPL 120
Query  121  GFFKKEVLPKCPQVYNKLGMYPPNM 145
            GFFKKE LPKCPQV+NKLGMYPPNM
Sbjct  121  GFFKKEALPKCPQVFNKLGMYPPNM 145

Sequence Alignment: 4. Allergen Name: Lig v 1 Sequence ID: O82015

 Score = 277.1 bits 931,  Expect = 1e-76
 Identities = 132/145 91%, Positives = 140/145 96%, Gaps = 0/145 0%
Query  1    EDVPQPPVSLFYVQGQVYCDTCRAGFITELSEFIQGAGVRLQCKDKENGKVTFTEVGYTR 60
            EDVPQPPVS FY+QGQVYCDTCRA FITELSEFI GAGVRLQCKD ENGKVTFTEVGYT+
Sbjct  1    EDVPQPPVSQFYIQGQVYCDTCRARFITELSEFIPGAGVRLQCKDGENGKVTFTEVGYTK 60
Query  61   AEGLYSMVIERDHKNEFCEIVLLSSSRKDCDEIPTEGWVKPSLKFILNTVNGTTRTINPL 120
            AEGLY+M+IERDHKNEFCEI L+SSSRKDCDEIPTEGWVKPSLKF+LNTVNGTTRTINPL
Sbjct  61   AEGLYNMLIERDHKNEFCEITLISSSRKDCDEIPTEGWVKPSLKFVLNTVNGTTRTINPL 120
Query  121  GFFKKEVLPKCPQVYNKLGMYPPNM 145
            GF+KKEVLPKCPQV+NKLGMYPPNM
Sbjct  121  GFLKKEVLPKCPQVFNKLGMYPPNM 145

Sequence Alignment: 5. Allergen Name: Ole e 1.0104 Sequence ID: X76397

 Score = 277.1 bits 931,  Expect = 1e-76
 Identities = 132/145 91%, Positives = 138/145 95%, Gaps = 0/145 0%
Query  1    EDVPQPPVSLFYVQGQVYCDTCRAGFITELSEFIQGAGVRLQCKDKENGKVTFTEVGYTR 60
            EDVPQPP+S FYVQGQVYCDTCR  FITE+SEFI GAGVRLQCKD ENGK+TFTEVGYTR
Sbjct  1    EDVPQPPISQFYVQGQVYCDTCRTRFITEFSEFIPGAGVRLQCKDGENGKITFTEVGYTR 60
Query  61   AEGLYSMVIERDHKNEFCEIVLLSSSRKDCDEIPTEGWVKPSLKFILNTVNGTTRTINPL 120
            AEGLYSM+IERDHKNEFCEI LLSSSRKDCDEIPTEGWVKPS+KFILNTVNGTTRTINPL
Sbjct  61   AEGLYSMLIERDHKNEFCEITLLSSSRKDCDEIPTEGWVKPSVKFILNTVNGTTRTINPL 120
Query  121  GFFKKEVLPKCPQVYNKLGMYPPNM 145
            GFFKKE LPKCPQV+NKLGMYPPNM
Sbjct  121  GFFKKEALPKCPQVFNKLGMYPPNM 145

Sequence Alignment: 6. Allergen Name: Ole e 1.0102 Sequence ID: X76395

 Score = 272.7 bits 916,  Expect = 3e-75
 Identities = 129/145 88%, Positives = 137/145 94%, Gaps = 0/145 0%
Query  1    EDVPQPPVSLFYVQGQVYCDTCRAGFITELSEFIQGAGVRLQCKDKENGKVTFTEVGYTR 60
            EDVPQPPVS F++QGQVYCDTCRAGFITELSEFI GA +RLQCKDKENG VTFTEVGYTR
Sbjct  1    EDVPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTR 60
Query  61   AEGLYSMVIERDHKNEFCEIVLLSSSRKDCDEIPTEGWVKPSLKFILNTVNGTTRTINPL 120
            AEGLYSM++ERDHKNEFCEI L+SS RKDC+EIPTEGWVKPSLKFILNTVNGTTRT+NPL
Sbjct  61   AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWVKPSLKFILNTVNGTTRTVNPL 120
Query  121  GFFKKEVLPKCPQVYNKLGMYPPNM 145
            GFFKKE LPKC QVYNKLGMYPPNM
Sbjct  121  GFFKKEALPKCAQVYNKLGMYPPNM 145

Sequence Alignment: 7. Allergen Name: Ole e 1.0103 Sequence ID: X76396

 Score = 270.4 bits 908,  Expect = 1e-74
 Identities = 128/145 88%, Positives = 136/145 93%, Gaps = 0/145 0%
Query  1    EDVPQPPVSLFYVQGQVYCDTCRAGFITELSEFIQGAGVRLQCKDKENGKVTFTEVGYTR 60
            EDVPQPPVS F++QGQVYCDTCRA FITELSEFI GA VRLQCKD ENG +TFTEVGYTR
Sbjct  1    EDVPQPPVSQFHIQGQVYCDTCRARFITELSEFIPGASVRLQCKDGENGSITFTEVGYTR 60
Query  61   AEGLYSMVIERDHKNEFCEIVLLSSSRKDCDEIPTEGWVKPSLKFILNTVNGTTRTINPL 120
            AEGLYSM+IERDHK+EFCEI L+SSSRKDCDEIP EGWVKPSLKF+LNTVNGTTRTINPL
Sbjct  61   AEGLYSMLIERDHKDEFCEITLISSSRKDCDEIPVEGWVKPSLKFMLNTVNGTTRTINPL 120
Query  121  GFFKKEVLPKCPQVYNKLGMYPPNM 145
            GFFKKE LPKCPQV+NKLGMYPPNM
Sbjct  121  GFFKKEALPKCPQVFNKLGMYPPNM 145

Sequence Alignment: 8. Allergen Name: Ole e 1.0106 Sequence ID: CAA73037

 Score = 269.2 bits 904,  Expect = 3e-74
 Identities = 126/145 86%, Positives = 136/145 93%, Gaps = 0/145 0%
Query  1    EDVPQPPVSLFYVQGQVYCDTCRAGFITELSEFIQGAGVRLQCKDKENGKVTFTEVGYTR 60
            EDVPQPPVS F++QGQVYCDTCRAGFITELSEFI GA VRLQCKDKENG VTFTE+GYTR
Sbjct  2    EDVPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYTR 61
Query  61   AEGLYSMVIERDHKNEFCEIVLLSSSRKDCDEIPTEGWVKPSLKFILNTVNGTTRTINPL 120
            AEGLYSM++ERDHKNEFCEI L+SS RKDC+EIPTEGW KPSLKFIL+TVNGTTRT+NPL
Sbjct  62   AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILSTVNGTTRTVNPL 121
Query  121  GFFKKEVLPKCPQVYNKLGMYPPNM 145
            GF+KKE LPKC QVYNKLGMYPPNM
Sbjct  122  GFYKKEALPKCAQVYNKLGMYPPNM 146

Sequence Alignment: 9. Allergen Name: Ole e 1 Sequence ID: P19963

 Score = 268.7 bits 902,  Expect = 5e-74
 Identities = 126/145 86%, Positives = 135/145 93%, Gaps = 0/145 0%
Query  1    EDVPQPPVSLFYVQGQVYCDTCRAGFITELSEFIQGAGVRLQCKDKENGKVTFTEVGYTR 60
            ED+PQPPVS F++QGQVYCDTCRAGFITELSEFI GA +RLQCKDKENG VTFTEVGYTR
Sbjct  1    EDIPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTR 60
Query  61   AEGLYSMVIERDHKNEFCEIVLLSSSRKDCDEIPTEGWVKPSLKFILNTVNGTTRTINPL 120
            AEGLYSM++ERDHKNEFCEI L+SS RKDC+EIPTEGW KPSLKF LNTVNGTTRT+NPL
Sbjct  61   AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFKLNTVNGTTRTVNPL 120
Query  121  GFFKKEVLPKCPQVYNKLGMYPPNM 145
            GFFKKE LPKC QVYNKLGMYPPNM
Sbjct  121  GFFKKEALPKCAQVYNKLGMYPPNM 145

Sequence Alignment: 10. Allergen Name: Ole e 1.0105 Sequence ID: CAA73038

 Score = 267.8 bits 899,  Expect = 8e-74
 Identities = 126/145 86%, Positives = 135/145 93%, Gaps = 0/145 0%
Query  1    EDVPQPPVSLFYVQGQVYCDTCRAGFITELSEFIQGAGVRLQCKDKENGKVTFTEVGYTR 60
            EDVPQPPVS F++QGQVYCDTCRAGFITELSEFI GA VRLQCKDKENG VTFTE+GYTR
Sbjct  2    EDVPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYTR 61
Query  61   AEGLYSMVIERDHKNEFCEIVLLSSSRKDCDEIPTEGWVKPSLKFILNTVNGTTRTINPL 120
            AEGLYSM++ERDHKNEFCEI L+SS RKDC+EIPTEGW KPSLKFILNTVNGTTRT+NPL
Sbjct  62   AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILNTVNGTTRTVNPL 121
Query  121  GFFKKEVLPKCPQVYNKLGMYPPNM 145
             F+KKE LPKC QVYNKLGMYPPNM
Sbjct  122  RFYKKEALPKCAQVYNKLGMYPPNM 146

Sequence Alignment: 11. Allergen Name: Ole e 1.0107 Sequence ID: CAA73036

 Score = 264.9 bits 889,  Expect = 6e-73
 Identities = 123/145 84%, Positives = 134/145 92%, Gaps = 0/145 0%
Query  1    EDVPQPPVSLFYVQGQVYCDTCRAGFITELSEFIQGAGVRLQCKDKENGKVTFTEVGYTR 60
            EDVPQPPVS F++QGQVYCDTCR+ FITELSEFI GA VRLQC++KENG +TFTE+GYTR
Sbjct  2    EDVPQPPVSQFHIQGQVYCDTCRSRFITELSEFIPGASVRLQCREKENGDITFTEIGYTR 61
Query  61   AEGLYSMVIERDHKNEFCEIVLLSSSRKDCDEIPTEGWVKPSLKFILNTVNGTTRTINPL 120
            AEGLYSM++ERDHKNEFCEI L+SS RKDCDEIP EGW KPSLKFILNTVNGTTRT+NPL
Sbjct  62   AEGLYSMLVERDHKNEFCEITLISSGRKDCDEIPIEGWAKPSLKFILNTVNGTTRTVNPL 121
Query  121  GFFKKEVLPKCPQVYNKLGMYPPNM 145
            GFFKKE LPKC QVYNKLGMYPPNM
Sbjct  122  GFFKKEALPKCAQVYNKLGMYPPNM 146

Sequence Alignment: 12. Allergen Name: Fra e 1.0201 Sequence ID: AAQ83588

 Score = 264.3 bits 887,  Expect = 9e-73
 Identities = 125/145 86%, Positives = 133/145 91%, Gaps = 0/145 0%
Query  1    EDVPQPPVSLFYVQGQVYCDTCRAGFITELSEFIQGAGVRLQCKDKENGKVTFTEVGYTR 60
            EDVPQPPVS F++QGQVYCDTCRA FIT+LSEFI GA VRLQC+DKENG VTFTE+GYTR
Sbjct  2    EDVPQPPVSQFHIQGQVYCDTCRARFITKLSEFITGASVRLQCRDKENGDVTFTEIGYTR 61
Query  61   AEGLYSMVIERDHKNEFCEIVLLSSSRKDCDEIPTEGWVKPSLKFILNTVNGTTRTINPL 120
             EGLYSM +ERDHKNEFCEI LLSS RKDC+EIP EGWVKPSLKFILNTVNGTTRTINPL
Sbjct  62   GEGLYSMFVERDHKNEFCEITLLSSGRKDCNEIPIEGWVKPSLKFILNTVNGTTRTINPL 121
Query  121  GFFKKEVLPKCPQVYNKLGMYPPNM 145
            GFFKKE LP+C QVYNKLGMYPPNM
Sbjct  122  GFFKKEALPQCAQVYNKLGMYPPNM 146

Sequence Alignment: 13. Allergen Name: Ole e 1.0101 Sequence ID: AAB32652

 Score = 239.5 bits 802,  Expect = 2e-65
 Identities = 113/130 86%, Positives = 121/130 93%, Gaps = 0/130 0%
Query  16   QVYCDTCRAGFITELSEFIQGAGVRLQCKDKENGKVTFTEVGYTRAEGLYSMVIERDHKN 75
            QVYCDTCRAGFITELSEFI GA VRLQCK+K+NG +TFTEVGYTRAEGLYSM++ERDHKN
Sbjct  1    QVYCDTCRAGFITELSEFIPGASVRLQCKEKKNGDITFTEVGYTRAEGLYSMLVERDHKN 60
Query  76   EFCEIVLLSSSRKDCDEIPTEGWVKPSLKFILNTVNGTTRTINPLGFFKKEVLPKCPQVY 135
            EFCEI L+SS  KDC+EIPTEGW KPSLKFILNTVNGTTRT+NPLGFFKKE LPKC QVY
Sbjct  61   EFCEITLISSGSKDCNEIPTEGWAKPSLKFILNTVNGTTRTVNPLGFFKKEALPKCAQVY 120
Query  136  NKLGMYPPNM 145
            NKLGMYPPNM
Sbjct  121  NKLGMYPPNM 130

Sequence Alignment: 14. Allergen Name: Aca f 1 Sequence ID: A0A0K1SC24

 Score = 133.8 bits 439,  Expect = 2e-33
 Identities = 68/141 48%, Positives = 91/141 64%, Gaps = 4/141 2%
Query  1    EDVPQPPVSLFYVQGQVYCDTCRAGFITELSEFIQGAGVRLQCKDKENGKVTFTEVGYTR 60
            +DVP+PPVS F+VQG VYCDTCR  FITE S  ++GA V+L+C++   G  TF     T 
Sbjct  1    DDVPKPPVSQFHVQGLVYCDTCRYPFITEASPIMEGATVKLECRNITAGTQTFKAEAVTD 60
Query  61   AEGLYSMVIERDHKNEFCEIVLLSSSRKDCDEIPTEGWVKPSLKFILNTVNGTT---RTI 117
              G YS+ ++ DH+++ CEI L+ S    C EIP + + K S K  L + NG     R+ 
Sbjct  61   KVGQYSIPVDGDHEDDICEIELVKSPDNQCSEIPHDVYAKQSAKVSLTSNNGEASDVRSA 120
Query  118  NPLGFFKKEVLPKCPQVYN-KLGMY 141
            N LGF +KE LP+CP+V   KL MY
Sbjct  121  NALGFMRKEPLPECPEVLKEKLDMY 145

Sequence Alignment: 15. Allergen Name: Pro j 1.0101 Sequence ID: AKV72167

 Score = 122.7 bits 401,  Expect = 4e-30
 Identities = 62/141 43%, Positives = 88/141 62%, Gaps = 4/141 2%
Query  1    EDVPQPPVSLFYVQGQVYCDTCRAGFITELSEFIQGAGVRLQCKDKENGKVTFTEVGYTR 60
            +DV +PPVS F++QG VYCDTCR  F+T +S  ++GA V+L+C++   G  TF     T 
Sbjct  1    DDVAKPPVSQFHIQGLVYCDTCRIQFMTRVSTIMEGATVKLECRNITAGTQTFKAEAVTD 60
Query  61   AEGLYSMVIERDHKNEFCEIVLLSSSRKDCDEIPTEGWVKPSLKFILNTVNGTT---RTI 117
              G YS+ +  D +++ CEI L+ S   DC EIP + + K S K  L + NG     R+ 
Sbjct  61   KVGQYSIPVNGDFEDDICEIELVKSPNSDCSEIPHDVYAKQSAKVSLTSNNGEASDIRSA 120
Query  118  NPLGFFKKEVLPKCPQVYNK-LGMY 141
            N LGF +KE L +CP+V  + L MY
Sbjct  121  NALGFMRKEPLKECPEVSKEPLDMY 145

Sequence Alignment: 16. Allergen Name: Sal k 5.0101 Sequence ID: ADK22842

 Score = 118.3 bits 386,  Expect = 9e-29
 Identities = 56/133 42%, Positives = 86/133 64%, Gaps = 3/133 2%
Query  9    SLFYVQGQVYCDTCRAGFITELSEFIQGAGVRLQCKDKENGKVTFTEVGYTRAEGLYSMV 68
            +L++V+G VYCDTCR  FIT +S  ++GA V LQC++   G  TF     T   G+Y++ 
Sbjct  7    NLYHVKGMVYCDTCRIQFITRVSTMMEGATVSLQCRNLTAGTETFKAEAVTDKLGMYTIK 66
Query  69   IERDHKNEFCEIVLLSSSRKDCDEIPTEGWVKPSLKFILNTVNGTT---RTINPLGFFKK 125
            ++ DH+++ C+IVL+ S  ++C EIP + + + + K  L + NG     R  N LGF+KK
Sbjct  67   VDGDHEDDICQIVLVKSPGQECSEIPNDVYSEQAAKVTLTSNNGEASDVRNANALGFLKK 126
Query  126  EVLPKCPQVYNKLGMY 141
              LP+CP+V  +L MY
Sbjct  127  APLPECPEVLKELDMY 142

Sequence Alignment: 17. Allergen Name: Ama r 1.0101 Sequence ID: A0A0K1SC10

 Score = 117.2 bits 382,  Expect = 2e-28
 Identities = 57/141 40%, Positives = 86/141 60%, Gaps = 3/141 2%
Query  1    EDVPQPPVSLFYVQGQVYCDTCRAGFITELSEFIQGAGVRLQCKDKENGKVTFTEVGYTR 60
            +DV + PVS F++QG VYCDTCR  F+T +S  ++GA V+L+C++   G  TF     T 
Sbjct  20   DDVAKAPVSQFHIQGLVYCDTCRIQFMTRISTIMEGATVKLECRNITAGTQTFKAEAVTD 79
Query  61   AEGLYSMVIERDHKNEFCEIVLLSSSRKDCDEIPTEGWVKPSLKFILNTVNGTT---RTI 117
              G YS+ +  D +++ CEI L+ S   +C E+  + + K S K  L + NG     R+ 
Sbjct  80   KVGQYSIPVNGDFEDDICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSNNGEASDIRSA 139
Query  118  NPLGFFKKEVLPKCPQVYNKLGMY 141
            N LGF +KE L +CP+V  +L +Y
Sbjct  140  NALGFMRKEPLEECPEVLKELDLY 163

Sequence Alignment: 18. Allergen Name: Che a 1 Sequence ID: AAL07319

 Score = 107.3 bits 348,  Expect = 2e-25
 Identities = 53/131 40%, Positives = 78/131 59%, Gaps = 3/131 2%
Query  11   FYVQGQVYCDTCRAGFITELSEFIQGAGVRLQCKDKENGKVTFTEVGYTRAEGLYSMVIE 70
            F VQG VYCDTCR  F+T +S  ++GA V+L+C++   G  TF     T   G YS+ + 
Sbjct  30   FKVQGMVYCDTCRIQFMTRISTIMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSIPVN 89
Query  71   RDHKNEFCEIVLLSSSRKDCDEIPTEGWVKPSLKFILNTVNGTT---RTINPLGFFKKEV 127
             D +++ CEI L+ S   +C E+  + + K S K  L + NG     R+ N LGF +KE 
Sbjct  90   GDFEDDICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSNNGEASDIRSANALGFMRKEP 149
Query  128  LPKCPQVYNKLGMY 141
            L +CP+V  +L +Y
Sbjct  150  LKECPEVLKELDLY 163

Sequence Alignment: 19. Allergen Name: Lyc e LAT52 Sequence ID: CAA33854

 Score = 106.7 bits 346,  Expect = 3e-25
 Identities = 51/132 38%, Positives = 81/132 61%, Gaps = 2/132 1%
Query  10   LFYVQGQVYCDTCRAGFITELSEFIQGAGVRLQCKDKENGKVTFTEVGYTRAEGLYSMVI 69
            +F V+G+VYCDTCR  F T+LSE ++GA V+LQC++      TF+  G T  +G Y + +
Sbjct  26   VFDVEGKVYCDTCRVQFETKLSENLEGATVKLQCRNISTEAETFSVEGVTDKDGKYKLTV 85
Query  70   ERDHKNEFCEIVLLSSSRKDCDEIPTEGWVKPSLKFILNT-VNGTTRTINPLGFFKKEVL 128
              DH+N+ CE+ ++ S R+DC E    G+ K  ++   N  ++   R  NPL F K E +
Sbjct  86   NGDHENDICEVTVVKSPREDCKE-SVSGYEKARIECSDNVGIHNAVRFANPLFFMKAESV 144
Query  129  PKCPQVYNKLGMYP 142
              C +  ++LG++P
Sbjct  145  QGCKEALDELGLFP 158

Sequence Alignment: 20. Allergen Name: Koc s 1.0101 Sequence ID: A0A0K1SC44

 Score = 104.0 bits 337,  Expect = 2e-24
 Identities = 54/138 39%, Positives = 84/138 60%, Gaps = 8/138 5%
Query  1    EDVPQPPVSLFYVQGQVYCDTCR--AGFITELSEFIQGAGVRLQCKDKENGKVTFTEVGY 58
            +DV + PVS F++QG VYCDTC   + ++  +   ++GA V+L+C++   G  TF     
Sbjct  20   DDVAKAPVSQFHIQGLVYCDTCPYPSSYVLPM---LEGATVKLECRNITAGTQTFKAEAV 76
Query  59   TRAEGLYSMVIERDHKNEFCEIVLLSSSRKDCDEIPTEGWVKPSLKFILNTVNGTT---R 115
            T   G YS+ ++ D +++ CEI LL S    C E+  + + K S K  L + NG     R
Sbjct  77   TDKVGQYSIPVDGDFEDDICEIELLKSPDNQCSEVSHDVYAKQSAKVSLTSNNGEASDVR 136
Query  116  TINPLGFFKKEVLPKCPQVYNKLGMY 141
            + N LGF +KE L +CP+V  +L +Y
Sbjct  137  SANALGFMRKEPLEECPEVLKELDLY 162

Sequence Alignment: 21. Allergen Name: Lol p 11.0101 Sequence ID: Q7M1X5

 Score = 88.6 bits 284,  Expect = 7e-20
 Identities = 46/118 38%, Positives = 67/118 56%, Gaps = 7/118 5%
Query  11   FYVQGQVYCDTCRAGFITELSEFIQGAGVRLQCKDKENGKVTFTEVGYTRAEGLYSMVIE 70
            F V G+VYCD CRAGF T +S  ++GA V + C+  + G+  +     T  +G Y + I+
Sbjct  6    FVVTGRVYCDPCRAGFETNVSHNVEGATVAVDCRPFDGGESKLKAEATTDKDGWYKIEID 65
Query  71   RDHKNEFCEIVLLSSSRKDCDEIPTEGWVKPSLKFILNTVNGTT----RTINPLGFFKKE 126
            +DH+ E CE+VL  S  K C EI      +   +  L +  G      R  NP+ FF+KE
Sbjct  66   QDHQEEICEVVLAKSPDKSCSEIEE---FRDRARVPLTSNXGIKQQGIRYANPIAFFRKE 122
Query  127  VLPKC 131
             L +C
Sbjct  123  PLKEC 127

Sequence Alignment: 22. Allergen Name: Phl p 11.0101 Sequence ID: AAN32987

 Score = 88.3 bits 283,  Expect = 9e-20
 Identities = 47/118 39%, Positives = 65/118 55%, Gaps = 7/118 5%
Query  11   FYVQGQVYCDTCRAGFITELSEFIQGAGVRLQCKDKENGKVTFTEVGYTRAEGLYSMVIE 70
            F V G+VYCD CRAGF T +S  +QGA V + C+    G+  +     T   G Y + I+
Sbjct  6    FVVTGRVYCDPCRAGFETNVSHNVQGATVAVDCRPFNGGESKLKAEATTDGLGWYKIEID 65
Query  71   RDHKNEFCEIVLLSSSRKDCDEIPTEGWVKPSLKFILNTVNGTT----RTINPLGFFKKE 126
            +DH+ E CE+VL  S    C EI      +   +  L + NG      R  NP+ FF+KE
Sbjct  66   QDHQEEICEVVLAKSPDTTCSEIEE---FRDRARVPLTSNNGIKQQGIRYANPIAFFRKE 122
Query  127  VLPKC 131
             L +C
Sbjct  123  PLKEC 127

Sequence Alignment: 23. Allergen Name: Pla l 1 Sequence ID: P82242

 Score = 85.4 bits 273,  Expect = 6e-19
 Identities = 51/117 43%, Positives = 76/117 64%, Gaps = 10/117 8%
Query  11   FYVQGQVYCDTCRA-GFITELSEFIQGAGVRLQCKDKENGKVTFTEVGYTRAEGLYSMVI 69
            F+V+G+VYC+ C +  +I ELSE + GA V+L CKD ++ KV ++  G T  +G+Y + +
Sbjct  9    FHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKD-DSKKVIYSIGGETDQDGVYRLPV 67
Query  70   ERDHKNEFCEIVLLSSSRKDCDEIP--TEGWVKPSLKFILN---TVNGTTRTINPLGFFK 124
               H++  CEI L+ SSR DC EIP   +G ++ S K  L+   T+   TR + PL F  
Sbjct  68   VGYHED--CEIKLVKSSRPDCSEIPKLAKGTIQTS-KVDLSKNTTITEKTRHVKPLSFRA 124
Query  125  KEVLPKC 131
            K   P C
Sbjct  125  KTDAPGC 131

Sequence Alignment: 24. Allergen Name: Pla l 1.0103 Sequence ID: CAC41635

 Score = 83.7 bits 267,  Expect = 2e-18
 Identities = 50/117 42%, Positives = 75/117 64%, Gaps = 10/117 8%
Query  11   FYVQGQVYCDTCRA-GFITELSEFIQGAGVRLQCKDKENGKVTFTEVGYTRAEGLYSMVI 69
            F+V+G+VYC+ C +  +I ELSE + GA V+L CKD ++ KV ++  G T  +G+Y + +
Sbjct  9    FHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKD-DSKKVIYSIGGETGQDGVYRLPV 67
Query  70   ERDHKNEFCEIVLLSSSRKDCDEIP--TEGWVKPSLKFILN---TVNGTTRTINPLGFFK 124
               H++  CEI L+ S R DC EIP   +G ++ S K  L+   T+   TR + PL F  
Sbjct  68   VGYHED--CEIKLVKSGRPDCSEIPKLAKGTIQTS-KVDLSKNTTITEKTRHVKPLSFRA 124
Query  125  KEVLPKC 131
            K   P C
Sbjct  125  KTDAPGC 131

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.