The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Input Sequence

EGGLCSRASLGCLALDLGWKDCEICPAVKRDVDLFLTGTPDEYVEQVAQYNALPVVLENA
RILKNCVDAKMTEEDKENALSVLDKIYTSPLC
Sequence Info Allergen Name Length Opt Bits Score E Value
CAA44344 Fel d 1 92 623 179.2 1.6e-47
CAA44343 Fel d 1 88 481 139.9 9.9e-36
P30439 Fel d 1 88 471 137.2 6.7e-35
P30438 Fel d 1 92 471 137.1 7.2e-35
AAC37318 Fel d 1 92 469 136.6 1.1e-34
AAC41617 Fel d 1 88 467 136.1 1.4e-34
Q9GK67 Ory c 3.B.0101 90 96 33.5 0.0012
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Fel d 1 Sequence ID: CAA44344

 Score = 179.2 bits 623,  Expect = 2e-47
 Identities = 92/92 100%, Positives = 92/92 100%, Gaps = 0/92 0%
Query  1    EGGLCSRASLGCLALDLGWKDCEICPAVKRDVDLFLTGTPDEYVEQVAQYNALPVVLENA 60
            EGGLCSRASLGCLALDLGWKDCEICPAVKRDVDLFLTGTPDEYVEQVAQYNALPVVLENA
Sbjct  1    EGGLCSRASLGCLALDLGWKDCEICPAVKRDVDLFLTGTPDEYVEQVAQYNALPVVLENA 60
Query  61   RILKNCVDAKMTEEDKENALSVLDKIYTSPLC 92
            RILKNCVDAKMTEEDKENALSVLDKIYTSPLC
Sbjct  61   RILKNCVDAKMTEEDKENALSVLDKIYTSPLC 92

Sequence Alignment: 2. Allergen Name: Fel d 1 Sequence ID: CAA44343

 Score = 139.9 bits 481,  Expect = 1e-35
 Identities = 72/73 98%, Positives = 73/73 100%, Gaps = 0/73 0%
Query  20   KDCEICPAVKRDVDLFLTGTPDEYVEQVAQYNALPVVLENARILKNCVDAKMTEEDKENA 79
            +DCEICPAVKRDVDLFLTGTPDEYVEQVAQYNALPVVLENARILKNCVDAKMTEEDKENA
Sbjct  16   RDCEICPAVKRDVDLFLTGTPDEYVEQVAQYNALPVVLENARILKNCVDAKMTEEDKENA 75
Query  80   LSVLDKIYTSPLC 92
            LSVLDKIYTSPLC
Sbjct  76   LSVLDKIYTSPLC 88

Sequence Alignment: 3. Allergen Name: Fel d 1 Sequence ID: P30439

 Score = 137.2 bits 471,  Expect = 7e-35
 Identities = 71/72 98%, Positives = 71/72 98%, Gaps = 0/72 0%
Query  21   DCEICPAVKRDVDLFLTGTPDEYVEQVAQYNALPVVLENARILKNCVDAKMTEEDKENAL 80
            DCEICPAVKRDVDLFLTGTPDEYVEQVAQY ALPVVLENARILKNCVDAKMTEEDKENAL
Sbjct  17   DCEICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENARILKNCVDAKMTEEDKENAL 76
Query  81   SVLDKIYTSPLC 92
            SVLDKIYTSPLC
Sbjct  77   SVLDKIYTSPLC 88

Sequence Alignment: 4. Allergen Name: Fel d 1 Sequence ID: P30438

 Score = 137.1 bits 471,  Expect = 7e-35
 Identities = 74/90 82%, Positives = 76/90 84%, Gaps = 0/90 0%
Query  3    GLCSRASLGCLALDLGWKDCEICPAVKRDVDLFLTGTPDEYVEQVAQYNALPVVLENARI 62
            G C    L    L +   +CEICPAVKRDVDLFLTGTPDEYVEQVAQY ALPVVLENARI
Sbjct  3    GACVLVLLWAALLLISGGNCEICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENARI 62
Query  63   LKNCVDAKMTEEDKENALSVLDKIYTSPLC 92
            LKNCVDAKMTEEDKENALSVLDKIYTSPLC
Sbjct  63   LKNCVDAKMTEEDKENALSVLDKIYTSPLC 92

Sequence Alignment: 5. Allergen Name: Fel d 1 Sequence ID: AAC37318

 Score = 136.6 bits 469,  Expect = 1e-34
 Identities = 73/79 92%, Positives = 75/79 94%, Gaps = 1/79 1%
Query  14   ALDLGWK-DCEICPAVKRDVDLFLTGTPDEYVEQVAQYNALPVVLENARILKNCVDAKMT 72
            AL L W  +CEICPAVKRDVDLFLTGTPDEYVEQVAQY ALPVVLENARILKNCVDAKMT
Sbjct  13   ALLLIWGGNCEICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENARILKNCVDAKMT 72
Query  73   EEDKENALSVLDKIYTSPLC 92
            EEDKENALS+LDKIYTSPLC
Sbjct  73   EEDKENALSLLDKIYTSPLC 92

Sequence Alignment: 6. Allergen Name: Fel d 1 Sequence ID: AAC41617

 Score = 136.1 bits 467,  Expect = 1e-34
 Identities = 70/72 97%, Positives = 71/72 98%, Gaps = 0/72 0%
Query  21   DCEICPAVKRDVDLFLTGTPDEYVEQVAQYNALPVVLENARILKNCVDAKMTEEDKENAL 80
            DCEICPAVKRDVDLFLTGTPDEYVEQVAQY ALPVVLENARILKNCVDAKMTEEDKENAL
Sbjct  17   DCEICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENARILKNCVDAKMTEEDKENAL 76
Query  81   SVLDKIYTSPLC 92
            S+LDKIYTSPLC
Sbjct  77   SLLDKIYTSPLC 88

Sequence Alignment: 7. Allergen Name: Ory c 3.B.0101 Sequence ID: Q9GK67

 Score = 33.5 bits 96,  Expect = 0.001
 Identities = 23/73 31%, Positives = 35/73 47%, Gaps = 1/73 1%
Query  13   LALDLGWKDCEICPAVKRDVDLFLTGTPDEYVEQVAQYNALPVVLENARILKNCVDAKMT 72
            LAL     D   CPA   D   FL      Y +++A+Y+A P  +E    +K C D ++ 
Sbjct  12   LALGCYEADAAACPAFVLDSVGFLFDPKPVYRQKLAKYDAPPEAVEAKLQVKECTD-EID 70
Query  73   EEDKENALSVLDKI 86
            +  +    +VL KI
Sbjct  71   KGKRVLIAAVLTKI 84

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2022  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.