The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

EMPARPSNMYPTNIDLFYVSDIKNYESRVEKAIDFGYAFDEHRTPYSLYHDQHGMDYLGQ
MIEGTSNSPYQYFYGSIFHFYRLLVGHVVDPYHKNGLAPSALEHHQTALRDPAFYQLWKR
IDHIVQKYKNRLPRYTYDELSFPGVKIENVDVGKLYTYFEHFEHSLGNAMYIGKLEDLLK
ANIRASHYRLNHKPFTYNIEVSSDKAQDVYVRIFLGPKYDSLGHECELDERRHYFVEMDR
FVHKVEAGKTVIERKSHDSSIISDSHDSYRNLYKKVADALEEKDQYYIDKSHKYCNYPEN
LLLPKGKKGGQTFTFYVIVTPYVKQEQHDFEPYHYKAFSYCGVGHGRKYPDDKPLGFPFD
RKIHDYDFYTPNMYFKDVVIFHKKYDEVHEVTH
Sequence Info Allergen Name Length Opt Bits Score E Value
AAB63595 Per a 3.0203 393 2733 629.3 8.9e-182
AAB09632 Per a 3.0201 631 2642 608.5 2.7e-175
AAB62731 Per a 3.0202 470 2608 600.8 4.1e-173
Q25641 Per a 3.0101 685 2007 463.8 1.1e-131
D0VNY7 Bla g 3.0101 657 1656 383.7 1.3e-107
G1AP69 Pen m 7.0101 683 767 181.1 1.3e-46
AEB77775 Pen m 7.0102 683 767 181.1 1.3e-46
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Per a 3.0203 Sequence ID: AAB63595

 Score = 629.3 bits 2733,  Expect = 9e-182
 Identities = 393/393 100%, Positives = 393/393 100%, Gaps = 0/393 0%
Query  1    EMPARPSNMYPTNIDLFYVSDIKNYESRVEKAIDFGYAFDEHRTPYSLYHDQHGMDYLGQ 60
            EMPARPSNMYPTNIDLFYVSDIKNYESRVEKAIDFGYAFDEHRTPYSLYHDQHGMDYLGQ
Sbjct  1    EMPARPSNMYPTNIDLFYVSDIKNYESRVEKAIDFGYAFDEHRTPYSLYHDQHGMDYLGQ 60
Query  61   MIEGTSNSPYQYFYGSIFHFYRLLVGHVVDPYHKNGLAPSALEHHQTALRDPAFYQLWKR 120
            MIEGTSNSPYQYFYGSIFHFYRLLVGHVVDPYHKNGLAPSALEHHQTALRDPAFYQLWKR
Sbjct  61   MIEGTSNSPYQYFYGSIFHFYRLLVGHVVDPYHKNGLAPSALEHHQTALRDPAFYQLWKR 120
Query  121  IDHIVQKYKNRLPRYTYDELSFPGVKIENVDVGKLYTYFEHFEHSLGNAMYIGKLEDLLK 180
            IDHIVQKYKNRLPRYTYDELSFPGVKIENVDVGKLYTYFEHFEHSLGNAMYIGKLEDLLK
Sbjct  121  IDHIVQKYKNRLPRYTYDELSFPGVKIENVDVGKLYTYFEHFEHSLGNAMYIGKLEDLLK 180
Query  181  ANIRASHYRLNHKPFTYNIEVSSDKAQDVYVRIFLGPKYDSLGHECELDERRHYFVEMDR 240
            ANIRASHYRLNHKPFTYNIEVSSDKAQDVYVRIFLGPKYDSLGHECELDERRHYFVEMDR
Sbjct  181  ANIRASHYRLNHKPFTYNIEVSSDKAQDVYVRIFLGPKYDSLGHECELDERRHYFVEMDR 240
Query  241  FVHKVEAGKTVIERKSHDSSIISDSHDSYRNLYKKVADALEEKDQYYIDKSHKYCNYPEN 300
            FVHKVEAGKTVIERKSHDSSIISDSHDSYRNLYKKVADALEEKDQYYIDKSHKYCNYPEN
Sbjct  241  FVHKVEAGKTVIERKSHDSSIISDSHDSYRNLYKKVADALEEKDQYYIDKSHKYCNYPEN 300
Query  301  LLLPKGKKGGQTFTFYVIVTPYVKQEQHDFEPYHYKAFSYCGVGHGRKYPDDKPLGFPFD 360
            LLLPKGKKGGQTFTFYVIVTPYVKQEQHDFEPYHYKAFSYCGVGHGRKYPDDKPLGFPFD
Sbjct  301  LLLPKGKKGGQTFTFYVIVTPYVKQEQHDFEPYHYKAFSYCGVGHGRKYPDDKPLGFPFD 360
Query  361  RKIHDYDFYTPNMYFKDVVIFHKKYDEVHEVTH 393
            RKIHDYDFYTPNMYFKDVVIFHKKYDEVHEVTH
Sbjct  361  RKIHDYDFYTPNMYFKDVVIFHKKYDEVHEVTH 393

Sequence Alignment: 2. Allergen Name: Per a 3.0201 Sequence ID: AAB09632

 Score = 608.5 bits 2642,  Expect = 3e-175
 Identities = 375/393 95%, Positives = 386/393 98%, Gaps = 0/393 0%
Query  1    EMPARPSNMYPTNIDLFYVSDIKNYESRVEKAIDFGYAFDEHRTPYSLYHDQHGMDYLGQ 60
            EMPARPSNMYPTN DLFYVSDIKNYE RVEKAIDFGYAFDEHRTPYSLYHDQHGMDYLGQ
Sbjct  239  EMPARPSNMYPTNFDLFYVSDIKNYERRVEKAIDFGYAFDEHRTPYSLYHDQHGMDYLGQ 298
Query  61   MIEGTSNSPYQYFYGSIFHFYRLLVGHVVDPYHKNGLAPSALEHHQTALRDPAFYQLWKR 120
            MIEGT NSP+QYFYGS+FHFYRLLVGHVVDPYHKNGLAPSALEH QTALRDPAFYQLWKR
Sbjct  299  MIEGTRNSPHQYFYGSVFHFYRLLVGHVVDPYHKNGLAPSALEHPQTALRDPAFYQLWKR 358
Query  121  IDHIVQKYKNRLPRYTYDELSFPGVKIENVDVGKLYTYFEHFEHSLGNAMYIGKLEDLLK 180
            IDHIVQKYKNRLPRYTYDELSFPGVKIENVDVGKLYTYFEHFEHSLGNAMY+GKLED +K
Sbjct  359  IDHIVQKYKNRLPRYTYDELSFPGVKIENVDVGKLYTYFEHFEHSLGNAMYLGKLEDYMK 418
Query  181  ANIRASHYRLNHKPFTYNIEVSSDKAQDVYVRIFLGPKYDSLGHECELDERRHYFVEMDR 240
            A+IRA HYRLNHKPFTYNIEVSSDKAQDVYVRIFLGPKYDSLGHECELDERRHYFVEMDR
Sbjct  419  ASIRARHYRLNHKPFTYNIEVSSDKAQDVYVRIFLGPKYDSLGHECELDERRHYFVEMDR 478
Query  241  FVHKVEAGKTVIERKSHDSSIISDSHDSYRNLYKKVADALEEKDQYYIDKSHKYCNYPEN 300
            FVHKVEAGKTVIERKSHDSSIISDSHDSYRNL+KKV+DAL+EKDQYYIDKSHKYC YPEN
Sbjct  479  FVHKVEAGKTVIERKSHDSSIISDSHDSYRNLFKKVSDALQEKDQYYIDKSHKYCGYPEN 538
Query  301  LLLPKGKKGGQTFTFYVIVTPYVKQEQHDFEPYHYKAFSYCGVGHGRKYPDDKPLGFPFD 360
            LLLPKGKKGGQTFTFYVIVTPYVKQ++HDFEPYHYKAFSYCGVGHGRKYPDDKPLGFPFD
Sbjct  539  LLLPKGKKGGQTFTFYVIVTPYVKQDEHDFEPYHYKAFSYCGVGHGRKYPDDKPLGFPFD 598
Query  361  RKIHDYDFYTPNMYFKDVVIFHKKYDEVHEVTH 393
            RKIHDYDFYTPNMYFKDVVIFHKKYDEVH+VTH
Sbjct  599  RKIHDYDFYTPNMYFKDVVIFHKKYDEVHDVTH 631

Sequence Alignment: 3. Allergen Name: Per a 3.0202 Sequence ID: AAB62731

 Score = 600.8 bits 2608,  Expect = 4e-173
 Identities = 375/392 95%, Positives = 384/392 97%, Gaps = 1/392 0%
Query  1    EMPARPSNMYPTNIDLFYVSDIKNYESRVEKAIDFGYAFDEHRTPYSLYHDQHGMDYLGQ 60
            EMPARPSNMYPTNIDLFYVSDIKNYESRVEKAIDF  AFDEHRTPYSLYHDQHGMDYLGQ
Sbjct  79   EMPARPSNMYPTNIDLFYVSDIKNYESRVEKAIDFD-AFDEHRTPYSLYHDQHGMDYLGQ 137
Query  61   MIEGTSNSPYQYFYGSIFHFYRLLVGHVVDPYHKNGLAPSALEHHQTALRDPAFYQLWKR 120
            MIEGTSNSPYQYFYGSIFHFYRLLVGHVVDPYHKNGLAPSALEHHQTALRDPAFYQLWKR
Sbjct  138  MIEGTSNSPYQYFYGSIFHFYRLLVGHVVDPYHKNGLAPSALEHHQTALRDPAFYQLWKR 197
Query  121  IDHIVQKYKNRLPRYTYDELSFPGVKIENVDVGKLYTYFEHFEHSLGNAMYIGKLEDLLK 180
            IDHIVQKYKNRLPRYTYDELSFPGVKIENVDVGKLYTYFEHFEHSLGNAMY+GKLED+LK
Sbjct  198  IDHIVQKYKNRLPRYTYDELSFPGVKIENVDVGKLYTYFEHFEHSLGNAMYLGKLEDVLK 257
Query  181  ANIRASHYRLNHKPFTYNIEVSSDKAQDVYVRIFLGPKYDSLGHECELDERRHYFVEMDR 240
            ANIRA HYRLNHKPFTYNIEVSSDKAQDVYVRIFLGPKYDSLGHECELDERRHYFVEMDR
Sbjct  258  ANIRARHYRLNHKPFTYNIEVSSDKAQDVYVRIFLGPKYDSLGHECELDERRHYFVEMDR 317
Query  241  FVHKVEAGKTVIERKSHDSSIISDSHDSYRNLYKKVADALEEKDQYYIDKSHKYCNYPEN 300
            FVHKVEAGKTVIERKSHDSSIISDSHDSYRNL+KKV+DALE KDQYYID SHKYC YPEN
Sbjct  318  FVHKVEAGKTVIERKSHDSSIISDSHDSYRNLFKKVSDALEGKDQYYIDNSHKYCGYPEN 377
Query  301  LLLPKGKKGGQTFTFYVIVTPYVKQEQHDFEPYHYKAFSYCGVGHGRKYPDDKPLGFPFD 360
            LLLPKGKKGGQTFTFYVIVTPYVKQ++HD+E YHYKAF+YCGVGHGRKYPDDKPLGFPFD
Sbjct  378  LLLPKGKKGGQTFTFYVIVTPYVKQDEHDLESYHYKAFTYCGVGHGRKYPDDKPLGFPFD 437
Query  361  RKIHDYDFYTPNMYFKDVVIFHKKYDEVHEVTH 393
            RKIHDYDFYTPNMYFKDVVIFHKKYDEVH  T+
Sbjct  438  RKIHDYDFYTPNMYFKDVVIFHKKYDEVHNETN 470

Sequence Alignment: 4. Allergen Name: Per a 3.0101 Sequence ID: Q25641

 Score = 463.8 bits 2007,  Expect = 1e-131
 Identities = 281/386 72%, Positives = 328/386 84%, Gaps = 2/386 0%
Query  1    EMPARPSNMYPTNIDLFYVSDIKNYESRVEKAIDFGYAFDEHRTPYSLYHDQHGMDYLGQ 60
            EMP RPSNMY TN DL+Y++DIKNYE RVE AIDFGYAFDEH  P+SLYHD HGM+YL  
Sbjct  295  EMPVRPSNMYVTNFDLYYIADIKNYEKRVEDAIDFGYAFDEHMKPHSLYHDVHGMEYLAD 354
Query  61   MIEGTSNSPYQYFYGSIFHFYRLLVGHVVDPYHKNGLAPSALEHHQTALRDPAFYQLWKR 120
            MIEG  +SP  YFYGSI+H Y  ++GH+VDPYHK GLAPS LEH +T LRDP FYQLWKR
Sbjct  355  MIEGNMDSPNFYFYGSIYHMYHSMIGHIVDPYHKMGLAPS-LEHPETVLRDPVFYQLWKR 413
Query  121  IDHIVQKYKNRLPRYTYDELSFPGVKIENVDVGKLYTYFEHFEHSLGNAMYIGKLEDLLK 180
            +DH+ QKYKNRLPRYT+DEL+F GVK+ENVDVGKLYTYFE+++ SL  A+Y+  ++ +  
Sbjct  414  VDHLFQKYKNRLPRYTHDELAFEGVKVENVDVGKLYTYFEQYDMSLDMAVYVNNVDQISN 473
Query  181  ANIRASHYRLNHKPFTYNIEVSSDKAQDVYVRIFLGPKYDSLGHECELDERRHYFVEMDR 240
             +++ +  RLNHKPFTYNIEVSSDKAQDVYV +FLGPKYD LG E +L++RRHYFVEMDR
Sbjct  474  VDVQLA-VRLNHKPFTYNIEVSSDKAQDVYVAVFLGPKYDYLGREYDLNDRRHYFVEMDR 532
Query  241  FVHKVEAGKTVIERKSHDSSIISDSHDSYRNLYKKVADALEEKDQYYIDKSHKYCNYPEN 300
            F + V AGKTVIER SHDS+II+   DSYR +YKKV +A E K QYY+DK H YC YPEN
Sbjct  533  FPYHVGAGKTVIERNSHDSNIIAPERDSYRTFYKKVQEAYEGKSQYYVDKGHNYCGYPEN 592
Query  301  LLLPKGKKGGQTFTFYVIVTPYVKQEQHDFEPYHYKAFSYCGVGHGRKYPDDKPLGFPFD 360
            LL+PKGKKGGQ +TFYVIVTPYVKQ++HDFEPY+YKAFSYCGVG  RKYPD+KPLG+PFD
Sbjct  593  LLIPKGKKGGQAYTFYVIVTPYVKQDEHDFEPYNYKAFSYCGVGSERKYPDNKPLGYPFD 652
Query  361  RKIHDYDFYTPNMYFKDVVIFHKKYDEV 388
            RKI+  DFYTPNMYFKDV+IFHKKYDEV
Sbjct  653  RKIYSNDFYTPNMYFKDVIIFHKKYDEV 680

Sequence Alignment: 5. Allergen Name: Bla g 3.0101 Sequence ID: D0VNY7

 Score = 383.7 bits 1656,  Expect = 1e-107
 Identities = 233/386 60%, Positives = 298/386 77%, Gaps = 4/386 1%
Query  1    EMPARPSNMYPTNIDLFYVSDIKNYESRVEKAIDFGYAFDEHRTPYSLYHDQHGMDYLGQ 60
            E+PARP+ M P + DL YVSDIKNYE RV  A+DFGY F +    +SLY+++ G+++LGQ
Sbjct  271  EVPARPAYMMPQDFDLMYVSDIKNYEKRVADAVDFGYVFCDKMISHSLYNNEKGLEWLGQ 330
Query  61   MIEGTSNSPYQYFYGSIFHFYRLLVGHVVDPYHKNGLAPSALEHHQTALRDPAFYQLWKR 120
            ++EG S  P   FYG IFH YR L+GH+ DP+HK+G+APSALEH +T+LRDPAFYQ+WKR
Sbjct  331  IVEGNSMHPD--FYGHIFHMYRSLLGHITDPFHKHGVAPSALEHPETSLRDPAFYQIWKR 388
Query  121  IDHIVQKYKNRLPRYTYDELSFPGVKIENVDVGKLYTYFEHFEHSLGNAMYIGKLEDLLK 180
            + H   K++ + P YT +EL+F GVKI+NVDVGKLYTYFE +E  L NA+ +GKLED+  
Sbjct  389  VQHYFNKFQMKQPYYTREELAFDGVKIDNVDVGKLYTYFEPYEMGLSNAVKVGKLEDVPN 448
Query  181  ANIRASHYRLNHKPFTYNIEVSSDKAQDVYVRIFLGPKYDSLGHECELDERRHYFVEMDR 240
             +IRA +YRLNHKPFTYN+EV+S+K   VYVR+FLGPKY+  GHE +L+ERR+YFVE+DR
Sbjct  449  VDIRARNYRLNHKPFTYNVEVTSEKDTPVYVRVFLGPKYNYYGHEYDLNERRNYFVEIDR 508
Query  241  FVHKVEAGKTVIERKSHDSSIISDSHDSYRNLYKKVADALEEKDQYYIDKSHKYCNYPEN 300
            F +++  GK  I+R SHDSS+++  +D+Y+ LYKKV +A E K  Y  +K  KYC  PE+
Sbjct  509  FPYQLHTGKNTIQRNSHDSSVVAQEQDTYKVLYKKVNEAYEGKTTYTYEKQDKYCGLPEH 568
Query  301  LLLPKGKKGGQTFTFYVIVTPYVKQEQHDFEPYHYKAFSYCGVGHGRKYPDDKPLGFPFD 360
            LL+PKGKKGGQ FT YVIVTPY K  +   E +H+KA+SYCGVG      D KPLGFPFD
Sbjct  569  LLIPKGKKGGQAFTVYVIVTPYDKAVEK--EEHHFKAYSYCGVGPHDSVYDKKPLGFPFD 626
Query  361  RKIHDYDFYTPNMYFKDVVIFHKKYDEVHE 390
            R IH YDF TPNM+ KDV IFHKKY+EV +
Sbjct  627  RPIHSYDFVTPNMFMKDVFIFHKKYEEVEQ 656

Sequence Alignment: 6. Allergen Name: Pen m 7.0101 Sequence ID: G1AP69

 Score = 181.1 bits 767,  Expect = 1e-46
 Identities = 142/377 37%, Positives = 216/377 57%, Gaps = 16/377 4%
Query  1    EMPARPSNMYPTNID-LFYVSDIKNYESRVEKAIDFGYAFDEHRTPYSLYHDQHGMDYLG 59
            + P+RP N+   ++D +  + D+   ESR+  AI  GY  D       +  ++ G+D LG
Sbjct  295  QFPSRPDNVDFEDVDGVARIRDLLIVESRIRDAIAHGYIVDRAGNHIDIM-NERGIDVLG 353
Query  60   QMIEGTSNSPYQYFYGSIFHFYRLLVGHVVDPYHKNGLAPSALEHHQTALRDPAFYQLWK 119
             +IE +  SP   +YG++ +   +++G   DP+ K  L P  LEH +TA RDP+F++L K
Sbjct  354  DVIESSLYSPNVQYYGALHNTAHIVLGRQSDPHGKYDLPPGVLEHFETATRDPSFFRLHK 413
Query  120  RIDHIVQKYKNRLPRYTYDELSFPGVKIENVDV-GKLYTYFEHFEHSLGNAMYIGKLEDL 178
             +D+I +++K+ LP YT +EL+F GV ++NV + G+L T+FE FE++L NA  +   E +
Sbjct  414  YMDNIFKEHKDSLPPYTVEELTFAGVSVDNVAIEGELETFFEDFEYNLINA--VDDTEQI 471
Query  179  LKANIRASHYRLNHKPFTYNIEVSSDKAQDVY--VRIFLGPKYDSLGHECELDERRHYFV 236
                I     RLNHK F   I+VS++K Q+V   VRIF  P  D+ G E  +DE R   +
Sbjct  472  PDVEISTYVPRLNHKDFKIKIDVSNNKGQEVLATVRIFAWPHLDNNGIEFTFDEGRWNAI 531
Query  237  EMDRFVHKVEAGKTVIERKSHDSSIISDSHDSYRNLYKKVADALEEKDQYYIDKSHKYCN 296
            E+D+F  K+ AG    ERKS +S++      S+  L++K  +AL   D    D       
Sbjct  532  ELDKFWVKLPAGTHHFERKSSESAVTVPDVPSFATLFEKTKEALAGADSGLTD-FESATG 590
Query  297  YPENLLLPKGKKGGQTFTFYVIVTPYVKQEQHDFEPYHYKA-FSYCGVGHGRKYPDDKPL 355
             P  +LLPKG + G  F + V VT        D    H    F++ G  HG KYPD++P 
Sbjct  591  IPNRFLLPKGNEQGLEFDLVVAVTDGAADAAVD--GLHENTEFNHYG-SHG-KYPDNRPH 646
Query  356  GFPFDRKIHDYDFYT--PNMYFKDVVIF-HKKY 385
            G+P+DRK+ D   +   PN     V +F H +Y
Sbjct  647  GYPLDRKVPDERVFEDLPNFGHIQVKVFNHGEY 679

Sequence Alignment: 7. Allergen Name: Pen m 7.0102 Sequence ID: AEB77775

 Score = 181.1 bits 767,  Expect = 1e-46
 Identities = 142/377 37%, Positives = 216/377 57%, Gaps = 16/377 4%
Query  1    EMPARPSNMYPTNID-LFYVSDIKNYESRVEKAIDFGYAFDEHRTPYSLYHDQHGMDYLG 59
            + P+RP N+   ++D +  + D+   ESR+  AI  GY  D       +  ++ G+D LG
Sbjct  295  QFPSRPDNVDFEDVDGVARIRDLLIVESRIRDAIAHGYIVDRAGNHIDIM-NERGIDVLG 353
Query  60   QMIEGTSNSPYQYFYGSIFHFYRLLVGHVVDPYHKNGLAPSALEHHQTALRDPAFYQLWK 119
             +IE +  SP   +YG++ +   +++G   DP+ K  L P  LEH +TA RDP+F++L K
Sbjct  354  DVIESSLYSPNVQYYGALHNTAHIVLGRQSDPHGKYDLPPGVLEHFETATRDPSFFRLHK 413
Query  120  RIDHIVQKYKNRLPRYTYDELSFPGVKIENVDV-GKLYTYFEHFEHSLGNAMYIGKLEDL 178
             +D+I +++K+ LP YT +EL+F GV ++NV + G+L T+FE FE++L NA  +   E +
Sbjct  414  YMDNIFKEHKDSLPPYTVEELTFAGVSVDNVAIEGELETFFEDFEYNLINA--VDDTEQI 471
Query  179  LKANIRASHYRLNHKPFTYNIEVSSDKAQDVY--VRIFLGPKYDSLGHECELDERRHYFV 236
                I     RLNHK F   I+VS++K Q+V   VRIF  P  D+ G E  +DE R   +
Sbjct  472  PDVEISTYVPRLNHKDFKIKIDVSNNKGQEVLATVRIFAWPHLDNNGIEFTFDEGRWNAI 531
Query  237  EMDRFVHKVEAGKTVIERKSHDSSIISDSHDSYRNLYKKVADALEEKDQYYIDKSHKYCN 296
            E+D+F  K+ AG    ERKS +S++      S+  L++K  +AL   D    D       
Sbjct  532  ELDKFWVKLPAGTHHFERKSSESAVTVPDVPSFATLFEKTKEALAGADSGLTD-FESATG 590
Query  297  YPENLLLPKGKKGGQTFTFYVIVTPYVKQEQHDFEPYHYKA-FSYCGVGHGRKYPDDKPL 355
             P  +LLPKG + G  F + V VT        D    H    F++ G  HG KYPD++P 
Sbjct  591  IPNRFLLPKGNEQGLEFDLVVAVTDGAADAAVD--GLHENTEFNHYG-SHG-KYPDNRPH 646
Query  356  GFPFDRKIHDYDFYT--PNMYFKDVVIF-HKKY 385
            G+P+DRK+ D   +   PN     V +F H +Y
Sbjct  647  GYPLDRKVPDERVFEDLPNFGHIQVKVFNHGEY 679

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.