The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

EQCGRQAGGALCPGGLCCSQYGWCANTPEYCGSGCQSQCDGGVGGEGGCVDLGSIISRST
FEEMLKHRNNAACPAKGFYTYDAFISAAKAFPAFGTTGDVDTCKREIAAFFGQTSHATTG
GWPTAPDGPYAWGYCHKEELNQASSYCSPSPAYPCAPGKKYYGRGPIQLSWNYNYGQCGQ
ALGLDLLNNPDLVATDRVISFKAAIWFWMTPQFPKPSCHDVITGQWSPTGHDISAGRAPG
YGVITNIINGGLECGSGWDARVEDRIGFYKRYCDMFGVGYGSNLDCYNQTPFGLG
Sequence Info Allergen Name Length Opt Bits Score E Value
CAD24068 Hev b 11.0102 295 2190 422.7 8e-120
CAC42881 Hev b 11.0101 295 2128 411.0 2.7e-116
Q8VXF1 Mus a 2.0101 318 1615 314.1 4.3e-87
CAB01591 Pers a 1 326 1545 300.9 4.2e-83
Q42428 Cas s 5 316 1446 282.2 1.7e-77
P29022 Zea m 8.0101 280 428 89.9 1.2e-19
P0DKH8 Fag e 4.0102 40 266 59.3 2.7e-11
Exo m 1.0101 40 266
P02877 Hev b 6.01 204 250 56.2 1.1e-09
AAA34256 Tri a 18 212 206 47.9 3.8e-07
AAA34257 Tri a 18 186 202 47.2 5.6e-07
AAA34258 Tri a 18 213 202 47.2 6.4e-07
P81729 Bra r 2 91 152 37.7 0.00019
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Hev b 11.0102 Sequence ID: CAD24068

 Score = 422.7 bits 2190,  Expect = 8e-120
 Identities = 295/295 100%, Positives = 295/295 100%, Gaps = 0/295 0%
Query  1    EQCGRQAGGALCPGGLCCSQYGWCANTPEYCGSGCQSQCDGGVGGEGGCVDLGSIISRST 60
            EQCGRQAGGALCPGGLCCSQYGWCANTPEYCGSGCQSQCDGGVGGEGGCVDLGSIISRST
Sbjct  1    EQCGRQAGGALCPGGLCCSQYGWCANTPEYCGSGCQSQCDGGVGGEGGCVDLGSIISRST 60
Query  61   FEEMLKHRNNAACPAKGFYTYDAFISAAKAFPAFGTTGDVDTCKREIAAFFGQTSHATTG 120
            FEEMLKHRNNAACPAKGFYTYDAFISAAKAFPAFGTTGDVDTCKREIAAFFGQTSHATTG
Sbjct  61   FEEMLKHRNNAACPAKGFYTYDAFISAAKAFPAFGTTGDVDTCKREIAAFFGQTSHATTG 120
Query  121  GWPTAPDGPYAWGYCHKEELNQASSYCSPSPAYPCAPGKKYYGRGPIQLSWNYNYGQCGQ 180
            GWPTAPDGPYAWGYCHKEELNQASSYCSPSPAYPCAPGKKYYGRGPIQLSWNYNYGQCGQ
Sbjct  121  GWPTAPDGPYAWGYCHKEELNQASSYCSPSPAYPCAPGKKYYGRGPIQLSWNYNYGQCGQ 180
Query  181  ALGLDLLNNPDLVATDRVISFKAAIWFWMTPQFPKPSCHDVITGQWSPTGHDISAGRAPG 240
            ALGLDLLNNPDLVATDRVISFKAAIWFWMTPQFPKPSCHDVITGQWSPTGHDISAGRAPG
Sbjct  181  ALGLDLLNNPDLVATDRVISFKAAIWFWMTPQFPKPSCHDVITGQWSPTGHDISAGRAPG 240
Query  241  YGVITNIINGGLECGSGWDARVEDRIGFYKRYCDMFGVGYGSNLDCYNQTPFGLG 295
            YGVITNIINGGLECGSGWDARVEDRIGFYKRYCDMFGVGYGSNLDCYNQTPFGLG
Sbjct  241  YGVITNIINGGLECGSGWDARVEDRIGFYKRYCDMFGVGYGSNLDCYNQTPFGLG 295

Sequence Alignment: 2. Allergen Name: Hev b 11.0101 Sequence ID: CAC42881

 Score = 411.0 bits 2128,  Expect = 3e-116
 Identities = 287/295 97%, Positives = 290/295 98%, Gaps = 0/295 0%
Query  1    EQCGRQAGGALCPGGLCCSQYGWCANTPEYCGSGCQSQCDGGVGGEGGCVDLGSIISRST 60
            EQCGRQAGGALCPGGLCCSQYGWCANTPEYCGSGCQSQCDGG GGE G +DLGSIISRST
Sbjct  1    EQCGRQAGGALCPGGLCCSQYGWCANTPEYCGSGCQSQCDGGGGGEDGGIDLGSIISRST 60
Query  61   FEEMLKHRNNAACPAKGFYTYDAFISAAKAFPAFGTTGDVDTCKREIAAFFGQTSHATTG 120
            FEEMLKHRN+AACPAKGFYTYDAFISAAKAFPAFGTTGDVDTCKREIAAFFGQTSHATTG
Sbjct  61   FEEMLKHRNDAACPAKGFYTYDAFISAAKAFPAFGTTGDVDTCKREIAAFFGQTSHATTG 120
Query  121  GWPTAPDGPYAWGYCHKEELNQASSYCSPSPAYPCAPGKKYYGRGPIQLSWNYNYGQCGQ 180
            GWPTAPDGPYAWGYC+KEELNQASSYCSPSPAYPCAPGKKYYGRGPIQLSWNYNYGQCGQ
Sbjct  121  GWPTAPDGPYAWGYCYKEELNQASSYCSPSPAYPCAPGKKYYGRGPIQLSWNYNYGQCGQ 180
Query  181  ALGLDLLNNPDLVATDRVISFKAAIWFWMTPQFPKPSCHDVITGQWSPTGHDISAGRAPG 240
            ALGLDLLNNPDLVATDRVISFKAAIWFWMTPQFPKPSCHDVITGQWSPTGHDISAGRAPG
Sbjct  181  ALGLDLLNNPDLVATDRVISFKAAIWFWMTPQFPKPSCHDVITGQWSPTGHDISAGRAPG 240
Query  241  YGVITNIINGGLECGSGWDARVEDRIGFYKRYCDMFGVGYGSNLDCYNQTPFGLG 295
            YGVITNIINGGLECG GWDARVEDRIGFYKRYCDMF VGYGSNLDCYNQTPFGLG
Sbjct  241  YGVITNIINGGLECGRGWDARVEDRIGFYKRYCDMFAVGYGSNLDCYNQTPFGLG 295

Sequence Alignment: 3. Allergen Name: Mus a 2.0101 Sequence ID: Q8VXF1

 Score = 314.1 bits 1615,  Expect = 4e-87
 Identities = 219/290 75%, Positives = 240/290 82%, Gaps = 2/290 0%
Query  1    EQCGRQAGGALCPGGLCCSQYGWCANTPEYCGSGCQSQCDGGVGGEGGCVDLGSIISRST 60
            EQCGRQAGGALCPGGLCCSQYGWC NT  YCG GCQSQC GG GG GG   + SIIS S 
Sbjct  20   EQCGRQAGGALCPGGLCCSQYGWCGNTDPYCGQGCQSQC-GGSGGSGGG-SVASIISSSL 77
Query  61   FEEMLKHRNNAACPAKGFYTYDAFISAAKAFPAFGTTGDVDTCKREIAAFFGQTSHATTG 120
            FE+MLKHRN+AACP KGFYTY+AFI+AA +F  FGTTGD    KREIAAF+ QTSH TTG
Sbjct  78   FEQMLKHRNDAACPGKGFYTYNAFIAAANSFSGFGTTGDDAKKKREIAAFLAQTSHETTG 137
Query  121  GWPTAPDGPYAWGYCHKEELNQASSYCSPSPAYPCAPGKKYYGRGPIQLSWNYNYGQCGQ 180
            GW TAPDGPYAWGYC  +E N +S YC  S  +PCA GKKYYGRGPIQ+S+NYNYG  G+
Sbjct  138  GWATAPDGPYAWGYCFVQEQNPSSDYCVASSQWPCAAGKKYYGRGPIQISFNYNYGPAGR 197
Query  181  ALGLDLLNNPDLVATDRVISFKAAIWFWMTPQFPKPSCHDVITGQWSPTGHDISAGRAPG 240
            A+G DLLNNPDLVATD  ISFK A+WFWMTPQ PKPSCHDVITG W+P+  D +AGR PG
Sbjct  198  AIGSDLLNNPDLVATDATISFKTALWFWMTPQSPKPSCHDVITGSWTPSNADQAAGRLPG 257
Query  241  YGVITNIINGGLECGSGWDARVEDRIGFYKRYCDMFGVGYGSNLDCYNQTPF 292
            YGV TNIINGGLECG G+DARV DRIGFYKRYCD++GV YG NLDCYNQ PF
Sbjct  258  YGVTTNIINGGLECGKGYDARVADRIGFYKRYCDLLGVSYGDNLDCYNQRPF 309

Sequence Alignment: 4. Allergen Name: Pers a 1 Sequence ID: CAB01591

 Score = 300.9 bits 1545,  Expect = 4e-83
 Identities = 205/292 70%, Positives = 238/292 81%, Gaps = 2/292 0%
Query  1    EQCGRQAGGALCPGGLCCSQYGWCANTPEYCGSGCQSQCDGGVGGEGGCVDLGSIISRST 60
            EQCGRQAGGALCPGGLCCSQ+GWC +T +YCG  CQSQC G     GG V   S+IS+S 
Sbjct  26   EQCGRQAGGALCPGGLCCSQFGWCGSTSDYCGPTCQSQCGGVTPSPGGGV--ASLISQSV 83
Query  61   FEEMLKHRNNAACPAKGFYTYDAFISAAKAFPAFGTTGDVDTCKREIAAFFGQTSHATTG 120
            F +MLKHRN+AAC AKGFYTY+AFI+AA +F  F + GD  T KREIAAF+ QTSH TTG
Sbjct  84   FNQMLKHRNDAACQAKGFYTYNAFIAAANSFNGFASVGDTATRKREIAAFLAQTSHETTG 143
Query  121  GWPTAPDGPYAWGYCHKEELNQASSYCSPSPAYPCAPGKKYYGRGPIQLSWNYNYGQCGQ 180
            GW TAPDGPYAWGYC  +E      YC P+  +PCAPGKKYYGRGPIQ+S+NYNYG  G+
Sbjct  144  GWATAPDGPYAWGYCFLKEQGNPPDYCVPTAQWPCAPGKKYYGRGPIQISYNYNYGPAGR 203
Query  181  ALGLDLLNNPDLVATDRVISFKAAIWFWMTPQFPKPSCHDVITGQWSPTGHDISAGRAPG 240
            A+G DL+NNPD VATD VISFK A+WFWMTPQ PKPSCH+VITG+W+P+  D +AGR PG
Sbjct  204  AIGYDLINNPDAVATDPVISFKTALWFWMTPQSPKPSCHNVITGRWTPSAADRAAGRLPG 263
Query  241  YGVITNIINGGLECGSGWDARVEDRIGFYKRYCDMFGVGYGSNLDCYNQTPFGL 294
            YGVITNIINGG+ECG G++ +V DRIGFYKRYCD++GV YGSNLDCYNQ  FG+
Sbjct  264  YGVITNIINGGIECGKGFNDKVADRIGFYKRYCDLLGVSYGSNLDCYNQRSFGV 317

Sequence Alignment: 5. Allergen Name: Cas s 5 Sequence ID: Q42428

 Score = 282.2 bits 1446,  Expect = 2e-77
 Identities = 200/290 68%, Positives = 229/290 78%, Gaps = 9/290 3%
Query  1    EQCGRQAGGALCPGGLCCSQYGWCANTPEYCGSGCQSQCDGGV-------GGEGGCVDLG 53
            EQCGRQAGGA C   LCCSQ+GWC NT EYCG+GCQSQC              GG  D+G
Sbjct  19   EQCGRQAGGAACANNLCCSQFGWCGNTAEYCGAGCQSQCSSPTTTTSSPTASSGGGGDVG 78
Query  54   SIISRSTFEEMLKHRNNAACPAKGFYTYDAFISAAKAFPAFGTTGDVDTCKREIAAFFGQ 113
            S+IS S F++MLK+RN+  C + GFYTY+AFI+AA++F  FGTTGDV T KRE+AAF+ Q
Sbjct  79   SLISASLFDQMLKYRNDPRCKSNGFYTYNAFIAAARSFNGFGTTGDVTTRKRELAAFLAQ 138
Query  114  TSHATTGGWPTAPDGPYAWGYCHKEELNQASSYCSPSPAYPCAPGKKYYGRGPIQLSWNY 173
            TSH TTGGW TAPDGPYAWGYC   E N   +YC+ S ++PC  GK+YYGRGPIQL+ NY
Sbjct  139  TSHETTGGWATAPDGPYAWGYCFVME-NNKQTYCT-SKSWPCVFGKQYYGRGPIQLTHNY 196
Query  174  NYGQCGQALGLDLLNNPDLVATDRVISFKAAIWFWMTPQFPKPSCHDVITGQWSPTGHDI 233
            NYGQ G+A+G DL+NNPDLVAT+  ISFK AIWFWMTPQ  KPS HDVI G W P+  D 
Sbjct  197  NYGQAGKAIGADLINNPDLVATNPTISFKTAIWFWMTPQANKPSSHDVIIGNWRPSAADT 256
Query  234  SAGRAPGYGVITNIINGGLECGSGWDARVEDRIGFYKRYCDMFGVGYGSNLDCYNQTPF 292
            SAGR P YGVITNIINGGLECG G D RV +RIGFYKRYCD +GV YG+NLDCYNQ PF
Sbjct  257  SAGRVPSYGVITNIINGGLECGHGSDDRVANRIGFYKRYCDTLGVSYGNNLDCYNQKPF 315

Sequence Alignment: 6. Allergen Name: Zea m 8.0101 Sequence ID: P29022

 Score = 89.9 bits 428,  Expect = 1e-19
 Identities = 113/241 46%, Positives = 154/241 63%, Gaps = 44/241 18%
Query  12   CPGGLCCSQYGWCANTPEYCGSGCQS-QC--DGGVGGEGGCVDLGS------IISRSTFE 62
            C   +CCS++G+C  T  YCG GCQS  C   GG GG GG    GS       +    F 
Sbjct  30   CQPNFCCSKFGYCGTTDAYCGDGCQSGPCRSGGGGGGGGGGGGGGSGGANVANVVTDAFF 89
Query  63   EMLKHRNNAACPAKGFYTYDAFISAAKAFPAFGTTGDVDTCKREIAAFFGQTSHATTGGW 122
              +K++  + C  K FYT  AF+SA  A+P F   G     KREIAAFF + +H T    
Sbjct  90   NGIKNQAGSGCEGKNFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHET---- 145
Query  123  PTAPDGPYAWGYCHKEELNQASSYCSPSP-AYPCAPGKKYYGRGPIQLSWNYNYGQCGQA 181
                 G +    C+  E+N++++YC  S   +PCA G+KYYGRGP+Q+SWNYNYG  G+ 
Sbjct  146  -----GHF----CYISEINKSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRD 196
Query  182  LGLDLLNNPDLVATDRVISFKAAIWFWMTPQFPKPSCHDVITGQWSPTGHDISAGRAPGY 241
            +G++ L +P+ VA D VI+FK A+WFWM       + H V+     P G          +
Sbjct  197  IGFNGLADPNRVAQDAVIAFKTALWFWMN------NVHGVM-----PQG----------F 235
Query  242  GVITNIINGGLECGSGWDARVEDRIGFYKRYCDMFGVGYGSNLDC 286
            G     ING LEC     A++  R+G+YK+YC  + V  G NL C
Sbjct  236  GATIRAINGALECNGNNPAQMNARVGYYKQYCQQLRVDPGPNLIC 280

Sequence Alignment: 7. Allergen Name: Fag e 4.0102 Sequence ID: P0DKH8

 Score = 59.3 bits 266,  Expect = 3e-11
 Identities = 29/38 76%, Positives = 33/38 86%, Gaps = 0/38 0%
Query  2    QCGRQAGGALCPGGLCCSQYGWCANTPEYCGSGCQSQC 39
            QCG Q GGA CPGGLCCSQ+GWC +TP+YCG+GCQS C
Sbjct  2    QCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSNC 39

Sequence Alignment: 8. Allergen Name: Exo Sequence ID:

 Score = 59.3 bits 266,  Expect = 3e-11
 Identities = 29/38 76%, Positives = 33/38 86%, Gaps = 0/38 0%
Query  2    QCGRQAGGALCPGGLCCSQYGWCANTPEYCGSGCQSQC 39
            QCG Q GGA CPGGLCCSQ+GWC +TP+YCG+GCQS C
Sbjct  2    QCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSNC 39

Sequence Alignment: 9. Allergen Name: Hev b 6.01 Sequence ID: P02877

 Score = 56.2 bits 250,  Expect = 1e-09
 Identities = 33/48 68%, Positives = 35/48 72%, Gaps = 3/48 6%
Query  1    EQCGRQAGGALCPGGLCCSQYGWCANTPEYCGS--GCQSQC-DGGVGGEGG 48
            EQCGRQAGG LCP  LCCSQ+GWC +T EYC     CQS C D G G  GG
Sbjct  18   EQCGRQAGGKLCPNNLCCSQWGWCGSTDEYCSPDHNCQSNCKDSGEGVGGG 68

Sequence Alignment: 10. Allergen Name: Tri a 18 Sequence ID: AAA34256

 Score = 47.9 bits 206,  Expect = 4e-07
 Identities = 27/47 57%, Positives = 32/47 68%, Gaps = 3/47 6%
Query  2    QCGRQAGGALCPGGLCCSQYGWCANTPEYCGSGCQS-QC--DGGVGGEGG 48
            +CG QAGG LCP  LCCSQ+G+C    E+CG GCQS  C  D   G + G
Sbjct  114  KCGSQAGGKLCPNNLCCSQWGFCGLGSEFCGGGCQSGACSTDKPCGKDAG 163
 Score = 45.1 bits 191,  Expect = 3e-06
 Identities = 23/43 53%, Positives = 28/43 65%, Gaps = 1/43 2%
Query  1    EQCGRQAGGALCPGGLCCSQYGWCANTPEYCGSGCQS-QCDGGV 43
            ++CG QAGGA C    CCSQYG+C    EYCG+GCQ   C   +
Sbjct  70   KRCGSQAGGATCTNNQCCSQYGYCGFGAEYCGAGCQGGPCRADI 113
 Score = 42.6 bits 178,  Expect = 1e-05
 Identities = 19/37 51%, Positives = 24/37 64%, Gaps = 0/37 0%
Query  1    EQCGRQAGGALCPGGLCCSQYGWCANTPEYCGSGCQS 37
            ++CG Q     CP  LCCSQYG+C    +YCG GCQ+
Sbjct  27   QRCGEQGSNMECPNNLCCSQYGYCGMGGDYCGKGCQN 63

Sequence Alignment: 11. Allergen Name: Tri a 18 Sequence ID: AAA34257

 Score = 47.2 bits 202,  Expect = 6e-07
 Identities = 55/151 36%, Positives = 69/151 45%, Gaps = 39/151 25%
Query  1    EQCGRQAGGALCPGGLCCSQYGWCANTPEYCGSGCQSQCDGGVGGEGGCVDLGSIISRST 60
            ++CG Q  G  CP  LCCSQYG+C    +YCG GCQ   +G       C   GS     T
Sbjct  1    QRCGEQGSGMECPNNLCCSQYGYCGMGGDYCGKGCQ---NGACWTSKRC---GSQAGGKT 54
Query  61   FEEMLKHRNNAACPAKGFYTYDAFISAAKAFPAFGTTGDVDTCKREIAAFFGQTSHATTG 120
                    NN  C   G   + A    A      G  G    C+ +I          +  
Sbjct  55   CP------NNHCCSQYGHCGFGAEYCGA------GCQGG--PCRADIKC-------GSQA 93
Query  121  GWPTAPDGP--YAWGYCH--KEELNQASSYCSPSPAYPCAPGKKYYGRGPIQLSWNY--- 173
            G    P+      WGYC    E   +     + S   PC  GK   GR     + NY   
Sbjct  94   GGKLCPNNLCCSQWGYCGLGSEFCGEGCQNGACSTDKPC--GKDAGGR---VCTNNYCCS 148
Query  174  NYGQCGQALG 183
             +G CG   G
Sbjct  149  KWGSCGIGPG 158

Sequence Alignment: 12. Allergen Name: Tri a 18 Sequence ID: AAA34258

 Score = 47.2 bits 202,  Expect = 6e-07
 Identities = 26/47 55%, Positives = 32/47 68%, Gaps = 3/47 6%
Query  2    QCGRQAGGALCPGGLCCSQYGWCANTPEYCGSGCQS-QC--DGGVGGEGG 48
            +CG Q+GG LCP  LCCSQ+G+C    E+CG GCQS  C  D   G + G
Sbjct  115  KCGSQSGGKLCPNNLCCSQWGFCGLGSEFCGGGCQSGACSTDKPCGKDAG 164
 Score = 46.0 bits 196,  Expect = 1e-06
 Identities = 24/43 55%, Positives = 28/43 65%, Gaps = 1/43 2%
Query  1    EQCGRQAGGALCPGGLCCSQYGWCANTPEYCGSGCQS-QCDGGV 43
            ++CG QAGGA CP   CCSQYG C    EYCG+GCQ   C   +
Sbjct  71   KRCGSQAGGATCPNNHCCSQYGHCGFGAEYCGAGCQGGPCRADI 114
 Score = 42.6 bits 178,  Expect = 1e-05
 Identities = 19/37 51%, Positives = 24/37 64%, Gaps = 0/37 0%
Query  1    EQCGRQAGGALCPGGLCCSQYGWCANTPEYCGSGCQS 37
            ++CG Q     CP  LCCSQYG+C    +YCG GCQ+
Sbjct  28   QRCGEQGSNMECPNNLCCSQYGYCGMGGDYCGKGCQN 64

Sequence Alignment: 13. Allergen Name: Bra r 2 Sequence ID: P81729

 Score = 37.7 bits 152,  Expect = 0.0002
 Identities = 18/32 56%, Positives = 23/32 71%, Gaps = 2/32 6%
Query  6    QAGGALCPGGLCCSQYGWCANTPEYCG--SGCQS 37
            QAGG  C G +CCSQYG+C  T +YC   + CQ+
Sbjct  1    QAGGQTCAGNICCSQYGYCGTTADYCSPDNNCQA 34

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.