The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

ETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLS
EQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQ
IYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYG
STQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL
Sequence Info Allergen Name Length Opt Bits Score E Value
CAA46316 Der f 1 212 1473 323.1 3.9e-90
BAC53948 Der f 1.0101 321 1473 322.8 7.5e-90
ABL84749 Der f 1.0108 321 1468 321.7 1.6e-89
ABL84750 Der f 1.0109 321 1468 321.7 1.6e-89
2428875 Der f 1.0107 303 1467 321.6 1.7e-89
ABL84751 Der f 1.0110 321 1467 321.5 1.8e-89
2428875 Der f 1.0105 303 1464 320.9 2.6e-89
2428875 Der f 1.0103 303 1464 320.9 2.6e-89
2428875 Der f 1.0102 303 1463 320.7 3e-89
P16311 Der f 1 321 1458 319.6 6.9e-89
2428875 Der f 1.0104 303 1450 317.9 2.1e-88
P25780 Eur m 1.0101 321 1287 283.0 7e-78
AAC82351 Eur m 1.0101 321 1287 283.0 7e-78
CAA42677 Eur m 1.0101 211 1281 282.1 8.8e-78
AAC82352 Eur m 1.0102 321 1278 281.1 2.7e-77
P08176 Der p 1 320 1240 273.0 7.4e-75
6771329 Der p 1.0117 222 1234 272.0 1e-74
ABA39435 Der p 1.0113 302 1235 271.9 1.4e-74
6771329 Der p 1.0115 222 1230 271.1 1.8e-74
6771329 Der p 1.0123 222 1229 270.9 2.1e-74
6771329 Der p 1.0118 222 1228 270.7 2.5e-74
6771329 Der p 1.0121 222 1228 270.7 2.5e-74
6771329 Der p 1.0119 222 1225 270.1 3.8e-74
6771329 Der p 1.0122 222 1223 269.6 5.2e-74
6771329 Der p 1.0116 222 1223 269.6 5.2e-74
6771329 Der p 1.0120 222 1223 269.6 5.2e-74
CAQ68250 Der p 1.0124 302 1226 270.0 5.4e-74
6771329 Der p 1.0114 222 1222 269.4 6e-74
AAK58415 Blo t 1.0101 221 496 114.2 3.3e-27
AAA28296 Der p 1 96 476 110.6 1.7e-26
AAQ24541 Blo t 1.0201 333 483 111.0 4.3e-26
P00785 Act d 1 380 456 105.2 2.9e-24
BAA21849 Ana c 2 351 452 104.4 4.6e-24
AAA32629 Act d 1 380 452 104.3 5.3e-24
V5LU01 Amb a 11.0101 386 442 102.1 2.4e-23
P14080 Cari p 2.0101 352 432 100.1 9e-23
AAB09252 Gly m 1 379 386 90.2 9.3e-20
P22895 Gly m 1 379 385 90.0 1.1e-19
AAB02650 Car p papain 345 365 85.8 1.8e-18
ABM53753 Tyr p 1.0101 336 259 63.1 1.1e-11
P16312 Der m 1 30 177 47.7 4.7e-08
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Der f 1 Sequence ID: CAA46316

 Score = 323.1 bits 1473,  Expect = 4e-90
 Identities = 212/212 100%, Positives = 212/212 100%, Gaps = 0/212 0%
Query  1    ETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLS 60
            ETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLS
Sbjct  1    ETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLS 60
Query  61   EQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQ 120
            EQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQ
Sbjct  61   EQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQ 120
Query  121  IYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYG 180
            IYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYG
Sbjct  121  IYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYG 180
Query  181  STQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL 212
            STQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL
Sbjct  181  STQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL 212

Sequence Alignment: 2. Allergen Name: Der f 1.0101 Sequence ID: BAC53948

 Score = 322.8 bits 1473,  Expect = 7e-90
 Identities = 212/212 100%, Positives = 212/212 100%, Gaps = 0/212 0%
Query  1    ETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLS 60
            ETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLS
Sbjct  98   ETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLS 157
Query  61   EQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQ 120
            EQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQ
Sbjct  158  EQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQ 217
Query  121  IYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYG 180
            IYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYG
Sbjct  218  IYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYG 277
Query  181  STQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL 212
            STQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL
Sbjct  278  STQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL 309

Sequence Alignment: 3. Allergen Name: Der f 1.0108 Sequence ID: ABL84749

 Score = 321.7 bits 1468,  Expect = 2e-89
 Identities = 211/212 99%, Positives = 211/212 99%, Gaps = 0/212 0%
Query  1    ETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLS 60
            ETSACRINSVNVPSELDLRSLRT TPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLS
Sbjct  98   ETSACRINSVNVPSELDLRSLRTATPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLS 157
Query  61   EQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQ 120
            EQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQ
Sbjct  158  EQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQ 217
Query  121  IYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYG 180
            IYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYG
Sbjct  218  IYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYG 277
Query  181  STQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL 212
            STQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL
Sbjct  278  STQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL 309

Sequence Alignment: 4. Allergen Name: Der f 1.0109 Sequence ID: ABL84750

 Score = 321.7 bits 1468,  Expect = 2e-89
 Identities = 211/212 99%, Positives = 212/212 100%, Gaps = 0/212 0%
Query  1    ETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLS 60
            ETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLS
Sbjct  98   ETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLS 157
Query  61   EQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQ 120
            EQ+LVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQ
Sbjct  158  EQKLVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQ 217
Query  121  IYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYG 180
            IYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYG
Sbjct  218  IYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYG 277
Query  181  STQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL 212
            STQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL
Sbjct  278  STQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL 309

Sequence Alignment: 5. Allergen Name: Der f 1.0107 Sequence ID: 2428875

 Score = 321.6 bits 1467,  Expect = 2e-89
 Identities = 211/212 99%, Positives = 212/212 100%, Gaps = 0/212 0%
Query  1    ETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLS 60
            ETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLS
Sbjct  80   ETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLS 139
Query  61   EQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQ 120
            EQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQ+CRRPNSQHYGISNYCQ
Sbjct  140  EQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQRCRRPNSQHYGISNYCQ 199
Query  121  IYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYG 180
            IYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYG
Sbjct  200  IYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYG 259
Query  181  STQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL 212
            STQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL
Sbjct  260  STQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL 291

Sequence Alignment: 6. Allergen Name: Der f 1.0110 Sequence ID: ABL84751

 Score = 321.5 bits 1467,  Expect = 2e-89
 Identities = 211/212 99%, Positives = 212/212 100%, Gaps = 0/212 0%
Query  1    ETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLS 60
            ETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLS
Sbjct  98   ETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLS 157
Query  61   EQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQ 120
            EQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQ
Sbjct  158  EQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQ 217
Query  121  IYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYG 180
            IYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII+HDNGYQPNYHAVNIVGYG
Sbjct  218  IYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIRHDNGYQPNYHAVNIVGYG 277
Query  181  STQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL 212
            STQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL
Sbjct  278  STQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL 309

Sequence Alignment: 7. Allergen Name: Der f 1.0105 Sequence ID: 2428875

 Score = 320.9 bits 1464,  Expect = 3e-89
 Identities = 211/212 99%, Positives = 211/212 99%, Gaps = 0/212 0%
Query  1    ETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLS 60
            ETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLS
Sbjct  80   ETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLS 139
Query  61   EQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQ 120
            EQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHY ISNYCQ
Sbjct  140  EQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYDISNYCQ 199
Query  121  IYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYG 180
            IYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYG
Sbjct  200  IYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYG 259
Query  181  STQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL 212
            STQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL
Sbjct  260  STQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL 291

Sequence Alignment: 8. Allergen Name: Der f 1.0103 Sequence ID: 2428875

 Score = 320.9 bits 1464,  Expect = 3e-89
 Identities = 211/212 99%, Positives = 211/212 99%, Gaps = 0/212 0%
Query  1    ETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLS 60
            ETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLS
Sbjct  80   ETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLS 139
Query  61   EQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQ 120
            EQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQ
Sbjct  140  EQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQ 199
Query  121  IYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYG 180
            IYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHY GRTIIQHDNGYQPNYHAVNIVGYG
Sbjct  200  IYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYGGRTIIQHDNGYQPNYHAVNIVGYG 259
Query  181  STQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL 212
            STQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL
Sbjct  260  STQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL 291

Sequence Alignment: 9. Allergen Name: Der f 1.0102 Sequence ID: 2428875

 Score = 320.7 bits 1463,  Expect = 3e-89
 Identities = 211/212 99%, Positives = 211/212 99%, Gaps = 0/212 0%
Query  1    ETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLS 60
            ETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLS
Sbjct  80   ETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLS 139
Query  61   EQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQ 120
            EQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQ
Sbjct  140  EQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQ 199
Query  121  IYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYG 180
            IYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQ DNGYQPNYHAVNIVGYG
Sbjct  200  IYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQRDNGYQPNYHAVNIVGYG 259
Query  181  STQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL 212
            STQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL
Sbjct  260  STQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL 291

Sequence Alignment: 10. Allergen Name: Der f 1 Sequence ID: P16311

 Score = 319.6 bits 1458,  Expect = 7e-89
 Identities = 210/212 99%, Positives = 211/212 99%, Gaps = 0/212 0%
Query  1    ETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLS 60
            ETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLS
Sbjct  98   ETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLS 157
Query  61   EQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQ 120
            EQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQ+CRRPNSQHYGISNYCQ
Sbjct  158  EQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQRCRRPNSQHYGISNYCQ 217
Query  121  IYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYG 180
            IYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYG
Sbjct  218  IYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYG 277
Query  181  STQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL 212
            STQG DYWIVRNSWDTTWGDSGYGYFQAGNNL
Sbjct  278  STQGDDYWIVRNSWDTTWGDSGYGYFQAGNNL 309

Sequence Alignment: 11. Allergen Name: Der f 1.0104 Sequence ID: 2428875

 Score = 317.9 bits 1450,  Expect = 2e-88
 Identities = 210/212 99%, Positives = 210/212 99%, Gaps = 0/212 0%
Query  1    ETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLS 60
            E SACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLS
Sbjct  80   EISACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLS 139
Query  61   EQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQ 120
            EQELVDCASQHG HGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQ
Sbjct  140  EQELVDCASQHGRHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQ 199
Query  121  IYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYG 180
            IYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYG
Sbjct  200  IYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYG 259
Query  181  STQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL 212
            STQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL
Sbjct  260  STQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL 291

Sequence Alignment: 12. Allergen Name: Eur m 1.0101 Sequence ID: P25780

 Score = 283.0 bits 1287,  Expect = 7e-78
 Identities = 181/212 85%, Positives = 196/212 92%, Gaps = 0/212 0%
Query  1    ETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLS 60
            ET AC INSV++PSELDLRSLRTVTPIRMQGGCGSCWAFSGVA+TESAYLAYRN SLDL+
Sbjct  98   ETYACSINSVSLPSELDLRSLRTVTPIRMQGGCGSCWAFSGVASTESAYLAYRNMSLDLA 157
Query  61   EQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQ 120
            EQELVDCASQ+GCHGDTIPRGIEYIQQNGVV+E  YPYVAREQ C RPN+Q YG+ NYCQ
Sbjct  158  EQELVDCASQNGCHGDTIPRGIEYIQQNGVVQEHYYPYVAREQSCHRPNAQRYGLKNYCQ 217
Query  121  IYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYG 180
            I PPD  +IR+ALTQTHTA+AVIIGIKDL AF+HYDGRTI+QHDNGYQPNYHAVNIVGYG
Sbjct  218  ISPPDSNKIRQALTQTHTAVAVIIGIKDLNAFRHYDGRTIMQHDNGYQPNYHAVNIVGYG 277
Query  181  STQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL 212
            +TQGVDYWIVRNSWDTTWGD+GYGYF A  NL
Sbjct  278  NTQGVDYWIVRNSWDTTWGDNGYGYFAANINL 309

Sequence Alignment: 13. Allergen Name: Eur m 1.0101 Sequence ID: AAC82351

 Score = 283.0 bits 1287,  Expect = 7e-78
 Identities = 181/212 85%, Positives = 196/212 92%, Gaps = 0/212 0%
Query  1    ETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLS 60
            ET AC INSV++PSELDLRSLRTVTPIRMQGGCGSCWAFSGVA+TESAYLAYRN SLDL+
Sbjct  98   ETYACSINSVSLPSELDLRSLRTVTPIRMQGGCGSCWAFSGVASTESAYLAYRNMSLDLA 157
Query  61   EQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQ 120
            EQELVDCASQ+GCHGDTIPRGIEYIQQNGVV+E  YPYVAREQ C RPN+Q YG+ NYCQ
Sbjct  158  EQELVDCASQNGCHGDTIPRGIEYIQQNGVVQEHYYPYVAREQSCHRPNAQRYGLKNYCQ 217
Query  121  IYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYG 180
            I PPD  +IR+ALTQTHTA+AVIIGIKDL AF+HYDGRTI+QHDNGYQPNYHAVNIVGYG
Sbjct  218  ISPPDSNKIRQALTQTHTAVAVIIGIKDLNAFRHYDGRTIMQHDNGYQPNYHAVNIVGYG 277
Query  181  STQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL 212
            +TQGVDYWIVRNSWDTTWGD+GYGYF A  NL
Sbjct  278  NTQGVDYWIVRNSWDTTWGDNGYGYFAANINL 309

Sequence Alignment: 14. Allergen Name: Eur m 1.0101 Sequence ID: CAA42677

 Score = 282.1 bits 1281,  Expect = 9e-78
 Identities = 180/211 85%, Positives = 195/211 92%, Gaps = 0/211 0%
Query  2    TSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSE 61
            T AC INSV++PSELDLRSLRTVTPIRMQGGCGSCWAFSGVA+TESAYLAYRN SLDL+E
Sbjct  1    TYACSINSVSLPSELDLRSLRTVTPIRMQGGCGSCWAFSGVASTESAYLAYRNMSLDLAE 60
Query  62   QELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQI 121
            QELVDCASQ+GCHGDTIPRGIEYIQQNGVV+E  YPYVAREQ C RPN+Q YG+ NYCQI
Sbjct  61   QELVDCASQNGCHGDTIPRGIEYIQQNGVVQEHYYPYVAREQSCHRPNAQRYGLKNYCQI 120
Query  122  YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYGS 181
             PPD  +IR+ALTQTHTA+AVIIGIKDL AF+HYDGRTI+QHDNGYQPNYHAVNIVGYG+
Sbjct  121  SPPDSNKIRQALTQTHTAVAVIIGIKDLNAFRHYDGRTIMQHDNGYQPNYHAVNIVGYGN 180
Query  182  TQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL 212
            TQGVDYWIVRNSWDTTWGD+GYGYF A  NL
Sbjct  181  TQGVDYWIVRNSWDTTWGDNGYGYFAANINL 211

Sequence Alignment: 15. Allergen Name: Eur m 1.0102 Sequence ID: AAC82352

 Score = 281.1 bits 1278,  Expect = 3e-77
 Identities = 180/212 84%, Positives = 195/212 91%, Gaps = 0/212 0%
Query  1    ETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLS 60
            ET AC INSV++PSELDLRSLRTVTPIR QGGCGSCWAFSGVA+TESAYLAYRN SLDL+
Sbjct  98   ETYACSINSVSLPSELDLRSLRTVTPIRNQGGCGSCWAFSGVASTESAYLAYRNMSLDLA 157
Query  61   EQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQ 120
            EQELVDCASQ+GCHGDTIPRGIEYIQQNGVV+E  YPYVAREQ C RPN+Q YG+ NYCQ
Sbjct  158  EQELVDCASQNGCHGDTIPRGIEYIQQNGVVQEHYYPYVAREQSCHRPNAQRYGLKNYCQ 217
Query  121  IYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYG 180
            I PPD  +IR+ALTQTHTA+AVIIGIKDL AF+HYDGRTI+QHDNGYQPNYHAVNIVGYG
Sbjct  218  ISPPDSNKIRQALTQTHTAVAVIIGIKDLNAFRHYDGRTIMQHDNGYQPNYHAVNIVGYG 277
Query  181  STQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL 212
            +TQGVDYWIVRNSWDTTWGD+GYGYF A  NL
Sbjct  278  NTQGVDYWIVRNSWDTTWGDNGYGYFAANINL 309

Sequence Alignment: 16. Allergen Name: Der p 1 Sequence ID: P08176

 Score = 273.0 bits 1240,  Expect = 7e-75
 Identities = 175/211 82%, Positives = 191/211 90%, Gaps = 1/211 0%
Query  1    ETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLS 60
            ET+AC IN  N P+E+DLR +RTVTPIRMQGGCGSCWAFSGVAATESAYLAYRN SLDL+
Sbjct  98   ETNACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLA 156
Query  61   EQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQ 120
            EQELVDCASQHGCHGDTIPRGIEYIQ+NGVV+E  Y YVAREQ CRRPN+Q +GISNYCQ
Sbjct  157  EQELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQ 216
Query  121  IYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYG 180
            IYPP+V +IREAL QTH+AIAVIIGIKDL AF+HYDGRTIIQ DNGYQPNYHAVNIVGY 
Sbjct  217  IYPPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYS 276
Query  181  STQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL 212
            + QGVDYWIVRNSWDT WGD+GYGYF A  +L
Sbjct  277  NAQGVDYWIVRNSWDTNWGDNGYGYFAANIDL 308

Sequence Alignment: 17. Allergen Name: Der p 1.0117 Sequence ID: 6771329

 Score = 272.0 bits 1234,  Expect = 1e-74
 Identities = 174/210 82%, Positives = 190/210 90%, Gaps = 1/210 0%
Query  2    TSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSE 61
            T+AC IN  N P+E+DLR +RTVTPIRMQGGCGSCWAFSGVAATESAYLAYRN SLDL+E
Sbjct  1    TNACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAE 59
Query  62   QELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQI 121
            QELVDCASQHGCHGDTIPRGIEYIQ+NGVV+E  Y YVAREQ CRRPN+Q +GISNYCQI
Sbjct  60   QELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQI 119
Query  122  YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYGS 181
            YPP+  +IREALTQTH+AIAVIIGIKDL AF+HYDGRTIIQ DNGYQPNYHAVNIVGY +
Sbjct  120  YPPNANKIREALTQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSN 179
Query  182  TQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL 212
             QGVDYWIVRNSWDT WGD+GYGYF A  +L
Sbjct  180  AQGVDYWIVRNSWDTNWGDNGYGYFAANIDL 210

Sequence Alignment: 18. Allergen Name: Der p 1.0113 Sequence ID: ABA39435

 Score = 271.9 bits 1235,  Expect = 1e-74
 Identities = 174/211 82%, Positives = 190/211 90%, Gaps = 1/211 0%
Query  1    ETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLS 60
            ET+AC IN  N P+E+DLR +RTVTPIRMQGGCGSCWAFSGVAATESAYLAYRN SLDL+
Sbjct  80   ETNACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLA 138
Query  61   EQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQ 120
            EQELVDCASQHGCHGDTIPRGIEYIQ+NGVV+E  Y YVAREQ CRRPN+Q +GISNYCQ
Sbjct  139  EQELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQ 198
Query  121  IYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYG 180
            IYPP+  +IREAL QTH+AIAVIIGIKDL AF+HYDGRTIIQ DNGYQPNYHAVNIVGY 
Sbjct  199  IYPPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYS 258
Query  181  STQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL 212
            + QGVDYWIVRNSWDT WGD+GYGYF A  +L
Sbjct  259  NAQGVDYWIVRNSWDTNWGDNGYGYFAANIDL 290

Sequence Alignment: 19. Allergen Name: Der p 1.0115 Sequence ID: 6771329

 Score = 271.1 bits 1230,  Expect = 2e-74
 Identities = 173/210 82%, Positives = 189/210 90%, Gaps = 1/210 0%
Query  2    TSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSE 61
            T+AC IN  N P+E+DLR +RTVTPIRMQGGCGSCWAFSGVAATESAYLAYRN SLDL+E
Sbjct  1    TNACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAE 59
Query  62   QELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQI 121
            QELVDCASQHGCHGDTIPRGIEYIQ+NGVV+E  Y YVAREQ CRRPN+Q +GISNYCQI
Sbjct  60   QELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNTQRFGISNYCQI 119
Query  122  YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYGS 181
            YPP+  +IREAL QTH+AIAVIIGIKDL AF+HYDGRTIIQ DNGYQPNYHAVNIVGY +
Sbjct  120  YPPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSN 179
Query  182  TQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL 212
             QGVDYWIVRNSWDT WGD+GYGYF A  +L
Sbjct  180  AQGVDYWIVRNSWDTNWGDNGYGYFAANIDL 210

Sequence Alignment: 20. Allergen Name: Der p 1.0123 Sequence ID: 6771329

 Score = 270.9 bits 1229,  Expect = 2e-74
 Identities = 173/210 82%, Positives = 189/210 90%, Gaps = 1/210 0%
Query  2    TSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSE 61
            T+AC IN  N P+E+DLR +RTVTPIRMQGGCGSCWAFSGVAATESAYLAYRN SLDL+E
Sbjct  1    TNACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAE 59
Query  62   QELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQI 121
            QELVDCASQHGCHGDTIPRGIEYIQ+NGVV+E  Y YVAREQ CRRPN+Q +GISNYCQI
Sbjct  60   QELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQI 119
Query  122  YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYGS 181
            YPP+  +IREAL QTH+AIAVIIGIKDL AF+HYDGRTIIQ DNGYQPNYHAVNIVGY +
Sbjct  120  YPPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSN 179
Query  182  TQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL 212
             QGVDYWIVRNSWDT WGD+GYGYF A  +L
Sbjct  180  AQGVDYWIVRNSWDTNWGDNGYGYFAANIDL 210

Sequence Alignment: 21. Allergen Name: Der p 1.0118 Sequence ID: 6771329

 Score = 270.7 bits 1228,  Expect = 2e-74
 Identities = 173/210 82%, Positives = 189/210 90%, Gaps = 1/210 0%
Query  2    TSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSE 61
            T+AC IN  N P+E+DLR +RTVTPIRMQGGCGSCWAFSGVAATESAYLAYRN SLDL+E
Sbjct  1    TNACSING-NAPAEIDLRQIRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAE 59
Query  62   QELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQI 121
            QELVDCASQHGCHGDTIPRGIEYIQ+NGVV+E  Y YVAREQ CRRPN+Q +GISNYCQI
Sbjct  60   QELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQI 119
Query  122  YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYGS 181
            YPP+  +IREAL QTH+AIAVIIGIKDL AF+HYDGRTIIQ DNGYQPNYHAVNIVGY +
Sbjct  120  YPPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSN 179
Query  182  TQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL 212
             QGVDYWIVRNSWDT WGD+GYGYF A  +L
Sbjct  180  AQGVDYWIVRNSWDTNWGDNGYGYFAANIDL 210

Sequence Alignment: 22. Allergen Name: Der p 1.0121 Sequence ID: 6771329

 Score = 270.7 bits 1228,  Expect = 2e-74
 Identities = 173/210 82%, Positives = 190/210 90%, Gaps = 1/210 0%
Query  2    TSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSE 61
            T+AC IN  N P+E+DLR +RTVTPIRMQGGCGSCWAFSGVAATESAYLAYR+ SLDL+E
Sbjct  1    TNACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRSQSLDLAE 59
Query  62   QELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQI 121
            QELVDCASQHGCHGDTIPRGIEYIQ+NGVV+E  Y YVAREQ CRRPN+Q +GISNYCQI
Sbjct  60   QELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQI 119
Query  122  YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYGS 181
            YPP+V +IREAL QTH+AIAVIIGIKDL AF+HYDGRTIIQ DNGYQPNYHAVNIVGY +
Sbjct  120  YPPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSN 179
Query  182  TQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL 212
             QGVDYWIVRNSWDT WGD+GYGYF A  +L
Sbjct  180  AQGVDYWIVRNSWDTNWGDNGYGYFAANIDL 210

Sequence Alignment: 23. Allergen Name: Der p 1.0119 Sequence ID: 6771329

 Score = 270.1 bits 1225,  Expect = 4e-74
 Identities = 173/210 82%, Positives = 189/210 90%, Gaps = 1/210 0%
Query  2    TSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSE 61
            T+AC IN  N P+E+DLR +RTVTPIRMQGGCGSCWAFSGVAATESAYLAYRN SLDL+E
Sbjct  1    TNACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAE 59
Query  62   QELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQI 121
            QELVDCASQHGCHGDTIPRGI YIQ+NGVV+E  Y YVAREQ CRRPN+Q +GISNYCQI
Sbjct  60   QELVDCASQHGCHGDTIPRGIGYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQI 119
Query  122  YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYGS 181
            YPP+V +IREAL QTH+AIAVIIGIKDL AF+HYDGRTIIQ DNGYQPNYHAVNIVGY +
Sbjct  120  YPPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSN 179
Query  182  TQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL 212
             QGVDYWIVRNSWDT WGD+GYGYF A  +L
Sbjct  180  AQGVDYWIVRNSWDTNWGDNGYGYFAANIDL 210

Sequence Alignment: 24. Allergen Name: Der p 1.0122 Sequence ID: 6771329

 Score = 269.6 bits 1223,  Expect = 5e-74
 Identities = 172/210 81%, Positives = 188/210 89%, Gaps = 1/210 0%
Query  2    TSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSE 61
            T+AC IN  N P+E+DLR +RTVTPIRMQGGCGSCWAFSGVAATESAYLAYRN SLDL+E
Sbjct  1    TNACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAE 59
Query  62   QELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQI 121
            QELVDCASQHGCHGDTIPRGIEYIQ+NGVV+E  Y YVAREQ CRRPN+Q +G SNYCQI
Sbjct  60   QELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGTSNYCQI 119
Query  122  YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYGS 181
            YPP+  +IREAL QTH+AIAVIIGIKDL AF+HYDGRTIIQ DNGYQPNYHAVNIVGY +
Sbjct  120  YPPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSN 179
Query  182  TQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL 212
             QGVDYWIVRNSWDT WGD+GYGYF A  +L
Sbjct  180  AQGVDYWIVRNSWDTNWGDNGYGYFAANIDL 210

Sequence Alignment: 25. Allergen Name: Der p 1.0116 Sequence ID: 6771329

 Score = 269.6 bits 1223,  Expect = 5e-74
 Identities = 173/210 82%, Positives = 189/210 90%, Gaps = 1/210 0%
Query  2    TSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSE 61
            T+AC IN  N P+E+DLR LRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRN SLDL+E
Sbjct  1    TNACSING-NAPAEIDLRQLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAE 59
Query  62   QELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQI 121
            QELVDCASQHGCHGDTIPRGIEYIQ+NGVV+E  Y YVAREQ CRRPN+Q +GISNYCQI
Sbjct  60   QELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQI 119
Query  122  YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYGS 181
            YPP+  +IREAL QTH+AIAVIIGIKDL AF+HYDGRTIIQ DNGYQPNY+AVNIVGY +
Sbjct  120  YPPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYYAVNIVGYSN 179
Query  182  TQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL 212
             QGVDYWIVRNSWDT WGD+GYGYF A  +L
Sbjct  180  AQGVDYWIVRNSWDTNWGDNGYGYFAANIDL 210

Sequence Alignment: 26. Allergen Name: Der p 1.0120 Sequence ID: 6771329

 Score = 269.6 bits 1223,  Expect = 5e-74
 Identities = 172/210 81%, Positives = 189/210 90%, Gaps = 1/210 0%
Query  2    TSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSE 61
            T+AC IN  N P+E+DLR +RTVTPIRMQGGCGSCWAFSGVAATESAYLAYRN SLDL+E
Sbjct  1    TNACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAE 59
Query  62   QELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQI 121
            QELVDCASQHGCHGDTIPRGIEYIQ+NGVV+E  Y YVAREQ CRRPN+Q +GISNYCQI
Sbjct  60   QELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQI 119
Query  122  YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYGS 181
            YPP+  +IREAL QTH+AIAVIIGIKDL AF+HYDGRTII+ DNGYQPNYHAVNIVGY +
Sbjct  120  YPPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIRRDNGYQPNYHAVNIVGYSN 179
Query  182  TQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL 212
             QGVDYWIVRNSWDT WGD+GYGYF A  +L
Sbjct  180  AQGVDYWIVRNSWDTNWGDNGYGYFAANIDL 210

Sequence Alignment: 27. Allergen Name: Der p 1.0124 Sequence ID: CAQ68250

 Score = 270.0 bits 1226,  Expect = 5e-74
 Identities = 173/211 81%, Positives = 190/211 90%, Gaps = 1/211 0%
Query  1    ETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLS 60
            ET+AC IN  N P+E+DLR +RTVTPIRMQGGCGSCWAFSGVAATESAYLAYRN SLDL+
Sbjct  80   ETNACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLA 138
Query  61   EQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQ 120
            EQELVDCASQHGC+GDTIPRGIEYIQ+NGVV+E  Y YVAREQ CRRPN+Q +GISNYCQ
Sbjct  139  EQELVDCASQHGCNGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQ 198
Query  121  IYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYG 180
            IYPP+  +IREAL QTH+AIAVIIGIKDL AF+HYDGRTIIQ DNGYQPNYHAVNIVGY 
Sbjct  199  IYPPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYS 258
Query  181  STQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL 212
            + QGVDYWIVRNSWDT WGD+GYGYF A  +L
Sbjct  259  NAQGVDYWIVRNSWDTNWGDNGYGYFAANIDL 290

Sequence Alignment: 28. Allergen Name: Der p 1.0114 Sequence ID: 6771329

 Score = 269.4 bits 1222,  Expect = 6e-74
 Identities = 172/210 81%, Positives = 188/210 89%, Gaps = 1/210 0%
Query  2    TSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSE 61
            T+AC IN  N P+E+DLR +RTVTPIRMQGGCGSCWAFSGVAATESAYLAYRN SLDL+E
Sbjct  1    TNACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAE 59
Query  62   QELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQI 121
            QELVDCASQHGCHGDTIPRGI YIQ+NGVV+E  Y YVAREQ CRRPN+Q +GISNYCQI
Sbjct  60   QELVDCASQHGCHGDTIPRGIAYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQI 119
Query  122  YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYGS 181
            YPP+  +IREAL QTH+AIAVIIGIKDL AF+HYDGRTIIQ DNGYQPNYHAVNIVGY +
Sbjct  120  YPPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSN 179
Query  182  TQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL 212
             QGVDYWIVRNSWDT WGD+GYGYF A  +L
Sbjct  180  AQGVDYWIVRNSWDTNWGDNGYGYFAANIDL 210

Sequence Alignment: 29. Allergen Name: Blo t 1.0101 Sequence ID: AAK58415

 Score = 114.2 bits 496,  Expect = 3e-27
 Identities = 81/195 41%, Positives = 118/195 60%, Gaps = 18/195 9%
Query  12   VPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCASQ- 70
            +P+ +D R    V PIR QGGCGSCWAF+  +  E+ Y  +R+ ++ LSEQEL+DC  + 
Sbjct  1    IPANFDWRQKTHVNPIRNQGGCGSCWAFAASSVAETLYAIHRHQNIILSEQELLDCTYHL 60
Query  71   -------HGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCR-RPNSQHYGISNYCQI- 121
                   HGC+    P   +Y++Q G++EE  YPY  +  QC+       Y +S+Y  + 
Sbjct  61   YDPTYKCHGCQSGMSPEAFKYMKQKGLLEESHYPYKMKLNQCQANARGTRYHVSSYNSLR 120
Query  122  YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDG-RTIIQHDNGYQPNY--HAVNIVG 178
            Y    ++I+ A+   H    V+I I    A  H+   R  I    GY      HAV +VG
Sbjct  121  YRAGDQEIQAAI-MNHGP--VVIYIHGTEA--HFRNLRKGILRGAGYNDAQIDHAVVLVG 175
Query  179  YGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNN 211
            +G+  G+DYWIVR SW T WGD+GYG+ +  +N
Sbjct  176  WGTQNGIDYWIVRTSWGTQWGDAGYGFVERHHN 208

Sequence Alignment: 30. Allergen Name: Der p 1 Sequence ID: AAA28296

 Score = 110.6 bits 476,  Expect = 2e-26
 Identities = 68/79 86%, Positives = 74/79 93%, Gaps = 1/79 1%
Query  1    ETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLS 60
            ET+AC IN  N P+E+DLR +RTVTPIRMQGGCGSCWAFSGVAATESAYLA+RN SLDL+
Sbjct  18   ETNACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAHRNQSLDLA 76
Query  61   EQELVDCASQHGCHGDTIPR 80
            EQELVDCASQHGCHGDTIPR
Sbjct  77   EQELVDCASQHGCHGDTIPR 96

Sequence Alignment: 31. Allergen Name: Blo t 1.0201 Sequence ID: AAQ24541

 Score = 111.0 bits 483,  Expect = 4e-26
 Identities = 82/201 40%, Positives = 118/201 58%, Gaps = 17/201 8%
Query  7    INSV-NVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELV 65
            IN+  ++P  +D R    +T IR QG CGSCWAF+     ES Y   +  S++LSEQELV
Sbjct  107  INTYGSLPQNFDWRQKARLTRIRQQGSCGSCWAFAAAGVAESLYSIQKQQSIELSEQELV 166
Query  66   DCASQ--------HGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPN--SQHYGI 115
            DC           +GC         +Y+ + G+VEE +YPY  R Q C  P+   Q Y +
Sbjct  167  DCTYNRYDSSYQCNGCGSGYSTEAFKYMIRTGLVEEENYPYNMRTQWCN-PDVEGQRYHV 225
Query  116  SNYCQI-YPPDVKQIREALTQTHTAIAVIIGIKD-LRAFQHYDGRTIIQHDNGYQPNYHA 173
            S Y Q+ Y    + +   + Q    +  + G  + +R + +   R +  +D  Y    HA
Sbjct  226  SGYQQLRYQSSDEDVMYTIQQHGPVVIYMHGSNNYFRNLGNGVLRGVAYND-AYTD--HA 282
Query  174  VNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNN 211
            V +VG+G+ QGVDYWI+RNSW T WG+ GYGY + G+N
Sbjct  283  VILVGWGTVQGVDYWIIRNSWGTGWGNGGYGYVERGHN 320

Sequence Alignment: 32. Allergen Name: Act d 1 Sequence ID: P00785

 Score = 105.2 bits 456,  Expect = 3e-24
 Identities = 78/187 41%, Positives = 110/187 58%, Gaps = 11/187 5%
Query  12   VPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCA-SQ 70
            +PS +D RS   V  I+ QG CG CWAFS +A  E          + LSEQEL+DC  +Q
Sbjct  127  LPSYVDWRSAGAVVDIKSQGECGGCWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQ 186
Query  71   H--GCHGDTIPRGIEYIQQNGVVE-ERSYPYVAREQQCRRP--NSQHYGISNYCQIYPPD 125
            +  GC+G  I  G ++I  NG +  E +YPY A++ +C     N ++  I  Y  +   +
Sbjct  187  NTRGCNGGYITDGFQFIINNGGINTEENYPYTAQDGECNLDLQNEKYVTIDTYENVPYNN 246
Query  126  VKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYGSTQGV 185
               ++ A+T    ++A +    D  AF+HY    I     G   + HAV IVGYG+  G+
Sbjct  247  EWALQTAVTYQPVSVA-LDAAGD--AFKHYSS-GIFTGPCGTAID-HAVTIVGYGTEGGI 301
Query  186  DYWIVRNSWDTTWGDSGY 203
            DYWIV+NSWDTTWG+ GY
Sbjct  302  DYWIVKNSWDTTWGEEGY 319

Sequence Alignment: 33. Allergen Name: Ana c 2 Sequence ID: BAA21849

 Score = 104.4 bits 452,  Expect = 5e-24
 Identities = 72/189 38%, Positives = 109/189 57%, Gaps = 13/189 6%
Query  7    INSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVD 66
            +N   VP  +D R    V  ++ Q  CGSCW+F+ +A  E  Y       + LSEQE++D
Sbjct  118  VNISAVPQSIDWRDYGAVNEVKNQNPCGSCWSFAAIATVEGIYKIKTGYLVSLSEQEVLD 177
Query  67   CASQHGCHGDTIPRGIEYI-QQNGVVEERSYPYVAREQQCRR---PNSQHYGISNYCQIY 122
            CA  +GC G  + +  ++I   NGV  E +YPY+A +  C     PNS +  I+ Y  + 
Sbjct  178  CAVSYGCKGGWVNKAYDFIISNNGVTTEENYPYLAYQGTCNANSFPNSAY--ITGYSYVR 235
Query  123  PPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYGS- 181
              D + +  A++  +  IA +I   +   FQ+Y+G  +     G   N HA+ I+GYG  
Sbjct  236  RNDERSMMYAVS--NQPIAALIDASE--NFQYYNG-GVFSGPCGTSLN-HAITIIGYGQD 289
Query  182  TQGVDYWIVRNSWDTTWGDSGY 203
            + G  YWIVRNSW ++WG+ GY
Sbjct  290  SSGTKYWIVRNSWGSSWGEGGY 311

Sequence Alignment: 34. Allergen Name: Act d 1 Sequence ID: AAA32629

 Score = 104.3 bits 452,  Expect = 5e-24
 Identities = 79/192 41%, Positives = 113/192 58%, Gaps = 12/192 6%
Query  6    RINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELV 65
            R+  V +PS +D RS   V  I+ QG CG CWAFS +A  E          + LSEQEL+
Sbjct  122  RVGQV-LPSYVDWRSAGAVVDIKSQGECGGCWAFSAIATVEGINKIVTGVLISLSEQELI 180
Query  66   DCA-SQH--GCHGDTIPRGIEYIQQNGVVE-ERSYPYVAREQQC--RRPNSQHYGISNYC 119
            DC  +Q+  GC+G  I  G ++I  NG +  E +YPY A++ +C     N ++  I  Y 
Sbjct  181  DCGRTQNTRGCNGGYITDGFQFIINNGGINTEENYPYTAQDGECNVELQNEKYVTIDTYE 240
Query  120  QIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGY 179
             +   +   ++ A+T    ++A +    D  AF++Y    I     G   + HAV IVGY
Sbjct  241  NVPYNNEWALQTAVTYQPVSVA-LDAAGD--AFKQYSS-GIFTGPCGTAID-HAVTIVGY 295
Query  180  GSTQGVDYWIVRNSWDTTWGDSGY 203
            G+  G+DYWIV+NSWDTTWG+ GY
Sbjct  296  GTEGGIDYWIVKNSWDTTWGEEGY 319

Sequence Alignment: 35. Allergen Name: Amb a 11.0101 Sequence ID: V5LU01

 Score = 102.1 bits 442,  Expect = 2e-23
 Identities = 73/197 37%, Positives = 109/197 55%, Gaps = 9/197 4%
Query  8    NSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDC 67
            N   +P ++D R    VT ++ QGGCGSCWAF+ V A E          + +SEQ+LVDC
Sbjct  127  NVTKIPDKVDWREKNAVTDVKGQGGCGSCWAFAAVVALEGINAIRTGKLVKFSEQQLVDC 186
Query  68   -ASQHGCHGDTIPRGIEY-IQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQIYPP- 124
              +  GC G  +     Y I++ G+  E SYPYV + + C +   +     +  Q  P  
Sbjct  187  DMTNAGCDGGLMEPAFTYVIKHGGIAPEASYPYVGKRETCDKAKIKDVLKIDGRQNVPGL 246
Query  125  DVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYG-STQ 183
            D + +R+A+   H  +A  I +     +Q Y    +   D G +PN H V IVGYG + +
Sbjct  247  DEEALRKAVA--HQPVATGIQLSG-HGLQFYS-EGVYTGDCGTEPN-HGVGIVGYGENEK 301
Query  184  GVDYWIVRNSWDTTWGDSGYGYFQAG 209
            G+ +W V+NSW  TWG+ GY ++Q G
Sbjct  302  GIKFWTVKNSWGPTWGEKGYIHLQRG 327

Sequence Alignment: 36. Allergen Name: Cari p 2.0101 Sequence ID: P14080

 Score = 100.1 bits 432,  Expect = 9e-23
 Identities = 74/192 38%, Positives = 113/192 58%, Gaps = 18/192 9%
Query  11   NVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCASQ 70
            N P  +D R+   VTP++ QG CGSCWAFS +A  E          L+LSEQELVDC  +
Sbjct  134  NYPQSIDWRAKGAVTPVKNQGACGSCWAFSTIATVEGINKIVTGNLLELSEQELVDCDKH 193
Query  71   -HGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCR---RPNSQHYGISNYCQIYPPDV 126
             +GC G      ++Y+  NGV   + YPY A++ +CR   +P  +   I+ Y ++ P + 
Sbjct  194  SYGCKGGYQTTSLQYVANNGVHTSKVYPYQAKQYKCRATDKPGPK-VKITGYKRV-PSNC 251
Query  127  K-QIREALTQTHTAIAVIIGIKDLRAFQH--YDGRTIIQHDNGYQPNYHAVNIVGYGSTQ 183
            +     AL     ++ V  G K ++ ++   +DG    + D       HAV  VGYG++ 
Sbjct  252  ETSFLGALANQPLSVLVEAGGKPFQLYKSGVFDGPCGTKLD-------HAVTAVGYGTSD 304
Query  184  GVDYWIVRNSWDTTWGDSGYGYF--QAGNN 211
            G +Y I++NSW   WG+ GY  +  Q+GN+
Sbjct  305  GKNYIIIKNSWGPNWGEKGYMRLKRQSGNS 334

Sequence Alignment: 37. Allergen Name: Gly m 1 Sequence ID: AAB09252

 Score = 90.2 bits 386,  Expect = 9e-20
 Identities = 73/198 36%, Positives = 103/198 52%, Gaps = 12/198 6%
Query  13   PSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCASQ-H 71
            P+  D R    +T ++ QGGCG  WAFS   A E+A+       + LSEQELVDC  +  
Sbjct  136  PASWDWRKKGVITQVKYQGGCGRGWAFSATGAIEAAHAIATGDLVSLSEQELVDCVEESE 195
Query  72   GCHGDTIPRGIEYI-QQNGVVEERSYPYVAREQQCRRPNSQ-HYGISNYCQIYPPDVKQI 129
            G +     +  E++ ++ G+  +  YPY A+E +C+    Q    I  Y  +   D    
Sbjct  196  GSYNGWQYQSFEWVLEHGGIATDDDYPYRAKEGRCKANKIQDKVTIDGYETLIMSDESTE 255
Query  130  REALTQTHTAI---AVIIGIKDLRAFQHYDGRTIIQHDNGYQPN--YHAVNIVGYGSTQG 184
             E      +AI    + + I D + F+ Y G  I   +N   P    H V +VGYGS  G
Sbjct  256  SETEQAFLSAILEQPISVSI-DAKDFHLYTG-GIYDGENCTSPYGINHFVLLVGYGSADG 313
Query  185  VDYWIVRNSWDTTWGDSGYGYFQ--AGNNL 212
            VDYWI +NSW   WG+ GY + Q   GN L
Sbjct  314  VDYWIAKNSWGEDWGEDGYIWIQRNTGNLL 343

Sequence Alignment: 38. Allergen Name: Gly m 1 Sequence ID: P22895

 Score = 90.0 bits 385,  Expect = 1e-19
 Identities = 73/198 36%, Positives = 103/198 52%, Gaps = 12/198 6%
Query  13   PSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCASQ-H 71
            P+  D R    +T ++ QGGCG  WAFS   A E+A+       + LSEQELVDC  +  
Sbjct  136  PASWDWRKKGVITQVKYQGGCGRGWAFSATGAIEAAHAIATGDLVSLSEQELVDCVEESE 195
Query  72   GCHGDTIPRGIEYI-QQNGVVEERSYPYVAREQQCRRPNSQ-HYGISNYCQIYPPDVKQI 129
            G +     +  E++ ++ G+  +  YPY A+E +C+    Q    I  Y  +   D    
Sbjct  196  GSYNGWQYQSFEWVLEHGGIATDDDYPYRAKEGRCKANKIQDKVTIDGYETLIMSDESTE 255
Query  130  REALTQTHTAI---AVIIGIKDLRAFQHYDGRTIIQHDNGYQPN--YHAVNIVGYGSTQG 184
             E      +AI    + + I D + F+ Y G  I   +N   P    H V +VGYGS  G
Sbjct  256  SETEQAFLSAILEQPISVSI-DAKDFHLYTG-GIYDGENCTSPYGINHFVLLVGYGSADG 313
Query  185  VDYWIVRNSWDTTWGDSGYGYFQ--AGNNL 212
            VDYWI +NSW   WG+ GY + Q   GN L
Sbjct  314  VDYWIAKNSWGFDWGEDGYIWIQRNTGNLL 343

Sequence Alignment: 39. Allergen Name: Car p papain Sequence ID: AAB02650

 Score = 85.8 bits 365,  Expect = 2e-18
 Identities = 67/190 35%, Positives = 102/190 53%, Gaps = 14/190 7%
Query  10   VNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLD-LSEQELVDCA 68
            VN+P  +D R    VTP++ QG CGSCWAFS V   E   +  R  +L+  SEQEL+DC 
Sbjct  132  VNIPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGI-IKIRTGNLNEYSEQELLDCD 190
Query  69   SQ-HGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISN--YCQIYPPD 125
             + +GC+G      ++ + Q G+    +YPY   ++ CR      Y        Q+ P +
Sbjct  191  RRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYN 250
Query  126  VKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYGSTQGV 185
               +  ++     ++ +    KD   FQ Y G  I     G + + HAV  VGYG     
Sbjct  251  EGALLYSIANQPVSVVLEAAGKD---FQLYRG-GIFVGPCGNKVD-HAVAAVGYGP---- 301
Query  186  DYWIVRNSWDTTWGDSGYGYFQAG 209
            +Y +++NSW T WG++GY   + G
Sbjct  302  NYILIKNSWGTGWGENGYIRIKRG 325

Sequence Alignment: 40. Allergen Name: Tyr p 1.0101 Sequence ID: ABM53753

 Score = 63.1 bits 259,  Expect = 1e-11
 Identities = 80/202 39%, Positives = 111/202 54%, Gaps = 25/202 12%
Query  7    INSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNT-SLDLSEQELV 65
            +N+   P   D R++     I  QG C SCWAF+     E+AY   +N  +L LS QELV
Sbjct  102  VNTSPFPKSWDWRNIIAFNSIEQQGRCSSCWAFAAATTVEAAYAHQKNKHNLHLSRQELV 161
Query  66   DCAS----QH----GCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQ-CRRPNSQH---- 112
            DC +    QH    GC G       +YI  +GV E++ Y Y     + C      H    
Sbjct  162  DCTNRTFDQHYLNYGCKGGWPTEAYKYIMDHGVYEDKLYHYTETFNEVCYADKVAHDKGH 221
Query  113  ---YGISNYCQIYPPDVKQIREALTQTHTAIAVII-GIKDLRAFQHYDGRTI--IQHDNG 166
               Y ISNY ++   D  +   A+  T+    V I G  D   F+ Y G  +  +  ++ 
Sbjct  222  PVKYYISNYGRLAYNDTDEAIMAMLVTYGPGTVDIHGTSD--TFRFYKGGIMRNVMPNSA 279
Query  167  YQPNYHAVNIVGYGS-TQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL 212
            Y    H V +VGYG+ + GVDYWI+RNSW  TWG+ GYG ++   NL
Sbjct  280  Y--TNHIVVVVGYGTDSSGVDYWIIRNSWGKTWGEHGYGRLERHPNL 324

Sequence Alignment: 41. Allergen Name: Der m 1 Sequence ID: P16312

 Score = 47.7 bits 177,  Expect = 5e-08
 Identities = 28/30 93%, Positives = 28/30 93%, Gaps = 0/30 0%
Query  2    TSACRINSVNVPSELDLRSLRTVTPIRMQG 31
            T ACRINS NVPSELDLRSLRTVTPIRMQG
Sbjct  1    TQACRINSGNVPSELDLRSLRTVTPIRMQG 30

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.