The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

GITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFKES
Sequence Info Allergen Name Length Opt Bits Score E Value
P83542 Pol g 1.0101 42 278 102.9 3e-25
AAS67044 Pol d 1.0104 316 269 99.3 2.7e-23
AAS67043 Pol d 1.0103 316 269 99.3 2.7e-23
AAS67042 Pol d 1.0102 316 269 99.3 2.7e-23
AAS67041 Pol d 1.0101 337 269 99.3 2.9e-23
3989146 Pol e 1.0101 302 215 80.4 1.3e-17
Q9U6W0 Pol a 1 301 213 79.7 2.2e-17
ABN13879 Poly p 1.0101 322 177 67.0 1.5e-13
P53357 Dol m 1.02 303 103 41.0 9.5e-06
C0HLL3 Vesp v 1.0101 304 81 33.3 0.002
P51528 Ves m 1 300 79 32.6 0.0033
P49369 Ves v 1 336 79 32.5 0.0037
3989146 Ves s 1.0101 298 77 31.8 0.0053
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Pol g 1.0101 Sequence ID: P83542

 Score = 102.9 bits 278,  Expect = 3e-25
 Identities = 42/42 100%, Positives = 42/42 100%, Gaps = 0/42 0%
Query  1    GITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFKES 42
            GITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFKES
Sbjct  1    GITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFKES 42

Sequence Alignment: 2. Allergen Name: Pol d 1.0104 Sequence ID: AAS67044

 Score = 99.3 bits 269,  Expect = 3e-23
 Identities = 40/42 95%, Positives = 42/42 100%, Gaps = 0/42 0%
Query  1    GITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFKES 42
            GITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLF++S
Sbjct  15   GITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKS 56

Sequence Alignment: 3. Allergen Name: Pol d 1.0103 Sequence ID: AAS67043

 Score = 99.3 bits 269,  Expect = 3e-23
 Identities = 40/42 95%, Positives = 42/42 100%, Gaps = 0/42 0%
Query  1    GITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFKES 42
            GITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLF++S
Sbjct  15   GITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKS 56

Sequence Alignment: 4. Allergen Name: Pol d 1.0102 Sequence ID: AAS67042

 Score = 99.3 bits 269,  Expect = 3e-23
 Identities = 40/42 95%, Positives = 42/42 100%, Gaps = 0/42 0%
Query  1    GITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFKES 42
            GITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLF++S
Sbjct  15   GITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKS 56

Sequence Alignment: 5. Allergen Name: Pol d 1.0101 Sequence ID: AAS67041

 Score = 99.3 bits 269,  Expect = 3e-23
 Identities = 40/42 95%, Positives = 42/42 100%, Gaps = 0/42 0%
Query  1    GITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFKES 42
            GITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLF++S
Sbjct  36   GITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKS 77

Sequence Alignment: 6. Allergen Name: Pol e 1.0101 Sequence ID: 3989146

 Score = 80.4 bits 215,  Expect = 1e-17
 Identities = 31/42 73%, Positives = 38/42 90%, Gaps = 0/42 0%
Query  1    GITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFKES 42
            G++PDCTFNEKDI ++VYSRDKR+GIILKK+ L NYDLF +S
Sbjct  1    GMSPDCTFNEKDIVFYVYSRDKRDGIILKKDSLTNYDLFTKS 42

Sequence Alignment: 7. Allergen Name: Pol a 1 Sequence ID: Q9U6W0

 Score = 79.7 bits 213,  Expect = 2e-17
 Identities = 31/41 75%, Positives = 37/41 90%, Gaps = 0/41 0%
Query  2    ITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFKES 42
            ++PDCTFNEKDI ++VYSRDKR+GIILKKE L NYDLF +S
Sbjct  1    MSPDCTFNEKDIVFYVYSRDKRDGIILKKETLTNYDLFTKS 41

Sequence Alignment: 8. Allergen Name: Poly p 1.0101 Sequence ID: ABN13879

 Score = 67.0 bits 177,  Expect = 2e-13
 Identities = 24/42 57%, Positives = 34/42 80%, Gaps = 0/42 0%
Query  1    GITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFKES 42
            G+ P+C FNE DI + VY+R +R+GI+L +E L+NYDLFK+S
Sbjct  18   GLIPECPFNEYDILFFVYTRQQRDGIVLTEETLQNYDLFKKS 59

Sequence Alignment: 9. Allergen Name: Dol m 1.02 Sequence ID: P53357

 Score = 41.0 bits 103,  Expect = 1e-05
 Identities = 15/42 35%, Positives = 27/42 64%, Gaps = 0/42 0%
Query  1    GITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFKES 42
            GI P+C +  ++I + + +R+ R+G+ L  + LKN  +FK S
Sbjct  1    GILPECKLVPEEISFVLSTRENRDGVYLTLQKLKNGKMFKNS 42

Sequence Alignment: 10. Allergen Name: Vesp v 1.0101 Sequence ID: C0HLL3

 Score = 33.3 bits 81,  Expect = 0.002
 Identities = 12/42 28%, Positives = 24/42 57%, Gaps = 0/42 0%
Query  1    GITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFKES 42
            G+ P C +  + I + + +R+ RNG+ L  + LK   ++ +S
Sbjct  1    GLLPKCKLVPEQISFILSTRENRNGVFLTLDSLKKGGILNKS 42

Sequence Alignment: 11. Allergen Name: Ves m 1 Sequence ID: P51528

 Score = 32.6 bits 79,  Expect = 0.003
 Identities = 11/38 28%, Positives = 21/38 55%, Gaps = 0/38 0%
Query  4    PDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFKE 41
            P C FN   + + + +R+ RN  +   + L+N+  FK+
Sbjct  2    PKCPFNSDTVSIIIETRENRNRDLYTLQTLQNHPEFKK 39

Sequence Alignment: 12. Allergen Name: Ves v 1 Sequence ID: P49369

 Score = 32.5 bits 79,  Expect = 0.004
 Identities = 11/38 28%, Positives = 21/38 55%, Gaps = 0/38 0%
Query  4    PDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFKE 41
            P C FN   + + + +R+ RN  +   + L+N+  FK+
Sbjct  38   PKCPFNSDTVSIIIETRENRNRDLYTLQTLQNHPEFKK 75

Sequence Alignment: 13. Allergen Name: Ves s 1.0101 Sequence ID: 3989146

 Score = 31.8 bits 77,  Expect = 0.005
 Identities = 10/36 27%, Positives = 21/36 58%, Gaps = 0/36 0%
Query  6    CTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFKE 41
            C F++  + + + +R+ RN      + L+N+D FK+
Sbjct  4    CPFSDDTVAMVIVTRENRNRDFYTLQTLRNHDEFKK 39

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.