The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

GKMNFTDCGHNEIKELSVSNCTGNYCVIHRGKPLTLDAKFDANQDTASVGLVLTAIIDGD
IAIDIPGLETNACKLMKCPIRKGEHQELIYNIGEIPDATPEIKAKVKAQLIGEHGVLACG
WVDGEVQE
Sequence Info Allergen Name Length Opt Bits Score E Value
CAB59976 Gly d 2.0101 128 871 236.7 1.5e-64
P80384 Lep d 2 141 508 140.8 1.2e-35
CAD32313 Lep d 2.0102 141 503 139.5 3e-35
CAA58755 Lep d 2.0201 141 498 138.2 7.4e-35
CAD32314 Lep d 2.0202 141 493 136.9 1.9e-34
CAB76459 Gly d 2.0201 125 469 130.6 1.3e-32
O02380 Tyr p 2 141 410 114.9 7.3e-28
BAX34757 Der f 35.0101 143 403 113.1 2.7e-27
A6XEP1 Blo t 2.0104 142 394 110.7 1.4e-26
A6XEP2 Blo t 2.0104 142 394 110.7 1.4e-26
A6XEP3 Blo t 2.0104 142 394 110.7 1.4e-26
A6XEP6 Blo t 2.0104 142 394 110.7 1.4e-26
AAQ73483 Blo t 2.0101 144 394 110.7 1.4e-26
A6XEN9 Blo t 2.0104 142 393 110.5 1.7e-26
A6XEP5 Blo t 2.0104 142 392 110.2 2e-26
A6XEN8 Blo t 2.0104 142 390 109.7 2.9e-26
A6XEP4 Blo t 2.0104 142 385 108.3 7.2e-26
A6XEP0 Blo t 2.0104 142 384 108.1 8.6e-26
AAQ73482 Blo t 2.0102 142 384 108.1 8.6e-26
CAA57160 Lep d 2.0101 98 374 105.6 3.3e-25
Q00855 Der f 2 146 372 104.9 8.1e-25
BAA01241 Der f 2 138 367 103.6 1.9e-24
BAA01239 Der f 2 138 366 103.3 2.2e-24
AAK30133 Der f 2 170 348 98.5 8e-23
ABA39438 Der f 2.0109 129 345 97.8 9.6e-23
AAQ73481 Blo t 2.0103 141 342 97.0 1.9e-22
P49278 Der p 2 146 337 95.7 4.9e-22
CAQ68249 Der p 2.0115 129 336 95.5 5e-22
ABA39437 Der p 2.0109 129 336 95.5 5e-22
CAK22338 Der p 2.0114 146 332 94.3 1.2e-21
Q9TZZ2 Eur m 2 145 330 93.8 1.7e-21
AAC82350 Eur m 2.0102 135 329 93.6 1.9e-21
Q28895 Can f 7.0101 149 205 60.8 1.6e-11
ABG76195 Der f 22.0101 155 195 58.1 1e-10
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Gly d 2.0101 Sequence ID: CAB59976

 Score = 236.7 bits 871,  Expect = 1e-64
 Identities = 128/128 100%, Positives = 128/128 100%, Gaps = 0/128 0%
Query  1    GKMNFTDCGHNEIKELSVSNCTGNYCVIHRGKPLTLDAKFDANQDTASVGLVLTAIIDGD 60
            GKMNFTDCGHNEIKELSVSNCTGNYCVIHRGKPLTLDAKFDANQDTASVGLVLTAIIDGD
Sbjct  1    GKMNFTDCGHNEIKELSVSNCTGNYCVIHRGKPLTLDAKFDANQDTASVGLVLTAIIDGD 60
Query  61   IAIDIPGLETNACKLMKCPIRKGEHQELIYNIGEIPDATPEIKAKVKAQLIGEHGVLACG 120
            IAIDIPGLETNACKLMKCPIRKGEHQELIYNIGEIPDATPEIKAKVKAQLIGEHGVLACG
Sbjct  61   IAIDIPGLETNACKLMKCPIRKGEHQELIYNIGEIPDATPEIKAKVKAQLIGEHGVLACG 120
Query  121  WVDGEVQE 128
            WVDGEVQE
Sbjct  121  WVDGEVQE 128

Sequence Alignment: 2. Allergen Name: Lep d 2 Sequence ID: P80384

 Score = 140.8 bits 508,  Expect = 1e-35
 Identities = 70/125 56%, Positives = 97/125 77%, Gaps = 2/125 1%
Query  1    GKMNFTDCGHNEIKELSVSNCTGNYCVIHRGKPLTLDAKFDANQDTASVGLVLTAIIDGD 60
            GKM F DCGH E+ EL ++ C+G+ CVIHRG+ +TL+AKF ANQDTA V + + A + G 
Sbjct  17   GKMTFKDCGHGEVTELDITGCSGDTCVIHRGEKMTLEAKFAANQDTAKVTIKVLAKVAGT 76
Query  61   IAIDIPGLETNACKLMKCPIRKGEHQELIYNIGEIPDATPEIKAKVKAQLIGEHGVLACG 120
              I +PGLET+ CK++KCP++KGE  ++IY+ G IP  TP++KA V A+LIG+HGV+ACG
Sbjct  77   -TIQVPGLETDGCKFIKCPVKKGEALDFIYS-GTIPAITPKVKADVTAELIGDHGVMACG 134
Query  121  WVDGEVQ 127
             V G+V+
Sbjct  135  TVHGQVE 141

Sequence Alignment: 3. Allergen Name: Lep d 2.0102 Sequence ID: CAD32313

 Score = 139.5 bits 503,  Expect = 3e-35
 Identities = 69/125 55%, Positives = 96/125 76%, Gaps = 2/125 1%
Query  1    GKMNFTDCGHNEIKELSVSNCTGNYCVIHRGKPLTLDAKFDANQDTASVGLVLTAIIDGD 60
            GKM F DCGH E+ EL ++ C+G+ CVIHRG+ +TL+AKF ANQDTA V + +   + G 
Sbjct  17   GKMTFKDCGHGEVTELDITGCSGDTCVIHRGEKMTLEAKFAANQDTAKVTIKVLTKVAGT 76
Query  61   IAIDIPGLETNACKLMKCPIRKGEHQELIYNIGEIPDATPEIKAKVKAQLIGEHGVLACG 120
              I +PGLET+ CK++KCP++KGE  ++IY+ G IP  TP++KA V A+LIG+HGV+ACG
Sbjct  77   -TIQVPGLETDGCKFIKCPVKKGEALDFIYS-GTIPAITPKVKADVTAELIGDHGVMACG 134
Query  121  WVDGEVQ 127
             V G+V+
Sbjct  135  TVHGQVE 141

Sequence Alignment: 4. Allergen Name: Lep d 2.0201 Sequence ID: CAA58755

 Score = 138.2 bits 498,  Expect = 7e-35
 Identities = 69/125 55%, Positives = 94/125 75%, Gaps = 2/125 1%
Query  1    GKMNFTDCGHNEIKELSVSNCTGNYCVIHRGKPLTLDAKFDANQDTASVGLVLTAIIDGD 60
            GKM F DCGH E+ EL +S C+G+ CVIHRG+ +TLDAKF ANQDT  V + + A + G 
Sbjct  17   GKMTFKDCGHGEVTELDISGCSGDTCVIHRGQKMTLDAKFAANQDTNKVTIKVLAKVAGT 76
Query  61   IAIDIPGLETNACKLMKCPIRKGEHQELIYNIGEIPDATPEIKAKVKAQLIGEHGVLACG 120
              I +PGLET+ CK++KCPI+KGE  ++ Y +  IP  TP+IKA V A+L+G+HGV+ACG
Sbjct  77   -TIQVPGLETDGCKVLKCPIKKGEALDFNYGM-TIPAITPKIKADVTAELVGDHGVMACG 134
Query  121  WVDGEVQ 127
             + G+V+
Sbjct  135  TIHGQVE 141

Sequence Alignment: 5. Allergen Name: Lep d 2.0202 Sequence ID: CAD32314

 Score = 136.9 bits 493,  Expect = 2e-34
 Identities = 68/125 54%, Positives = 93/125 74%, Gaps = 2/125 1%
Query  1    GKMNFTDCGHNEIKELSVSNCTGNYCVIHRGKPLTLDAKFDANQDTASVGLVLTAIIDGD 60
            GKM F DCGH E+ EL +S C+G+ CVIHRG+ +TLDAKF ANQDT  V + + A + G 
Sbjct  17   GKMTFKDCGHGEVTELDISGCSGDTCVIHRGQKMTLDAKFAANQDTNKVTIKVLAKVAGT 76
Query  61   IAIDIPGLETNACKLMKCPIRKGEHQELIYNIGEIPDATPEIKAKVKAQLIGEHGVLACG 120
              I +PGLET+ CK++KCPI+KGE  ++ Y +  IP  TP+IK  V A+L+G+HGV+ACG
Sbjct  77   -TIQVPGLETDGCKVLKCPIKKGEALDFNYGM-TIPAITPKIKVDVTAELVGDHGVMACG 134
Query  121  WVDGEVQ 127
             + G+V+
Sbjct  135  TIHGQVE 141

Sequence Alignment: 6. Allergen Name: Gly d 2.0201 Sequence ID: CAB76459

 Score = 130.6 bits 469,  Expect = 1e-32
 Identities = 64/125 51%, Positives = 92/125 73%, Gaps = 2/125 1%
Query  1    GKMNFTDCGHNEIKELSVSNCTGNYCVIHRGKPLTLDAKFDANQDTASVGLVLTAIIDGD 60
            GKM F DCG  E+ EL +++C+G++CVIHRGKPLTL+AKF ANQDT    + + A + G 
Sbjct  1    GKMKFKDCGKGEVTELDITDCSGDFCVIHRGKPLTLEAKFAANQDTTKATIKVLAKVAGT 60
Query  61   IAIDIPGLETNACKLMKCPIRKGEHQELIYNIGEIPDATPEIKAKVKAQLIGEHGVLACG 120
              I +PGLET+ CK++KCPI+KG+  ++ Y    +P   P++KA+V A+L+G+HGVLACG
Sbjct  61   -PIQVPGLETDGCKFVKCPIKKGDPIDFKYTT-TVPAILPKVKAEVTAELVGDHGVLACG 118
Query  121  WVDGEVQ 127
                +V+
Sbjct  119  RFGRQVE 125

Sequence Alignment: 7. Allergen Name: Tyr p 2 Sequence ID: O02380

 Score = 114.9 bits 410,  Expect = 7e-28
 Identities = 56/125 44%, Positives = 85/125 68%, Gaps = 2/125 1%
Query  1    GKMNFTDCGHNEIKELSVSNCTGNYCVIHRGKPLTLDAKFDANQDTASVGLVLTAIIDGD 60
            G++ FTDCG  EI  ++V  C G+ CVIH+ KP+ + A+F ANQDT  + + +T  ++G 
Sbjct  16   GQVKFTDCGKKEIASVAVDGCEGDLCVIHKSKPVHVIAEFTANQDTCKIEVKVTGQLNG- 74
Query  61   IAIDIPGLETNACKLMKCPIRKGEHQELIYNIGEIPDATPEIKAKVKAQLIGEHGVLACG 120
            + + IPG+ET+ CK++KCP++KG    + Y++  +P   P IK  VK    GEHGVLACG
Sbjct  75   LEVPIPGIETDGCKVLKCPLKKGTKYTMNYSVN-VPSVVPNIKTVVKLLATGEHGVLACG 133
Query  121  WVDGEVQ 127
             V+ +V+
Sbjct  134  AVNTDVK 140

Sequence Alignment: 8. Allergen Name: Der f 35.0101 Sequence ID: BAX34757

 Score = 113.1 bits 403,  Expect = 3e-27
 Identities = 51/126 40%, Positives = 87/126 69%, Gaps = 2/126 1%
Query  1    GKMNFTDCGHNEIKELSVSNCTGNYCVIHRGKPLTLDAKFDANQDTASVGLVLTAIIDGD 60
            GKM F DCGH E+  L VS C G+YCV+H+GK + LD K  +NQD+  + L+++A ++G 
Sbjct  18   GKMKFVDCGHKEVISLDVSGCEGDYCVLHKGKTIDLDMKCKSNQDSEHLKLIISADVNG- 76
Query  61   IAIDIPGLETNACKLMKCPIRKGEHQELIYNIGEIPDATPEIKAKVKAQLIGEHGVLACG 120
            I I++PG++ + C  ++CPI KG+  ++ Y+   +P   P IK  + A++IG++G++ C 
Sbjct  77   IEIEVPGFDQDGCHYVQCPIHKGQDYDIKYSYN-VPAVLPNIKGTLTAKVIGDNGLVGCL 135
Query  121  WVDGEVQE 128
             ++GE+ +
Sbjct  136  KLNGEIAD 143

Sequence Alignment: 9. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP1

 Score = 110.7 bits 394,  Expect = 1e-26
 Identities = 53/124 42%, Positives = 85/124 68%, Gaps = 2/124 1%
Query  1    GKMNFTDCGHNEIKELSVSNCTGNYCVIHRGKPLTLDAKFDANQDTASVGLVLTAIIDGD 60
            G + FTDC H E+  L +S C+G++C+IH+GK +TL   F ANQD+  + + ++AI++ +
Sbjct  17   GDVKFTDCAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQDSEKLEIKISAIMN-N 75
Query  61   IAIDIPGLETNACKLMKCPIRKGEHQELIYNIGEIPDATPEIKAKVKAQLIGEHGVLACG 120
            I + +PG++ + CK   CP++KG+  EL Y++  IP   P +K    A L+G+HGV+ACG
Sbjct  76   IEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLI-IPTILPNLKTVTTASLVGDHGVVACG 134
Query  121  WVDGEV 126
             V+ EV
Sbjct  135  KVNTEV 140

Sequence Alignment: 10. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP2

 Score = 110.7 bits 394,  Expect = 1e-26
 Identities = 53/124 42%, Positives = 85/124 68%, Gaps = 2/124 1%
Query  1    GKMNFTDCGHNEIKELSVSNCTGNYCVIHRGKPLTLDAKFDANQDTASVGLVLTAIIDGD 60
            G + FTDC H E+  L +S C+G++C+IH+GK +TL   F ANQD+  + + ++AI++ +
Sbjct  17   GDVKFTDCAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQDSEKLEIKISAIMN-N 75
Query  61   IAIDIPGLETNACKLMKCPIRKGEHQELIYNIGEIPDATPEIKAKVKAQLIGEHGVLACG 120
            I + +PG++ + CK   CP++KG+  EL Y++  IP   P +K    A L+G+HGV+ACG
Sbjct  76   IEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLI-IPTILPNLKTVTTASLVGDHGVVACG 134
Query  121  WVDGEV 126
             V+ EV
Sbjct  135  KVNTEV 140

Sequence Alignment: 11. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP3

 Score = 110.7 bits 394,  Expect = 1e-26
 Identities = 53/124 42%, Positives = 85/124 68%, Gaps = 2/124 1%
Query  1    GKMNFTDCGHNEIKELSVSNCTGNYCVIHRGKPLTLDAKFDANQDTASVGLVLTAIIDGD 60
            G + FTDC H E+  L +S C+G++C+IH+GK +TL   F ANQD+  + + ++AI++ +
Sbjct  17   GDVKFTDCAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQDSEKLEIKISAIMN-N 75
Query  61   IAIDIPGLETNACKLMKCPIRKGEHQELIYNIGEIPDATPEIKAKVKAQLIGEHGVLACG 120
            I + +PG++ + CK   CP++KG+  EL Y++  IP   P +K    A L+G+HGV+ACG
Sbjct  76   IEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLI-IPTILPNLKTITTASLVGDHGVVACG 134
Query  121  WVDGEV 126
             V+ EV
Sbjct  135  KVNTEV 140

Sequence Alignment: 12. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP6

 Score = 110.7 bits 394,  Expect = 1e-26
 Identities = 53/124 42%, Positives = 85/124 68%, Gaps = 2/124 1%
Query  1    GKMNFTDCGHNEIKELSVSNCTGNYCVIHRGKPLTLDAKFDANQDTASVGLVLTAIIDGD 60
            G + FTDC H E+  L +S C+G++C+IH+GK +TL   F ANQD+  + + ++AI++ +
Sbjct  17   GDVKFTDCAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQDSEKLEIKISAIMN-N 75
Query  61   IAIDIPGLETNACKLMKCPIRKGEHQELIYNIGEIPDATPEIKAKVKAQLIGEHGVLACG 120
            I + +PG++ + CK   CP++KG+  EL Y++  IP   P +K    A L+G+HGV+ACG
Sbjct  76   IEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLI-IPTILPNLKTVTTASLVGDHGVVACG 134
Query  121  WVDGEV 126
             V+ EV
Sbjct  135  KVNTEV 140

Sequence Alignment: 13. Allergen Name: Blo t 2.0101 Sequence ID: AAQ73483

 Score = 110.7 bits 394,  Expect = 1e-26
 Identities = 53/124 42%, Positives = 85/124 68%, Gaps = 2/124 1%
Query  1    GKMNFTDCGHNEIKELSVSNCTGNYCVIHRGKPLTLDAKFDANQDTASVGLVLTAIIDGD 60
            G + FTDC H E+  L +S C+G++C+IH+GK +TL   F ANQD+  + + ++AI++ +
Sbjct  19   GDVKFTDCAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQDSEKLEIKISAIMN-N 77
Query  61   IAIDIPGLETNACKLMKCPIRKGEHQELIYNIGEIPDATPEIKAKVKAQLIGEHGVLACG 120
            I + +PG++ + CK   CP++KG+  EL Y++  IP   P +K    A L+G+HGV+ACG
Sbjct  78   IEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLI-IPTILPNLKTVTTASLVGDHGVVACG 136
Query  121  WVDGEV 126
             V+ EV
Sbjct  137  KVNTEV 142

Sequence Alignment: 14. Allergen Name: Blo t 2.0104 Sequence ID: A6XEN9

 Score = 110.5 bits 393,  Expect = 2e-26
 Identities = 53/124 42%, Positives = 83/124 66%, Gaps = 2/124 1%
Query  1    GKMNFTDCGHNEIKELSVSNCTGNYCVIHRGKPLTLDAKFDANQDTASVGLVLTAIIDGD 60
            G + FTDC H E+  L +S C+G++C IH+GK +TL   F ANQD+  + + ++A ++G 
Sbjct  17   GDVKFTDCAHGEVTSLDLSGCSGDHCTIHKGKSFTLKTFFIANQDSEKLEIKISATMNG- 75
Query  61   IAIDIPGLETNACKLMKCPIRKGEHQELIYNIGEIPDATPEIKAKVKAQLIGEHGVLACG 120
            I + +PG++ + CK   CP++KG+  EL Y++  IP   P +K    A L+G+HGV+ACG
Sbjct  76   IEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLI-IPTVLPNVKTVTTASLVGDHGVVACG 134
Query  121  WVDGEV 126
             V+ EV
Sbjct  135  KVNTEV 140

Sequence Alignment: 15. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP5

 Score = 110.2 bits 392,  Expect = 2e-26
 Identities = 53/124 42%, Positives = 83/124 66%, Gaps = 2/124 1%
Query  1    GKMNFTDCGHNEIKELSVSNCTGNYCVIHRGKPLTLDAKFDANQDTASVGLVLTAIIDGD 60
            G + FTDC H E+  L +S C+G++C IH+GK +TL   F ANQD+  + + ++A ++G 
Sbjct  17   GDVKFTDCAHGEVTSLDLSRCSGDHCTIHKGKSFTLKTFFIANQDSEKLEIKISATMNG- 75
Query  61   IAIDIPGLETNACKLMKCPIRKGEHQELIYNIGEIPDATPEIKAKVKAQLIGEHGVLACG 120
            I + +PG++ + CK   CP++KG+  EL Y++  IP   P +K    A L+G+HGV+ACG
Sbjct  76   IEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLI-IPTVLPNVKTVTTASLVGDHGVVACG 134
Query  121  WVDGEV 126
             V+ EV
Sbjct  135  KVNTEV 140

Sequence Alignment: 16. Allergen Name: Blo t 2.0104 Sequence ID: A6XEN8

 Score = 109.7 bits 390,  Expect = 3e-26
 Identities = 53/124 42%, Positives = 83/124 66%, Gaps = 2/124 1%
Query  1    GKMNFTDCGHNEIKELSVSNCTGNYCVIHRGKPLTLDAKFDANQDTASVGLVLTAIIDGD 60
            G + FTDC H E+  L +S C+G++C IH+GK +TL   F ANQD+  + + ++A ++G 
Sbjct  17   GDVKFTDCAHGEVTSLDLSGCSGDHCTIHKGKSFTLKTFFIANQDSEKLEIKISATMNG- 75
Query  61   IAIDIPGLETNACKLMKCPIRKGEHQELIYNIGEIPDATPEIKAKVKAQLIGEHGVLACG 120
            I + +PG++ + CK   CP++KG+  EL Y++  IP   P +K    A L+G+HGV+ACG
Sbjct  76   IEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLI-IPTILPNLKTVTTASLVGDHGVVACG 134
Query  121  WVDGEV 126
             V+ EV
Sbjct  135  KVNTEV 140

Sequence Alignment: 17. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP4

 Score = 108.3 bits 385,  Expect = 7e-26
 Identities = 52/124 41%, Positives = 84/124 67%, Gaps = 2/124 1%
Query  1    GKMNFTDCGHNEIKELSVSNCTGNYCVIHRGKPLTLDAKFDANQDTASVGLVLTAIIDGD 60
            G + FTDC H E+  L +S C+ ++C+IH+GK +TL   F ANQD+  + + ++AI++ +
Sbjct  17   GDVKFTDCAHGEVTSLDLSGCSDDHCIIHKGKSFTLKTFFIANQDSEKLEIKISAIMN-N 75
Query  61   IAIDIPGLETNACKLMKCPIRKGEHQELIYNIGEIPDATPEIKAKVKAQLIGEHGVLACG 120
            I + +PG++ + CK   CP++KG+  EL Y++  IP   P +K    A L+G+HGV+ACG
Sbjct  76   IEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLI-IPTILPNLKTVTTASLVGDHGVVACG 134
Query  121  WVDGEV 126
             V+ EV
Sbjct  135  KVNTEV 140

Sequence Alignment: 18. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP0

 Score = 108.1 bits 384,  Expect = 9e-26
 Identities = 52/124 41%, Positives = 84/124 67%, Gaps = 2/124 1%
Query  1    GKMNFTDCGHNEIKELSVSNCTGNYCVIHRGKPLTLDAKFDANQDTASVGLVLTAIIDGD 60
            G + FTDC H E+  L +S C+G++C+I +GK +TL   F ANQD+  + + ++AI++ +
Sbjct  17   GDVKFTDCAHGEVTSLDLSGCSGDHCIIRKGKSFTLKTFFIANQDSEKLEIKISAIMN-N 75
Query  61   IAIDIPGLETNACKLMKCPIRKGEHQELIYNIGEIPDATPEIKAKVKAQLIGEHGVLACG 120
            I + +PG++ + CK   CP++KG+  EL Y++  IP   P +K    A L+G+HGV+ACG
Sbjct  76   IEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLI-IPTILPNLKTVTTASLVGDHGVVACG 134
Query  121  WVDGEV 126
             V+ EV
Sbjct  135  KVNTEV 140

Sequence Alignment: 19. Allergen Name: Blo t 2.0102 Sequence ID: AAQ73482

 Score = 108.1 bits 384,  Expect = 9e-26
 Identities = 52/124 41%, Positives = 84/124 67%, Gaps = 2/124 1%
Query  1    GKMNFTDCGHNEIKELSVSNCTGNYCVIHRGKPLTLDAKFDANQDTASVGLVLTAIIDGD 60
            G + FT C H E+  L +S C+G++C+IH+GK +TL   F ANQD+  + + ++AI++ +
Sbjct  17   GDVKFTACAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQDSEKLEIKISAIMN-N 75
Query  61   IAIDIPGLETNACKLMKCPIRKGEHQELIYNIGEIPDATPEIKAKVKAQLIGEHGVLACG 120
            I + +PG++ + CK   CP++KG+  EL Y++  IP   P +K    A L+G+HGV+ACG
Sbjct  76   IEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLI-IPTILPNLKTVTTASLVGDHGVVACG 134
Query  121  WVDGEV 126
             V+ EV
Sbjct  135  KVNTEV 140

Sequence Alignment: 20. Allergen Name: Lep d 2.0101 Sequence ID: CAA57160

 Score = 105.6 bits 374,  Expect = 3e-25
 Identities = 55/98 56%, Positives = 77/98 78%, Gaps = 2/98 2%
Query  28   IHRGKPLTLDAKFDANQDTASVGLVLTAIIDGDIAIDIPGLETNACKLMKCPIRKGEHQE 87
            IHRG+ +TL+AKF ANQDTA V + + A + G   I +PGLET+ CK++KCP++KGE  +
Sbjct  1    IHRGEKMTLEAKFAANQDTAKVTIKVLAKVAGT-TIQVPGLETDGCKFIKCPVKKGEALD 59
Query  88   LIYNIGEIPDATPEIKAKVKAQLIGEHGVLACGWVDGEVQ 127
            +IY+ G IP  TP++KA V A+LIG+HGV+ACG V G+V+
Sbjct  60   FIYS-GTIPAITPKVKADVTAELIGDHGVMACGTVHGQVE 98

Sequence Alignment: 21. Allergen Name: Der f 2 Sequence ID: Q00855

 Score = 104.9 bits 372,  Expect = 8e-25
 Identities = 54/116 46%, Positives = 85/116 73%, Gaps = 4/116 3%
Query  2    KMNFTDCGHNEIKELSVSNCTG-NYCVIHRGKPLTLDAKFDANQDTASVGLVLTAIIDGD 60
            +++  DC +NEIK++ V  C G + C+IHRGKP+TL+A FDANQ+T +  + + A +DG 
Sbjct  19   QVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDG- 77
Query  61   IAIDIPGLETNACKLMKCPIRKGEHQELIYNIGEIPDATPEIK-AKVKAQLIGEHGVLAC 119
            + ID+PG++TNAC +MKCP+ KG++ ++ Y    +P   P+ +   V  +LIG++GVLAC
Sbjct  78   LEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWN-VPKIAPKSENVVVTVKLIGDNGVLAC 136

Sequence Alignment: 22. Allergen Name: Der f 2 Sequence ID: BAA01241

 Score = 103.6 bits 367,  Expect = 2e-24
 Identities = 53/116 45%, Positives = 84/116 72%, Gaps = 4/116 3%
Query  2    KMNFTDCGHNEIKELSVSNCTG-NYCVIHRGKPLTLDAKFDANQDTASVGLVLTAIIDGD 60
            +++  DC +NEIK++ V  C G + C+IHRGKP+TL+A FDANQ+T +  + + A +DG 
Sbjct  11   QVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDG- 69
Query  61   IAIDIPGLETNACKLMKCPIRKGEHQELIYNIGEIPDATPEIK-AKVKAQLIGEHGVLAC 119
            + ID+PG++TNAC +MKCP+ KG++ +  Y    +P   P+ +   V  +L+G++GVLAC
Sbjct  70   LEIDVPGIDTNACHFMKCPLVKGQQYDAKYTWN-VPKIAPKSENVVVTVKLVGDNGVLAC 128

Sequence Alignment: 23. Allergen Name: Der f 2 Sequence ID: BAA01239

 Score = 103.3 bits 366,  Expect = 2e-24
 Identities = 53/116 45%, Positives = 85/116 73%, Gaps = 4/116 3%
Query  2    KMNFTDCGHNEIKELSVSNCTG-NYCVIHRGKPLTLDAKFDANQDTASVGLVLTAIIDGD 60
            +++  DC +NEIK++ V  C G + C+IHRGKP+TL+A FDANQ+T +  + + A +DG 
Sbjct  11   QVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDG- 69
Query  61   IAIDIPGLETNACKLMKCPIRKGEHQELIYNIGEIPDATPEIK-AKVKAQLIGEHGVLAC 119
            + ID+PG++TNAC ++KCP+ KG++ ++ Y    +P   P+ +   V  +LIG++GVLAC
Sbjct  70   LEIDVPGIDTNACHFVKCPLVKGQQYDIKYTWN-VPKIAPKSENVVVTVKLIGDNGVLAC 128

Sequence Alignment: 24. Allergen Name: Der f 2 Sequence ID: AAK30133

 Score = 98.5 bits 348,  Expect = 8e-23
 Identities = 52/108 48%, Positives = 80/108 74%, Gaps = 4/108 3%
Query  10   HNEIKELSVSNCTG-NYCVIHRGKPLTLDAKFDANQDTASVGLVLTAIIDGDIAIDIPGL 68
            +NEIK++ V  C G + C+IHRGKP+TL+A FDANQ+T +  + + A +DG + ID+PG+
Sbjct  51   NNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDG-LEIDVPGI 109
Query  69   ETNACKLMKCPIRKGEHQELIYNIGEIPDATPEIK-AKVKAQLIGEHGVLAC 119
            +TNAC +MKCP+ KG++ ++ Y    +P   P+ +   V  +LIG++GVLAC
Sbjct  110  DTNACHFMKCPLVKGQQYDIKYTWN-VPKIAPKSENVVVTVKLIGDNGVLAC 160

Sequence Alignment: 25. Allergen Name: Der f 2.0109 Sequence ID: ABA39438

 Score = 97.8 bits 345,  Expect = 1e-22
 Identities = 51/116 43%, Positives = 84/116 72%, Gaps = 4/116 3%
Query  2    KMNFTDCGHNEIKELSVSNCTG-NYCVIHRGKPLTLDAKFDANQDTASVGLVLTAIIDGD 60
            +++  DC +NEIK++ V    G + C+IHRGKP+TL+A FDANQ+T +  + + A I+G 
Sbjct  2    QVDVKDCANNEIKKVMVDGRHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKANING- 60
Query  61   IAIDIPGLETNACKLMKCPIRKGEHQELIYNIGEIPDATPEIK-AKVKAQLIGEHGVLAC 119
            + +D+PG++TNAC ++KCP+ KG++ ++ Y    +P   P+ +   V  +LIG++GVLAC
Sbjct  61   LEVDVPGIDTNACHFVKCPLVKGQQYDIKYTWN-VPKIAPKSENVVVTVKLIGDNGVLAC 119

Sequence Alignment: 26. Allergen Name: Blo t 2.0103 Sequence ID: AAQ73481

 Score = 97.0 bits 342,  Expect = 2e-22
 Identities = 47/113 41%, Positives = 78/113 69%, Gaps = 2/113 1%
Query  12   EIKELSVSNCTGNYCVIHRGKPLTLDAKFDANQDTASVGLVLTAIIDGDIAIDIPGLETN 71
            E+  L +S C+G++C+IH+GK +TL   F ANQD+  + + ++AI++ +I + +PG++ +
Sbjct  27   EVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQDSEKLEIKISAIMN-NIEVPVPGVDKD 85
Query  72   ACKLMKCPIRKGEHQELIYNIGEIPDATPEIKAKVKAQLIGEHGVLACGWVDGEV 126
             CK   CP++KG+  EL Y++  IP   P +K    A L+G+HGV+ACG V+ EV
Sbjct  86   GCKHTTCPLKKGQKYELDYSLI-IPTILPNLKTVTTASLVGDHGVVACGKVNTEV 139

Sequence Alignment: 27. Allergen Name: Der p 2 Sequence ID: P49278

 Score = 95.7 bits 337,  Expect = 5e-22
 Identities = 48/116 41%, Positives = 81/116 69%, Gaps = 4/116 3%
Query  2    KMNFTDCGHNEIKELSVSNCTGNY-CVIHRGKPLTLDAKFDANQDTASVGLVLTAIIDGD 60
            +++  DC ++EIK++ V  C G+  C+IHRGKP+ L+A F+ANQ+T +  + + A IDG 
Sbjct  19   QVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNTKTAKIEIKASIDG- 77
Query  61   IAIDIPGLETNACKLMKCPIRKGEHQELIYNIGEIPDATPEIK-AKVKAQLIGEHGVLAC 119
            + +D+PG++ NAC  MKCP+ KG++ ++ Y    +P   P+ +   V  +++G+ GVLAC
Sbjct  78   LEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWN-VPKIAPKSENVVVTVKVMGDDGVLAC 136

Sequence Alignment: 28. Allergen Name: Der p 2.0115 Sequence ID: CAQ68249

 Score = 95.5 bits 336,  Expect = 5e-22
 Identities = 47/116 40%, Positives = 82/116 70%, Gaps = 4/116 3%
Query  2    KMNFTDCGHNEIKELSVSNCTGNY-CVIHRGKPLTLDAKFDANQDTASVGLVLTAIIDGD 60
            +++  DC ++EIK++ V  C G+  C+IHRGKP+ L+A F+ANQ++ +  + + A IDG 
Sbjct  2    QVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDG- 60
Query  61   IAIDIPGLETNACKLMKCPIRKGEHQELIYNIGEIPDATPEIK-AKVKAQLIGEHGVLAC 119
            + +D+PG++ NAC  MKCP+ KG++ ++ Y    +P   P+ +   V  +++G++GVLAC
Sbjct  61   LEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWN-VPKIAPKSENVVVTVKVMGDNGVLAC 119

Sequence Alignment: 29. Allergen Name: Der p 2.0109 Sequence ID: ABA39437

 Score = 95.5 bits 336,  Expect = 5e-22
 Identities = 47/116 40%, Positives = 82/116 70%, Gaps = 4/116 3%
Query  2    KMNFTDCGHNEIKELSVSNCTGNY-CVIHRGKPLTLDAKFDANQDTASVGLVLTAIIDGD 60
            +++  DC ++EIK++ V  C G+  C+IHRGKP+ L+A F+ANQ++ +  + + A IDG 
Sbjct  2    QVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDG- 60
Query  61   IAIDIPGLETNACKLMKCPIRKGEHQELIYNIGEIPDATPEIK-AKVKAQLIGEHGVLAC 119
            + +D+PG++ NAC  MKCP+ KG++ ++ Y    +P   P+ +   V  +++G++GVLAC
Sbjct  61   LEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWN-VPKIAPKSENVVVTVKVLGDNGVLAC 119

Sequence Alignment: 30. Allergen Name: Der p 2.0114 Sequence ID: CAK22338

 Score = 94.3 bits 332,  Expect = 1e-21
 Identities = 47/116 40%, Positives = 82/116 70%, Gaps = 4/116 3%
Query  2    KMNFTDCGHNEIKELSVSNCTGNY-CVIHRGKPLTLDAKFDANQDTASVGLVLTAIIDGD 60
            +++  DC ++EIK++ V  C G+  C+IHRGKP+ L+A F+ANQ+T +  + + A IDG 
Sbjct  19   QVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEALFEANQNTKNAKIEIKASIDG- 77
Query  61   IAIDIPGLETNACKLMKCPIRKGEHQELIYNIGEIPDATPEIK-AKVKAQLIGEHGVLAC 119
            + +D+PG++ NAC  +KCP+ KG++ ++ Y    +P   P+ +   V  +++G++GVLAC
Sbjct  78   LEVDVPGIDPNACHYVKCPLVKGQQYDIKYTWN-VPKIAPKSENVVVTVKVLGDNGVLAC 136

Sequence Alignment: 31. Allergen Name: Eur m 2 Sequence ID: Q9TZZ2

 Score = 93.8 bits 330,  Expect = 2e-21
 Identities = 48/116 41%, Positives = 79/116 68%, Gaps = 4/116 3%
Query  2    KMNFTDCGHNEIKELSVSNCTGNY-CVIHRGKPLTLDAKFDANQDTASVGLVLTAIIDGD 60
            +++  DC ++EIK++ V  C G+  CVIHRG  + L+A FDANQ++ +  + + A IDG 
Sbjct  18   QVDIKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEIKATIDG- 76
Query  61   IAIDIPGLETNACKLMKCPIRKGEHQELIYNIGEIPDATPEIK-AKVKAQLIGEHGVLAC 119
            + ID+PG++ N C +MKCP+ KG+  ++ Y    +P   P+ +   V  +L+G++GVLAC
Sbjct  77   VEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWN-VPRIAPKSENVVVTVKLLGDNGVLAC 135

Sequence Alignment: 32. Allergen Name: Eur m 2.0102 Sequence ID: AAC82350

 Score = 93.6 bits 329,  Expect = 2e-21
 Identities = 48/116 41%, Positives = 79/116 68%, Gaps = 4/116 3%
Query  2    KMNFTDCGHNEIKELSVSNCTGNY-CVIHRGKPLTLDAKFDANQDTASVGLVLTAIIDGD 60
            +++  DC ++EIK++ V  C G+  CVIHRG  + L+A FDANQ++ +  + + A IDG 
Sbjct  8    QVDVKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEIKATIDG- 66
Query  61   IAIDIPGLETNACKLMKCPIRKGEHQELIYNIGEIPDATPEIK-AKVKAQLIGEHGVLAC 119
            + ID+PG++ N C +MKCP+ KG+  ++ Y    +P   P+ +   V  +L+G++GVLAC
Sbjct  67   VEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWN-VPRIAPKSENVVVTVKLLGDNGVLAC 125

Sequence Alignment: 33. Allergen Name: Can f 7.0101 Sequence ID: Q28895

 Score = 60.8 bits 205,  Expect = 2e-11
 Identities = 39/118 33%, Positives = 66/118 55%, Gaps = 7/118 5%
Query  1    GKMNFTDCGH--NEIKELSVSNCTGNYCVIHRGKPLTLDAKFDANQDTASVGLVLTAIID 58
            G ++F DCG     IKEL+V+ C    C +H+G+  +++  F +N  + S   V+  I+ 
Sbjct  20   GAVHFKDCGSAVGVIKELNVNPCPAQPCKLHKGQSYSVNVTFTSNIPSQSSKAVVHGIVL 79
Query  59   GDIAIDIPGLETNACKL-MKCPIRKGEHQELIYNIGEIPDATPEIKAKVKAQLIGEHGV- 116
            G +A+  P  E + CK  + CPI+K +    + N   + +  P IK  V+  L+G++   
Sbjct  80   G-VAVPFPIPEADGCKSGINCPIQKDKTYSYL-NKLPVKNEYPSIKLVVQWMLLGDNNQH 137
Query  117  LACGW 121
            L C W
Sbjct  138  LFC-W 141

Sequence Alignment: 34. Allergen Name: Der f 22.0101 Sequence ID: ABG76195

 Score = 58.1 bits 195,  Expect = 1e-10
 Identities = 42/115 36%, Positives = 66/115 57%, Gaps = 11/115 9%
Query  3    MNFTDCGHNEIKELSVSNCTGNY--CVIHRGKPLTLDAKFDANQDTASVGLVLTAIIDGD 60
            + + DCGHNEIK + V+    N   CVIH+     L   F AN++T +          G 
Sbjct  25   VQYKDCGHNEIKSFFVTGGNPNQKSCVIHKHSKNQLRISFVANENTGNKINTRFICNLGG 84
Query  61   IAIDIPGLE-TNACKL--MKCPIRKGE--HQELIYNIGE-IPDATPEIKAKVKAQLIGEH 114
            I +  PG++ T+AC+   + CP+ KG+  +  L +N+G+ +P A   + A V+ +  G  
Sbjct  85   IELGWPGIDGTDACQGHGLSCPLTKGQTYNYHLDFNLGDDVPTAN--VTATVRLE-NGHG 141
Query  115  GVLACG 120
            G L CG
Sbjct  142  GDLLCG 147

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.