The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

GLLPKCKLVPEQISFILSTRENRNGVFLTLDSLKKGGILNKSDLSSTQVVFLIHGFISSA
NNSNYMDMTKALLEKNDCMVISIDWRNGACTNEFQILKFIGYPKAVENTRTVGKYIADFS
KLLMQKYKVSLANIRLIGHSLGAQIAGFAGKEYQKFKLGKYPEIIGLDPAGPLFKSNDCS
QRICETDAHYVQIIHTSNNLGTERTLGTVDFYMNNGYNQPGCYYSFIGETCSHTRAVQYF
TECIRHECCLIGVPQSKNPQPVSKCTRNECVCVGLNAKRYPKTGSFYVPVESKAPYCNNK
GKKI
Sequence Info Allergen Name Length Opt Bits Score E Value
C0HLL3 Vesp v 1.0101 304 2066 477.5 2.8e-136
P53357 Dol m 1.02 303 1722 399.1 1.1e-112
ACA00159 Vesp c 1.0101 301 1424 331.1 3.1e-92
Q06478 Dol m 1.0101 317 1375 319.9 7.6e-89
P49369 Ves v 1 336 1315 306.2 1.1e-84
P51528 Ves m 1 300 1311 305.4 1.8e-84
ABN13879 Poly p 1.0101 322 1272 296.5 9.1e-82
Q9U6W0 Pol a 1 301 1214 283.3 8e-78
AAS67042 Pol d 1.0102 316 1171 273.4 7.6e-75
AAS67041 Pol d 1.0101 337 1167 272.5 1.5e-74
3989146 Ves s 1.0101 298 1164 271.9 2.1e-74
AAS67043 Pol d 1.0103 316 1161 271.2 3.7e-74
AAS67044 Pol d 1.0104 316 1154 269.6 1.1e-73
3989146 Pol e 1.0101 302 987 231.5 3e-62
AAT95008 Sol i 1.0101 346 498 120.0 1.3e-28
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Vesp v 1.0101 Sequence ID: C0HLL3

 Score = 477.5 bits 2066,  Expect = 3e-136
 Identities = 304/304 100%, Positives = 304/304 100%, Gaps = 0/304 0%
Query  1    GLLPKCKLVPEQISFILSTRENRNGVFLTLDSLKKGGILNKSDLSSTQVVFLIHGFISSA 60
            GLLPKCKLVPEQISFILSTRENRNGVFLTLDSLKKGGILNKSDLSSTQVVFLIHGFISSA
Sbjct  1    GLLPKCKLVPEQISFILSTRENRNGVFLTLDSLKKGGILNKSDLSSTQVVFLIHGFISSA 60
Query  61   NNSNYMDMTKALLEKNDCMVISIDWRNGACTNEFQILKFIGYPKAVENTRTVGKYIADFS 120
            NNSNYMDMTKALLEKNDCMVISIDWRNGACTNEFQILKFIGYPKAVENTRTVGKYIADFS
Sbjct  61   NNSNYMDMTKALLEKNDCMVISIDWRNGACTNEFQILKFIGYPKAVENTRTVGKYIADFS 120
Query  121  KLLMQKYKVSLANIRLIGHSLGAQIAGFAGKEYQKFKLGKYPEIIGLDPAGPLFKSNDCS 180
            KLLMQKYKVSLANIRLIGHSLGAQIAGFAGKEYQKFKLGKYPEIIGLDPAGPLFKSNDCS
Sbjct  121  KLLMQKYKVSLANIRLIGHSLGAQIAGFAGKEYQKFKLGKYPEIIGLDPAGPLFKSNDCS 180
Query  181  QRICETDAHYVQIIHTSNNLGTERTLGTVDFYMNNGYNQPGCYYSFIGETCSHTRAVQYF 240
            QRICETDAHYVQIIHTSNNLGTERTLGTVDFYMNNGYNQPGCYYSFIGETCSHTRAVQYF
Sbjct  181  QRICETDAHYVQIIHTSNNLGTERTLGTVDFYMNNGYNQPGCYYSFIGETCSHTRAVQYF 240
Query  241  TECIRHECCLIGVPQSKNPQPVSKCTRNECVCVGLNAKRYPKTGSFYVPVESKAPYCNNK 300
            TECIRHECCLIGVPQSKNPQPVSKCTRNECVCVGLNAKRYPKTGSFYVPVESKAPYCNNK
Sbjct  241  TECIRHECCLIGVPQSKNPQPVSKCTRNECVCVGLNAKRYPKTGSFYVPVESKAPYCNNK 300
Query  301  GKKI 304
            GKKI
Sbjct  301  GKKI 304

Sequence Alignment: 2. Allergen Name: Dol m 1.02 Sequence ID: P53357

 Score = 399.1 bits 1722,  Expect = 1e-112
 Identities = 247/303 81%, Positives = 275/303 90%, Gaps = 1/303 0%
Query  1    GLLPKCKLVPEQISFILSTRENRNGVFLTLDSLKKGGILNKSDLSSTQVVFLIHGFISSA 60
            G+LP+CKLVPE+ISF+LSTRENR+GV+LTL  LK G ++  SDLSS +V FLIHGFISSA
Sbjct  1    GILPECKLVPEEISFVLSTRENRDGVYLTLQKLKNGKMFKNSDLSSKKVPFLIHGFISSA 60
Query  61   NNSNYMDMTKALLEKNDCMVISIDWRNGACTNEFQILKFIGYPKAVENTRTVGKYIADFS 120
             N NY DMT+ALL+K+D MVISIDWR+GAC+NEF +LKFIGYPKAVENTR VGKYIADFS
Sbjct  61   TNKNYADMTRALLDKDDIMVISIDWRDGACSNEFALLKFIGYPKAVENTRAVGKYIADFS 120
Query  121  KLLMQKYKVSLANIRLIGHSLGAQIAGFAGKEYQKFKLGKYPEIIGLDPAGPLFKSNDCS 180
            K+L+QKYKV L NIRLIGHSLGAQIAGFAGKE+Q+FKLGKYPEIIGLDPAGP FK  DC 
Sbjct  121  KILIQKYKVLLENIRLIGHSLGAQIAGFAGKEFQRFKLGKYPEIIGLDPAGPSFKKKDCP 180
Query  181  QRICETDAHYVQIIHTSNNLGTERTLGTVDFYMNNGYNQPGCYYSFIGETCSHTRAVQYF 240
            +RICETDAHYVQI+HTS+NLGTERTLGTVDFY+N+G NQPGC Y  IGETCSHTRAV+Y+
Sbjct  181  ERICETDAHYVQILHTSSNLGTERTLGTVDFYINDGSNQPGCTY-IIGETCSHTRAVKYL 239
Query  241  TECIRHECCLIGVPQSKNPQPVSKCTRNECVCVGLNAKRYPKTGSFYVPVESKAPYCNNK 300
            TECIR ECCLIGVPQSKNPQPVSKCTRNECVCVGLNAK YPK GSFYVPVE+KAP+CNN 
Sbjct  240  TECIRRECCLIGVPQSKNPQPVSKCTRNECVCVGLNAKEYPKKGSFYVPVEAKAPFCNNN 299
Query  301  GKKI 304
            GK I
Sbjct  300  GKII 303

Sequence Alignment: 3. Allergen Name: Vesp c 1.0101 Sequence ID: ACA00159

 Score = 331.1 bits 1424,  Expect = 3e-92
 Identities = 210/298 70%, Positives = 239/298 80%, Gaps = 1/298 0%
Query  6    CKLVPEQISFILSTRENRNGVFLTLDSLKKGGILNKSDLSSTQVVFLIHGFISSANNSNY 65
            C    + +  I+ TREN+   F TLD++K    + K  ++    VF+ HGF SSA   N+
Sbjct  4    CPYSDDTVKMIVLTRENKKYDFYTLDTIKNHNEF-KDTITLKPHVFITHGFTSSATAENF 62
Query  66   MDMTKALLEKNDCMVISIDWRNGACTNEFQILKFIGYPKAVENTRTVGKYIADFSKLLMQ 125
            + M KALL+K + +VI  DWR  ACTNE   LK+  YP A  NTR VG YIA  +K+L+Q
Sbjct  63   VVMAKALLDKGNYLVILTDWRMAACTNEIAGLKLAYYPYAASNTRLVGNYIATVTKMLVQ 122
Query  126  KYKVSLANIRLIGHSLGAQIAGFAGKEYQKFKLGKYPEIIGLDPAGPLFKSNDCSQRICE 185
            KY V +ANIRLIGHSLGA+I+GFAGK+ Q++ LGKYPEIIGLDPAGP FKSNDCSQRICE
Sbjct  123  KYNVPMANIRLIGHSLGAHISGFAGKKVQELGLGKYPEIIGLDPAGPSFKSNDCSQRICE 182
Query  186  TDAHYVQIIHTSNNLGTERTLGTVDFYMNNGYNQPGCYYSFIGETCSHTRAVQYFTECIR 245
            TDA+YVQIIHTSN LGTERTLGTVDFYMNNGYNQPGC    IGETCSHTRAV+YFTECI+
Sbjct  183  TDANYVQIIHTSNRLGTERTLGTVDFYMNNGYNQPGCGLPIIGETCSHTRAVKYFTECIK 242
Query  246  HECCLIGVPQSKNPQPVSKCTRNECVCVGLNAKRYPKTGSFYVPVESKAPYCNNKGKKI 304
            HECCLIGVP+SKNPQPVSKCTRNECVCVGLNAK YPKTGSFYVPVESKAPYCNNKGK I
Sbjct  243  HECCLIGVPKSKNPQPVSKCTRNECVCVGLNAKTYPKTGSFYVPVESKAPYCNNKGKII 301

Sequence Alignment: 4. Allergen Name: Dol m 1.0101 Sequence ID: Q06478

 Score = 319.9 bits 1375,  Expect = 8e-89
 Identities = 197/297 66%, Positives = 239/297 80%, Gaps = 2/297 0%
Query  6    CKLVPEQISFILSTRENRNGVFLTLDSLKKGGILNKSDLSSTQVVFLIHGFISSANNSNY 65
            C +  + +  I+ TRENR   F TLD++ +   + KS +    VVF+ HGF SSA   N+
Sbjct  21   CPFSNDTVKMIFLTRENRKHDFYTLDTMNRHNEFKKS-IIKRPVVFITHGFTSSATEKNF 79
Query  66   MDMTKALLEKNDCMVISIDWRNGACTNEFQILKFIGYPKAVENTRTVGKYIADFSKLLMQ 125
            + M++AL+   D ++I +DWR  ACT+E+  LK++ Y  AV NTR VG +IA  +K L++
Sbjct  80   VAMSEALMHTGDFLIIMVDWRMAACTDEYPGLKYMFYKAAVGNTRLVGNFIAMIAKKLVE 139
Query  126  KYKVSLANIRLIGHSLGAQIAGFAGKEYQKFKLGKYPEIIGLDPAGPLFKSNDCSQRICE 185
            +YKV + NIRL+GHSLGA+I+GFAGK  Q++KLGK+ EIIGLDPAGP FK NDCS+RICE
Sbjct  140  QYKVPMTNIRLVGHSLGAHISGFAGKRVQELKLGKFSEIIGLDPAGPSFKKNDCSERICE 199
Query  186  TDAHYVQIIHTSNNLGTERTLGTVDFYMNNGYNQPGCYYSFIGETCSHTRAVQYFTECIR 245
            TDAHYVQI+HTS+NLGTERTLGTVDFY+NNG NQPGC Y  IGETCSHTRAV+YFTECIR
Sbjct  200  TDAHYVQILHTSSNLGTERTLGTVDFYINNGSNQPGCRY-IIGETCSHTRAVKYFTECIR 258
Query  246  HECCLIGVPQSKNPQPVSKCTRNECVCVGLNAKRYPKTGSFYVPVESKAPYCNNKGKKI 304
             ECCLIGVPQSKNPQPVSKCTRNECVCVGLNAK+YPK GSFYVPVE++APYCNN GK I
Sbjct  259  RECCLIGVPQSKNPQPVSKCTRNECVCVGLNAKKYPKRGSFYVPVEAEAPYCNNNGKII 317

Sequence Alignment: 5. Allergen Name: Ves v 1 Sequence ID: P49369

 Score = 306.2 bits 1315,  Expect = 1e-84
 Identities = 188/299 62%, Positives = 236/299 78%, Gaps = 2/299 0%
Query  4    PKCKLVPEQISFILSTRENRNGVFLTLDSLKKGGILNKSDLSSTQVVFLIHGFISSANNS 63
            PKC +  + +S I+ TRENRN  + TL +L+    + K  ++   VVF+ HGF SSA+ +
Sbjct  38   PKCPFNSDTVSIIIETRENRNRDLYTLQTLQNHPEFKKKTITRP-VVFITHGFTSSASET 96
Query  64   NYMDMTKALLEKNDCMVISIDWRNGACTNEFQILKFIGYPKAVENTRTVGKYIADFSKLL 123
            N++++ KAL++K++ MVISIDW+  ACTNE   LK++ YP A  NTR VG+YIA  ++ L
Sbjct  97   NFINLAKALVDKDNYMVISIDWQTAACTNEAAGLKYLYYPTAARNTRLVGQYIATITQKL 156
Query  124  MQKYKVSLANIRLIGHSLGAQIAGFAGKEYQKFKLGKYPEIIGLDPAGPLFKSNDCSQRI 183
            ++ YK+S+ANIRLIGHSLGA+ +GFAGK+ Q++KLGKY EIIGLDPA P F SN CS+R+
Sbjct  157  VKHYKISMANIRLIGHSLGAHASGFAGKKVQELKLGKYSEIIGLDPARPSFDSNHCSERL 216
Query  184  CETDAHYVQIIHTSNNLGTERTLGTVDFYMNNGYNQPGCYYSFIGETCSHTRAVQYFTEC 243
            CETDA YVQIIHTSN LGTE+TLGTVDFYMNNG NQPGC   F  E CSH+RAV Y  EC
Sbjct  217  CETDAEYVQIIHTSNYLGTEKTLGTVDFYMNNGKNQPGCGR-FFSEVCSHSRAVIYMAEC 275
Query  244  IRHECCLIGVPQSKNPQPVSKCTRNECVCVGLNAKRYPKTGSFYVPVESKAPYCNNKGKK 303
            I+HECCLIG+P+SK+ QP+S CT+ ECVCVGLNAK+YP  GSFYVPVES AP+CNNKGK 
Sbjct  276  IKHECCLIGIPKSKSSQPISSCTKQECVCVGLNAKKYPSRGSFYVPVESTAPFCNNKGKI 335
Query  304  I 304
            I
Sbjct  336  I 336

Sequence Alignment: 6. Allergen Name: Ves m 1 Sequence ID: P51528

 Score = 305.4 bits 1311,  Expect = 2e-84
 Identities = 187/299 62%, Positives = 234/299 78%, Gaps = 2/299 0%
Query  4    PKCKLVPEQISFILSTRENRNGVFLTLDSLKKGGILNKSDLSSTQVVFLIHGFISSANNS 63
            PKC +  + +S I+ TRENRN  + TL +L+    + K  ++   VVF+ HGF SSA+  
Sbjct  2    PKCPFNSDTVSIIIETRENRNRDLYTLQTLQNHPEFKKKTITRP-VVFITHGFTSSASEK 60
Query  64   NYMDMTKALLEKNDCMVISIDWRNGACTNEFQILKFIGYPKAVENTRTVGKYIADFSKLL 123
            N++++ KAL++K++ MVISIDW+  ACTNE+  LK+  YP A  NTR VG+YIA  ++ L
Sbjct  61   NFINLAKALVDKDNYMVISIDWQTAACTNEYPGLKYAYYPTAASNTRLVGQYIATITQKL 120
Query  124  MQKYKVSLANIRLIGHSLGAQIAGFAGKEYQKFKLGKYPEIIGLDPAGPLFKSNDCSQRI 183
            ++ YK+S+ANIRLIGHSLGA+++GFAGK  Q++KLGKY EIIGLDPA P F SN CS+R+
Sbjct  121  VKDYKISMANIRLIGHSLGAHVSGFAGKRVQELKLGKYSEIIGLDPARPSFDSNHCSERL 180
Query  184  CETDAHYVQIIHTSNNLGTERTLGTVDFYMNNGYNQPGCYYSFIGETCSHTRAVQYFTEC 243
            CETDA YVQIIHTSN LGTE+ LGTVDFYMNNG N PGC   F  E CSHTRAV Y  EC
Sbjct  181  CETDAEYVQIIHTSNYLGTEKILGTVDFYMNNGKNNPGCGR-FFSEVCSHTRAVIYMAEC 239
Query  244  IRHECCLIGVPQSKNPQPVSKCTRNECVCVGLNAKRYPKTGSFYVPVESKAPYCNNKGKK 303
            I+HECCLIG+P+SK+ QP+S+CT+ ECVCVGLNAK+YP  GSFYVPVES AP+CNNKGK 
Sbjct  240  IKHECCLIGIPRSKSSQPISRCTKQECVCVGLNAKKYPSRGSFYVPVESTAPFCNNKGKI 299
Query  304  I 304
            I
Sbjct  300  I 300

Sequence Alignment: 7. Allergen Name: Poly p 1.0101 Sequence ID: ABN13879

 Score = 296.5 bits 1272,  Expect = 9e-82
 Identities = 180/302 59%, Positives = 235/302 77%, Gaps = 5/302 1%
Query  1    GLLPKCKLVPEQISFILSTRENRNGVFLTLDSLKKGGILNKSDLSSTQVVFLIHGFISSA 60
            GL+P+C +    I F + TR+ R+G+ LT ++L+   ++ KS +S  QVVF+ HGF+S+ 
Sbjct  18   GLIPECPFNEYDILFFVYTRQQRDGIVLTEETLQNYDLFKKSTISR-QVVFIDHGFLSNG 76
Query  61   NNSNYMDMTKALLEKNDCMVISIDWRNGACTNEFQILKFIGYPKAVENTRTVGKYIADFS 120
            NN N++ M KAL+EK++ +VIS+DW+ GAC      L ++GY  AV NTR VGKY+ADF+
Sbjct  77   NNENFIAMAKALIEKDNFLVISVDWKKGACNAFASTLDYLGYSTAVGNTRHVGKYVADFT 136
Query  121  KLLMQKYKVSLANIRLIGHSLGAQIAGFAGKEYQKFKLGKYPEIIGLDPAGPLFKSNDCS 180
            KLL+++YKVS++NIRLIGHSLGA+ +GFAGKE Q++KL KY  I GLDPAGP F SNDC 
Sbjct  137  KLLVEQYKVSMSNIRLIGHSLGAHTSGFAGKEVQELKLNKYSNIDGLDPAGPSFDSNDCP 196
Query  181  QRICETDAHYVQIIHTSNNLGTERTLGTVDFYMNNGYNQPGCYYSFIGETCSHTRAVQYF 240
            +R+CETDA YVQIIHTSN LG    +GTVDFYMN G +QPGC   F   +CSHT+AV+Y+
Sbjct  197  ERLCETDAEYVQIIHTSNILGVYSKIGTVDFYMNYGSHQPGCGR-FFSPSCSHTKAVKYL 255
Query  241  TECIRHECCLIGVPQSK---NPQPVSKCTRNECVCVGLNAKRYPKTGSFYVPVESKAPYC 297
            TECI+HECCLIG P  K    P+P+S+CT++ CVCVGLNAK YP  GSFYVPVE+ APYC
Sbjct  256  TECIKHECCLIGTPWKKYFSTPKPISQCTKDTCVCVGLNAKSYPARGSFYVPVEATAPYC 315
Query  298  NNKGKKI 304
            +N+G K+
Sbjct  316  HNEGIKL 322

Sequence Alignment: 8. Allergen Name: Pol a 1 Sequence ID: Q9U6W0

 Score = 283.3 bits 1214,  Expect = 8e-78
 Identities = 175/295 59%, Positives = 228/295 77%, Gaps = 10/295 3%
Query  4    PKCKLVPEQISFILSTRENRNGVFLTLDSLKKGGILNKSDLSSTQVVFLIHGFISSANNS 63
            P C +  + I F + +R+ R+G+ L  ++L    ++ KS +S  QVVFLIHGF+S+ NN 
Sbjct  3    PDCTFNEKDIVFYVYSRDKRDGIILKKETLTNYDLFTKSTISK-QVVFLIHGFLSTGNNE 61
Query  64   NYMDMTKALLEKNDCMVISIDWRNGACTNEFQILK-FIGYPKAVENTRTVGKYIADFSKL 122
            N++ M+KAL+EK+D +VIS+DW+ GAC N F   K  +GY KAV NTR VGK++ADF+KL
Sbjct  62   NFVAMSKALIEKDDFLVISVDWKKGAC-NAFASTKDALGYSKAVGNTRHVGKFVADFTKL 120
Query  123  LMQKYKVSLANIRLIGHSLGAQIAGFAGKEYQKFKLGKYPEIIGLDPAGPLFKSNDCSQR 182
            L++KYKV ++NIRLIGHSLGA+ +GFAGKE QK+KLGKY EIIGLDPAGP F  +DC  R
Sbjct  121  LVEKYKVLISNIRLIGHSLGAHTSGFAGKEVQKLKLGKYKEIIGLDPAGPYFHRSDCPDR 180
Query  183  ICETDAHYVQIIHTSNNLGTERTLGTVDFYMNNGYNQPGCYYSFIGETCSHTRAVQYFTE 242
            +C TDA YVQ+IHTS  LG    +G+VDFY+N G NQPGC       +CSHT+AV+Y+TE
Sbjct  181  LCVTDAEYVQVIHTSIILGVYYNVGSVDFYVNYGKNQPGCNE----PSCSHTKAVKYLTE 236
Query  243  CIRHECCLIGVPQSK---NPQPVSKCTRNECVCVGLNAKRYPKTGSFYVPVESKAPYCNN 299
            CI+HECCLIG P  K    P+P+S+C  + CVCVGLNAK YP  G+FY PVE+ APYC+N
Sbjct  237  CIKHECCLIGTPWKKYFSTPKPISQCRGDTCVCVGLNAKSYPARGAFYAPVEANAPYCHN 296
Query  300  KGKKI 304
            +G K+
Sbjct  297  EGIKL 301

Sequence Alignment: 9. Allergen Name: Pol d 1.0102 Sequence ID: AAS67042

 Score = 273.4 bits 1171,  Expect = 8e-75
 Identities = 167/299 55%, Positives = 221/299 73%, Gaps = 8/299 2%
Query  1    GLLPKCKLVPEQISFILSTRENRNGVFLTLDSLKKGGILNKSDLSSTQVVFLIHGFISSA 60
            G+ P C +  + I + + +R+ RNG+ L  + LK   ++ KS +S  Q+  LIHGF+S+ 
Sbjct  15   GITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQISH-QIAILIHGFLSTG 73
Query  61   NNSNYMDMTKALLEKNDCMVISIDWRNGACTNEFQILKFIGYPKAVENTRTVGKYIADFS 120
            NN N+  M KAL+E ++ +VIS+DW+ GAC         +GY +AV NTR VGKY+ADF+
Sbjct  74   NNENFDAMAKALIEIDNFLVISVDWKKGACNAFASTNDVLGYSQAVGNTRHVGKYVADFT 133
Query  121  KLLMQKYKVSLANIRLIGHSLGAQIAGFAGKEYQKFKLGKYPEIIGLDPAGPLFKSNDCS 180
            KLL+++YKV ++NIRLIGHSLGA+ +GFAGKE Q++KLGKY EIIGLDPAGP F +N C 
Sbjct  134  KLLVEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGLDPAGPSFLTNKCP 193
Query  181  QRICETDAHYVQIIHTSNNLGTERTLGTVDFYMNNGYNQPGCYYSFIGETCSHTRAVQYF 240
             R+CETDA YVQ IHTS  LG    +G+VDFY+N G +QPGC       +CSHT+AV+Y+
Sbjct  194  NRLCETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSE----PSCSHTKAVKYL 249
Query  241  TECIRHECCLIGVPQSK---NPQPVSKCTRNECVCVGLNAKRYPKTGSFYVPVESKAPYC 297
            TECI+ ECCLIG P       P+P+S+C R+ CVCVGLNA+ YP  GSFYVPVE  APYC
Sbjct  250  TECIKRECCLIGTPWKSYFSTPKPISQCKRDTCVCVGLNAQSYPAKGSFYVPVEKDAPYC 309
Query  298  NNKGKKI 304
            +N+G K+
Sbjct  310  HNEGIKL 316

Sequence Alignment: 10. Allergen Name: Pol d 1.0101 Sequence ID: AAS67041

 Score = 272.5 bits 1167,  Expect = 2e-74
 Identities = 166/299 55%, Positives = 221/299 73%, Gaps = 8/299 2%
Query  1    GLLPKCKLVPEQISFILSTRENRNGVFLTLDSLKKGGILNKSDLSSTQVVFLIHGFISSA 60
            G+ P C +  + I + + +R+ RNG+ L  + LK   ++ KS +S  Q+  LIHGF+S+ 
Sbjct  36   GITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQISH-QIAILIHGFLSTG 94
Query  61   NNSNYMDMTKALLEKNDCMVISIDWRNGACTNEFQILKFIGYPKAVENTRTVGKYIADFS 120
            NN N+  M KAL+E ++ +VIS+DW+ GAC         +GY +AV NTR VGKY+ADF+
Sbjct  95   NNENFDAMAKALIEIDNFLVISVDWKKGACNAFASTNDVLGYSQAVGNTRHVGKYVADFT 154
Query  121  KLLMQKYKVSLANIRLIGHSLGAQIAGFAGKEYQKFKLGKYPEIIGLDPAGPLFKSNDCS 180
            KLL+++YKV ++NIRLIGHSLGA+ +GFAGKE Q++KLGKY EIIGLDPAGP F +N C 
Sbjct  155  KLLVEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGLDPAGPSFLTNKCP 214
Query  181  QRICETDAHYVQIIHTSNNLGTERTLGTVDFYMNNGYNQPGCYYSFIGETCSHTRAVQYF 240
             R+CETDA YVQ IHTS  LG    +G+VDFY+N G +QPGC       +CSHT+AV+Y+
Sbjct  215  NRLCETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSE----PSCSHTKAVKYL 270
Query  241  TECIRHECCLIGVPQSK---NPQPVSKCTRNECVCVGLNAKRYPKTGSFYVPVESKAPYC 297
            TECI+ ECCLIG P       P+P+S+C R+ CVCVGLNA+ YP  GSFYVPV+  APYC
Sbjct  271  TECIKRECCLIGTPWKSYFSTPKPISQCKRDTCVCVGLNAQSYPAKGSFYVPVDKDAPYC 330
Query  298  NNKGKKI 304
            +N+G K+
Sbjct  331  HNEGIKL 337

Sequence Alignment: 11. Allergen Name: Ves s 1.0101 Sequence ID: 3989146

 Score = 271.9 bits 1164,  Expect = 2e-74
 Identities = 168/296 56%, Positives = 217/296 73%, Gaps = 4/296 1%
Query  5    KCKLVPEQISFILSTRENRNGVFLTLDSLKKGGILNKSDLSSTQVVFLIHGFISSANNSN 64
            KC +  + ++ ++ TRENRN  F TL +L+    + K  ++   VVF+ HGF SSA   +
Sbjct  3    KCPFSDDTVAMVIVTRENRNRDFYTLQTLRNHDEFKKKAITRP-VVFITHGFTSSATVES 61
Query  65   YMDMTKALLEKNDCMVISIDWRNGACTNEFQILKFIGYPKAVENTRTVGKYIADFSKLLM 124
            ++D+  A+LE     V   DWR  AC     +L ++    AV NTR VG+YIA  +K L+
Sbjct  62   FVDLQTAILEXXXXKVTVSDWRVAACNRTTGLLYYV---TAVSNTRLVGRYIATVTKKLV 118
Query  125  QKYKVSLANIRLIGHSLGAQIAGFAGKEYQKFKLGKYPEIIGLDPAGPLFKSNDCSQRIC 184
              Y VS+A+IRLIGHSLGA+++GFAGKE QK+KL KY EIIGLDPAGP F+SNDC++R+C
Sbjct  119  TDYNVSMADIRLIGHSLGAHVSGFAGKEVQKLKLEKYSEIIGLDPAGPSFESNDCAERLC 178
Query  185  ETDAHYVQIIHTSNNLGTERTLGTVDFYMNNGYNQPGCYYSFIGETCSHTRAVQYFTECI 244
            +TDAHYVQIIHTS  +G E+++G VDFY+N G NQPGC    + + CSH+RA+ Y TECI
Sbjct  179  KTDAHYVQIIHTSKKFGIEKSIGHVDFYVNQGNNQPGCGIIPLKDVCSHSRAITYMTECI 238
Query  245  RHECCLIGVPQSKNPQPVSKCTRNECVCVGLNAKRYPKTGSFYVPVESKAPYCNNKGKKI 304
            + ECCLIG+PQSK+ + +S CTR ECVCVGL AK YP TGSFYVPVES AP+CNNKGK I
Sbjct  239  KRECCLIGIPQSKSSKSISSCTRQECVCVGLKAKSYPNTGSFYVPVESTAPFCNNKGKII 298

Sequence Alignment: 12. Allergen Name: Pol d 1.0103 Sequence ID: AAS67043

 Score = 271.2 bits 1161,  Expect = 4e-74
 Identities = 165/299 55%, Positives = 221/299 73%, Gaps = 8/299 2%
Query  1    GLLPKCKLVPEQISFILSTRENRNGVFLTLDSLKKGGILNKSDLSSTQVVFLIHGFISSA 60
            G+ P C +  + I + + +R+ RNG+ L  + LK   ++ KS +S  Q+  LIHGF+S+ 
Sbjct  15   GITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQISH-QIAILIHGFLSTG 73
Query  61   NNSNYMDMTKALLEKNDCMVISIDWRNGACTNEFQILKFIGYPKAVENTRTVGKYIADFS 120
            NN N+  M KAL+E ++ +VIS+DW+ GAC         +GY +AV NTR VGKY+ADF+
Sbjct  74   NNENFDAMAKALIEIDNFLVISVDWKKGACNAFASTNDVLGYSQAVGNTRHVGKYVADFT 133
Query  121  KLLMQKYKVSLANIRLIGHSLGAQIAGFAGKEYQKFKLGKYPEIIGLDPAGPLFKSNDCS 180
            KLL+++YKV ++NIRLIGHSLGA+ +GFAGKE Q++KLGKY EIIGLDPAGP F ++ C 
Sbjct  134  KLLVEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGLDPAGPSFLTSKCP 193
Query  181  QRICETDAHYVQIIHTSNNLGTERTLGTVDFYMNNGYNQPGCYYSFIGETCSHTRAVQYF 240
             R+CETDA YVQ IHTS  LG    +G+VDFY+N G +QPGC       +CSHT+AV+Y+
Sbjct  194  DRLCETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSE----PSCSHTKAVKYL 249
Query  241  TECIRHECCLIGVPQSK---NPQPVSKCTRNECVCVGLNAKRYPKTGSFYVPVESKAPYC 297
            TECI+ ECCLIG P       P+P+S+C R+ CVCVGLNA+ YP  GSFYVPV+  APYC
Sbjct  250  TECIKRECCLIGTPWKSYFSTPKPISQCKRDTCVCVGLNAQSYPAKGSFYVPVDKDAPYC 309
Query  298  NNKGKKI 304
            +N+G K+
Sbjct  310  HNEGIKL 316

Sequence Alignment: 13. Allergen Name: Pol d 1.0104 Sequence ID: AAS67044

 Score = 269.6 bits 1154,  Expect = 1e-73
 Identities = 165/299 55%, Positives = 220/299 73%, Gaps = 8/299 2%
Query  1    GLLPKCKLVPEQISFILSTRENRNGVFLTLDSLKKGGILNKSDLSSTQVVFLIHGFISSA 60
            G+ P C +  + I + + +R+ RNG+ L  + LK   ++ KS +S  Q+  LIHGF+S+ 
Sbjct  15   GITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQISH-QIAILIHGFLSTG 73
Query  61   NNSNYMDMTKALLEKNDCMVISIDWRNGACTNEFQILKFIGYPKAVENTRTVGKYIADFS 120
            NN N+  M KAL+E ++ +VIS+DW+ GAC         +GY +AV NTR VGKY+ADF+
Sbjct  74   NNENFDAMAKALIEIDNFLVISVDWKKGACNAFASTNDVLGYSQAVGNTRHVGKYVADFT 133
Query  121  KLLMQKYKVSLANIRLIGHSLGAQIAGFAGKEYQKFKLGKYPEIIGLDPAGPLFKSNDCS 180
            KLL+++YKV ++NIRLIGHSLGA+ +GFAGKE Q++KLGKY EIIGLDPAGP F ++ C 
Sbjct  134  KLLVEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGLDPAGPSFLTSKCP 193
Query  181  QRICETDAHYVQIIHTSNNLGTERTLGTVDFYMNNGYNQPGCYYSFIGETCSHTRAVQYF 240
             R+CETDA YVQ IHTS  LG    +G+VDFY+N G +QPGC       +CSHT+AV+Y+
Sbjct  194  DRLCETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSE----PSCSHTKAVKYL 249
Query  241  TECIRHECCLIGVPQSK---NPQPVSKCTRNECVCVGLNAKRYPKTGSFYVPVESKAPYC 297
            TECI+ ECCLIG P       P+ +S+C R+ CVCVGLNA+ YP  GSFYVPVE  APYC
Sbjct  250  TECIKRECCLIGTPWKSYFSTPKSISQCKRDTCVCVGLNAQSYPAKGSFYVPVEKDAPYC 309
Query  298  NNKGKKI 304
            +N+G K+
Sbjct  310  HNEGIKL 316

Sequence Alignment: 14. Allergen Name: Pol e 1.0101 Sequence ID: 3989146

 Score = 231.5 bits 987,  Expect = 3e-62
 Identities = 144/299 48%, Positives = 195/299 65%, Gaps = 8/299 2%
Query  1    GLLPKCKLVPEQISFILSTRENRNGVFLTLDSLKKGGILNKSDLSSTQVVFLIHGFISSA 60
            G+ P C +  + I F + +R+ R+G+ L  DSL    ++ KS   S QVVFLIHGF++S 
Sbjct  1    GMSPDCTFNEKDIVFYVYSRDKRDGIILKKDSLTNYDLFTKSITVSKQVVFLIHGFLTSX 60
Query  61   NNSNYMDMTKALLEKNDCMVISIDWRNGACTNEFQILKFIGYPKAVENTRTVGKYIADFS 120
                   ++ AL+E +D +V+S+DW+             +GY K       +G Y+ADF+
Sbjct  61   XXXXXXSLSGALIEGDDFLVMSVDWKKXXXXXXXXXXGALGYSKXASIKDALGTYVADFT 120
Query  121  KLLMQKYKVSLANIRLIGHSLGAQIAGFAGKEYQKFKLGKYPEIIGLDPAGPLFKSNDCS 180
            KL + KYKV     R IGHSLGA+ +GFAGKE QK+KLGKY EIIGLDPAGP F ++ C 
Sbjct  121  KLKLGKYKVLRXXXRGIGHSLGAHTSGFAGKEVQKLKLGKYKEIIGLDPAGPSFLTSKCP 180
Query  181  QRICETDAHYVQIIHTSNNLGTERTLGTVDFYMNNGYNQPGCYYSFIGETCSHTRAVQYF 240
             R+CE+   Y QI+HTS   G    +G+VDFY+N G +QPGC       +C   +A +Y+
Sbjct  181  DRLCESGTDYTQILHTSXXXGVYYNVGSVDFYVNYGKSQPGCNE----PSCXXXKATKYL 236
Query  241  TECIRHECCLIGVPQSK---NPQPVSKCTRNECVCVGLNAKRYPKTGSFYVPVESKAPYC 297
            TECI+ ECCLI  P  K    P+P+S+C R+ CVCVGLNAK YP  G+FY PVE+ APYC
Sbjct  237  TECIKEECCLISTPWFKYFSTPKPISQC-RDTCVCVGLNAKSYPARGAFYAPVEANAPYC 295
Query  298  NNKGKKI 304
            +N+G K+
Sbjct  296  HNEGIKL 302

Sequence Alignment: 15. Allergen Name: Sol i 1.0101 Sequence ID: AAT95008

 Score = 120.0 bits 498,  Expect = 1e-28
 Identities = 82/211 38%, Positives = 123/211 58%, Gaps = 9/211 4%
Query  45   SSTQVVFLIHGFISSANNSNYMDMTKALLEKNDCMVISIDWRNGACTNEFQILKFIGYPK 104
            +S  VVF+ HGF SSA  S + D+  A+++K     I +DW   ACT+ +  ++F  Y  
Sbjct  73   ASLPVVFITHGFTSSAQVSTFKDLANAFVQKGHTAFI-VDWSEAACTDGLPGVQFAEYNA 131
Query  105  AVENTRTVGKYIADFSKLLMQKYKVSLANIRLIGHSLGAQIAGFAGKEYQKFKLGKYPEI 164
            A  NT  +G+ +A ++  LM K K+ L NI+ +GHSLG+++ GFA K  +K+     P I
Sbjct  132  AASNTYDIGQLMAKYTVDLMNKCKIPLNNIQYVGHSLGSHVCGFAAKHVKKLINKTMPYI 191
Query  165  IGLDPAGPLFKSNDCSQRICETDAHYVQIIHTSNNLGT-ERTLGTVDFYMNNGYNQPGCY 223
            + LDPA P F SN C +RIC++DA  + +  TS  LG  E  +G +    + G +QP C 
Sbjct  192  LALDPADPSFGSNKCGERICKSDAKRIVVFKTSI-LGIGENIIGHLLIVFDGGKSQPAC- 249
Query  224  YSFIGETCSHTRAVQYFTECIRHECCLIGVP----QSKNP 259
             S+    CSH+ ++ Y T  +   C  + VP    Q  NP
Sbjct  250  -SWYDVPCSHSESIVYATGMVSGRCQHLAVPWTAQQRINP 288

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.