The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

GMSPDCTFNEKDIVFYVYSRDKRDGIILKKDSLTNYDLFTKSITVSKQVVFLIHGFLTSX
XXXXXXSLSGALIEGDDFLVMSVDWKKXXXXXXXXXXGALGYSKXASIKDALGTYVADFT
KLKLGKYKVLRXXXRGIGHSLGAHTSGFAGKEVQKLKLGKYKEIIGLDPAGPSFLTSKCP
DRLCESGTDYTQILHTSXXXGVYYNVGSVDFYVNYGKSQPGCNEPSCXXXKATKYLTECI
KEECCLISTPWFKYFSTPKPISQCRDTCVCVGLNAKSYPARGAFYAPVEANAPYCHNEGI
KL
Sequence Info Allergen Name Length Opt Bits Score E Value
3989146 Pol e 1.0101 302 1845 427.1 4e-121
Q9U6W0 Pol a 1 301 1545 358.7 1.5e-100
AAS67043 Pol d 1.0103 316 1436 333.9 4.9e-93
AAS67042 Pol d 1.0102 316 1430 332.5 1.3e-92
AAS67044 Pol d 1.0104 316 1429 332.3 1.5e-92
AAS67041 Pol d 1.0101 337 1426 331.6 2.6e-92
ABN13879 Poly p 1.0101 322 1320 307.4 4.6e-85
P53357 Dol m 1.02 303 1027 240.6 5.4e-65
C0HLL3 Vesp v 1.0101 304 987 231.5 3e-62
P49369 Ves v 1 336 912 214.4 4.8e-57
Q06478 Dol m 1.0101 317 906 213.0 1.2e-56
P51528 Ves m 1 300 899 211.5 3.3e-56
ACA00159 Vesp c 1.0101 301 892 209.9 9.9e-56
3989146 Ves s 1.0101 298 856 201.7 2.9e-53
AAT95008 Sol i 1.0101 346 354 87.2 9.7e-19
P83542 Pol g 1.0101 42 215 60.4 1.4e-11
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Pol e 1.0101 Sequence ID: 3989146

 Score = 427.1 bits 1845,  Expect = 4e-121
 Identities = 302/302 100%, Positives = 275/302 91%, Gaps = 0/302 0%
Query  1    GMSPDCTFNEKDIVFYVYSRDKRDGIILKKDSLTNYDLFTKSITVSKQVVFLIHGFLTSX 60
            GMSPDCTFNEKDIVFYVYSRDKRDGIILKKDSLTNYDLFTKSITVSKQVVFLIHGFLTSX
Sbjct  1    GMSPDCTFNEKDIVFYVYSRDKRDGIILKKDSLTNYDLFTKSITVSKQVVFLIHGFLTSX 60
Query  61   XXXXXXSLSGALIEGDDFLVMSVDWKKXXXXXXXXXXGALGYSKXASIKDALGTYVADFT 120
            XXXXXXSLSGALIEGDDFLVMSVDWKKXXXXXXXXXXGALGYSKXASIKDALGTYVADFT
Sbjct  61   XXXXXXSLSGALIEGDDFLVMSVDWKKXXXXXXXXXXGALGYSKXASIKDALGTYVADFT 120
Query  121  KLKLGKYKVLRXXXRGIGHSLGAHTSGFAGKEVQKLKLGKYKEIIGLDPAGPSFLTSKCP 180
            KLKLGKYKVLRXXXRGIGHSLGAHTSGFAGKEVQKLKLGKYKEIIGLDPAGPSFLTSKCP
Sbjct  121  KLKLGKYKVLRXXXRGIGHSLGAHTSGFAGKEVQKLKLGKYKEIIGLDPAGPSFLTSKCP 180
Query  181  DRLCESGTDYTQILHTSXXXGVYYNVGSVDFYVNYGKSQPGCNEPSCXXXKATKYLTECI 240
            DRLCESGTDYTQILHTSXXXGVYYNVGSVDFYVNYGKSQPGCNEPSCXXXKATKYLTECI
Sbjct  181  DRLCESGTDYTQILHTSXXXGVYYNVGSVDFYVNYGKSQPGCNEPSCXXXKATKYLTECI 240
Query  241  KEECCLISTPWFKYFSTPKPISQCRDTCVCVGLNAKSYPARGAFYAPVEANAPYCHNEGI 300
            KEECCLISTPWFKYFSTPKPISQCRDTCVCVGLNAKSYPARGAFYAPVEANAPYCHNEGI
Sbjct  241  KEECCLISTPWFKYFSTPKPISQCRDTCVCVGLNAKSYPARGAFYAPVEANAPYCHNEGI 300
Query  301  KL 302
            KL
Sbjct  301  KL 302

Sequence Alignment: 2. Allergen Name: Pol a 1 Sequence ID: Q9U6W0

 Score = 358.7 bits 1545,  Expect = 2e-100
 Identities = 231/300 77%, Positives = 247/300 82%, Gaps = 2/300 0%
Query  2    MSPDCTFNEKDIVFYVYSRDKRDGIILKKDSLTNYDLFTKSITVSKQVVFLIHGFLTSXX 61
            MSPDCTFNEKDIVFYVYSRDKRDGIILKK++LTNYDLFTKS T+SKQVVFLIHGFL++  
Sbjct  1    MSPDCTFNEKDIVFYVYSRDKRDGIILKKETLTNYDLFTKS-TISKQVVFLIHGFLSTGN 59
Query  62   XXXXXSLSGALIEGDDFLVMSVDWKKXXXXXXXXXXGALGYSKXASIKDALGTYVADFTK 121
                 ++S ALIE DDFLV+SVDWKK           ALGYSK       +G +VADFTK
Sbjct  60   NENFVAMSKALIEKDDFLVISVDWKKGACNAFASTKDALGYSKAVGNTRHVGKFVADFTK 119
Query  122  LKLGKYKVLRXXXRGIGHSLGAHTSGFAGKEVQKLKLGKYKEIIGLDPAGPSFLTSKCPD 181
            L + KYKVL    R IGHSLGAHTSGFAGKEVQKLKLGKYKEIIGLDPAGP F  S CPD
Sbjct  120  LLVEKYKVLISNIRLIGHSLGAHTSGFAGKEVQKLKLGKYKEIIGLDPAGPYFHRSDCPD 179
Query  182  RLCESGTDYTQILHTSXXXGVYYNVGSVDFYVNYGKSQPGCNEPSCXXXKATKYLTECIK 241
            RLC +  +Y Q++HTS   GVYYNVGSVDFYVNYGK+QPGCNEPSC   KA KYLTECIK
Sbjct  180  RLCVTDAEYVQVIHTSIILGVYYNVGSVDFYVNYGKNQPGCNEPSCSHTKAVKYLTECIK 239
Query  242  EECCLISTPWFKYFSTPKPISQCR-DTCVCVGLNAKSYPARGAFYAPVEANAPYCHNEGI 300
             ECCLI TPW KYFSTPKPISQCR DTCVCVGLNAKSYPARGAFYAPVEANAPYCHNEGI
Sbjct  240  HECCLIGTPWKKYFSTPKPISQCRGDTCVCVGLNAKSYPARGAFYAPVEANAPYCHNEGI 299
Query  301  KL 302
            KL
Sbjct  300  KL 301

Sequence Alignment: 3. Allergen Name: Pol d 1.0103 Sequence ID: AAS67043

 Score = 333.9 bits 1436,  Expect = 5e-93
 Identities = 210/301 69%, Positives = 239/301 79%, Gaps = 2/301 0%
Query  1    GMSPDCTFNEKDIVFYVYSRDKRDGIILKKDSLTNYDLFTKSITVSKQVVFLIHGFLTSX 60
            G++PDCTFNEKDI ++VYSRDKR+GIILKK+ L NYDLF KS  +S Q+  LIHGFL++ 
Sbjct  15   GITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKS-QISHQIAILIHGFLSTG 73
Query  61   XXXXXXSLSGALIEGDDFLVMSVDWKKXXXXXXXXXXGALGYSKXASIKDALGTYVADFT 120
                  +++ ALIE D+FLV+SVDWKK            LGYS+       +G YVADFT
Sbjct  74   NNENFDAMAKALIEIDNFLVISVDWKKGACNAFASTNDVLGYSQAVGNTRHVGKYVADFT 133
Query  121  KLKLGKYKVLRXXXRGIGHSLGAHTSGFAGKEVQKLKLGKYKEIIGLDPAGPSFLTSKCP 180
            KL + +YKV     R IGHSLGAHTSGFAGKEVQ+LKLGKYKEIIGLDPAGPSFLTSKCP
Sbjct  134  KLLVEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGLDPAGPSFLTSKCP 193
Query  181  DRLCESGTDYTQILHTSXXXGVYYNVGSVDFYVNYGKSQPGCNEPSCXXXKATKYLTECI 240
            DRLCE+  +Y Q +HTS   GVYYNVGSVDFYVNYGKSQPGC+EPSC   KA KYLTECI
Sbjct  194  DRLCETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSEPSCSHTKAVKYLTECI 253
Query  241  KEECCLISTPWFKYFSTPKPISQC-RDTCVCVGLNAKSYPARGAFYAPVEANAPYCHNEG 299
            K ECCLI TPW  YFSTPKPISQC RDTCVCVGLNA+SYPA+G+FY PV+ +APYCHNEG
Sbjct  254  KRECCLIGTPWKSYFSTPKPISQCKRDTCVCVGLNAQSYPAKGSFYVPVDKDAPYCHNEG 313
Query  300  IKL 302
            IKL
Sbjct  314  IKL 316

Sequence Alignment: 4. Allergen Name: Pol d 1.0102 Sequence ID: AAS67042

 Score = 332.5 bits 1430,  Expect = 1e-92
 Identities = 209/301 69%, Positives = 239/301 79%, Gaps = 2/301 0%
Query  1    GMSPDCTFNEKDIVFYVYSRDKRDGIILKKDSLTNYDLFTKSITVSKQVVFLIHGFLTSX 60
            G++PDCTFNEKDI ++VYSRDKR+GIILKK+ L NYDLF KS  +S Q+  LIHGFL++ 
Sbjct  15   GITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKS-QISHQIAILIHGFLSTG 73
Query  61   XXXXXXSLSGALIEGDDFLVMSVDWKKXXXXXXXXXXGALGYSKXASIKDALGTYVADFT 120
                  +++ ALIE D+FLV+SVDWKK            LGYS+       +G YVADFT
Sbjct  74   NNENFDAMAKALIEIDNFLVISVDWKKGACNAFASTNDVLGYSQAVGNTRHVGKYVADFT 133
Query  121  KLKLGKYKVLRXXXRGIGHSLGAHTSGFAGKEVQKLKLGKYKEIIGLDPAGPSFLTSKCP 180
            KL + +YKV     R IGHSLGAHTSGFAGKEVQ+LKLGKYKEIIGLDPAGPSFLT+KCP
Sbjct  134  KLLVEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGLDPAGPSFLTNKCP 193
Query  181  DRLCESGTDYTQILHTSXXXGVYYNVGSVDFYVNYGKSQPGCNEPSCXXXKATKYLTECI 240
            +RLCE+  +Y Q +HTS   GVYYNVGSVDFYVNYGKSQPGC+EPSC   KA KYLTECI
Sbjct  194  NRLCETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSEPSCSHTKAVKYLTECI 253
Query  241  KEECCLISTPWFKYFSTPKPISQC-RDTCVCVGLNAKSYPARGAFYAPVEANAPYCHNEG 299
            K ECCLI TPW  YFSTPKPISQC RDTCVCVGLNA+SYPA+G+FY PVE +APYCHNEG
Sbjct  254  KRECCLIGTPWKSYFSTPKPISQCKRDTCVCVGLNAQSYPAKGSFYVPVEKDAPYCHNEG 313
Query  300  IKL 302
            IKL
Sbjct  314  IKL 316

Sequence Alignment: 5. Allergen Name: Pol d 1.0104 Sequence ID: AAS67044

 Score = 332.3 bits 1429,  Expect = 1e-92
 Identities = 210/301 69%, Positives = 238/301 79%, Gaps = 2/301 0%
Query  1    GMSPDCTFNEKDIVFYVYSRDKRDGIILKKDSLTNYDLFTKSITVSKQVVFLIHGFLTSX 60
            G++PDCTFNEKDI ++VYSRDKR+GIILKK+ L NYDLF KS  +S Q+  LIHGFL++ 
Sbjct  15   GITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKS-QISHQIAILIHGFLSTG 73
Query  61   XXXXXXSLSGALIEGDDFLVMSVDWKKXXXXXXXXXXGALGYSKXASIKDALGTYVADFT 120
                  +++ ALIE D+FLV+SVDWKK            LGYS+       +G YVADFT
Sbjct  74   NNENFDAMAKALIEIDNFLVISVDWKKGACNAFASTNDVLGYSQAVGNTRHVGKYVADFT 133
Query  121  KLKLGKYKVLRXXXRGIGHSLGAHTSGFAGKEVQKLKLGKYKEIIGLDPAGPSFLTSKCP 180
            KL + +YKV     R IGHSLGAHTSGFAGKEVQ+LKLGKYKEIIGLDPAGPSFLTSKCP
Sbjct  134  KLLVEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGLDPAGPSFLTSKCP 193
Query  181  DRLCESGTDYTQILHTSXXXGVYYNVGSVDFYVNYGKSQPGCNEPSCXXXKATKYLTECI 240
            DRLCE+  +Y Q +HTS   GVYYNVGSVDFYVNYGKSQPGC+EPSC   KA KYLTECI
Sbjct  194  DRLCETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSEPSCSHTKAVKYLTECI 253
Query  241  KEECCLISTPWFKYFSTPKPISQC-RDTCVCVGLNAKSYPARGAFYAPVEANAPYCHNEG 299
            K ECCLI TPW  YFSTPK ISQC RDTCVCVGLNA+SYPA+G+FY PVE +APYCHNEG
Sbjct  254  KRECCLIGTPWKSYFSTPKSISQCKRDTCVCVGLNAQSYPAKGSFYVPVEKDAPYCHNEG 313
Query  300  IKL 302
            IKL
Sbjct  314  IKL 316

Sequence Alignment: 6. Allergen Name: Pol d 1.0101 Sequence ID: AAS67041

 Score = 331.6 bits 1426,  Expect = 3e-92
 Identities = 208/301 69%, Positives = 239/301 79%, Gaps = 2/301 0%
Query  1    GMSPDCTFNEKDIVFYVYSRDKRDGIILKKDSLTNYDLFTKSITVSKQVVFLIHGFLTSX 60
            G++PDCTFNEKDI ++VYSRDKR+GIILKK+ L NYDLF KS  +S Q+  LIHGFL++ 
Sbjct  36   GITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKS-QISHQIAILIHGFLSTG 94
Query  61   XXXXXXSLSGALIEGDDFLVMSVDWKKXXXXXXXXXXGALGYSKXASIKDALGTYVADFT 120
                  +++ ALIE D+FLV+SVDWKK            LGYS+       +G YVADFT
Sbjct  95   NNENFDAMAKALIEIDNFLVISVDWKKGACNAFASTNDVLGYSQAVGNTRHVGKYVADFT 154
Query  121  KLKLGKYKVLRXXXRGIGHSLGAHTSGFAGKEVQKLKLGKYKEIIGLDPAGPSFLTSKCP 180
            KL + +YKV     R IGHSLGAHTSGFAGKEVQ+LKLGKYKEIIGLDPAGPSFLT+KCP
Sbjct  155  KLLVEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGLDPAGPSFLTNKCP 214
Query  181  DRLCESGTDYTQILHTSXXXGVYYNVGSVDFYVNYGKSQPGCNEPSCXXXKATKYLTECI 240
            +RLCE+  +Y Q +HTS   GVYYNVGSVDFYVNYGKSQPGC+EPSC   KA KYLTECI
Sbjct  215  NRLCETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSEPSCSHTKAVKYLTECI 274
Query  241  KEECCLISTPWFKYFSTPKPISQC-RDTCVCVGLNAKSYPARGAFYAPVEANAPYCHNEG 299
            K ECCLI TPW  YFSTPKPISQC RDTCVCVGLNA+SYPA+G+FY PV+ +APYCHNEG
Sbjct  275  KRECCLIGTPWKSYFSTPKPISQCKRDTCVCVGLNAQSYPAKGSFYVPVDKDAPYCHNEG 334
Query  300  IKL 302
            IKL
Sbjct  335  IKL 337

Sequence Alignment: 7. Allergen Name: Poly p 1.0101 Sequence ID: ABN13879

 Score = 307.4 bits 1320,  Expect = 5e-85
 Identities = 193/301 64%, Positives = 228/301 75%, Gaps = 5/301 1%
Query  1    GMSPDCTFNEKDIVFYVYSRDKRDGIILKKDSLTNYDLFTKSITVSKQVVFLIHGFLTSX 60
            G+ P+C FNE DI+F+VY+R +RDGI+L +++L NYDLF KS T+S+QVVF+ HGFL++ 
Sbjct  18   GLIPECPFNEYDILFFVYTRQQRDGIVLTEETLQNYDLFKKS-TISRQVVFIDHGFLSNG 76
Query  61   XXXXXXSLSGALIEGDDFLVMSVDWKKXXXXXXXXXXGALGYSKXASIKDALGTYVADFT 120
                  +++ ALIE D+FLV+SVDWKK            LGYS        +G YVADFT
Sbjct  77   NNENFIAMAKALIEKDNFLVISVDWKKGACNAFASTLDYLGYSTAVGNTRHVGKYVADFT 136
Query  121  KLKLGKYKVLRXXXRGIGHSLGAHTSGFAGKEVQKLKLGKYKEIIGLDPAGPSFLTSKCP 180
            KL + +YKV     R IGHSLGAHTSGFAGKEVQ+LKL KY  I GLDPAGPSF ++ CP
Sbjct  137  KLLVEQYKVSMSNIRLIGHSLGAHTSGFAGKEVQELKLNKYSNIDGLDPAGPSFDSNDCP 196
Query  181  DRLCESGTDYTQILHTSXXXGVYYNVGSVDFYVNYGKSQPGCNE---PSCXXXKATKYLT 237
            +RLCE+  +Y QI+HTS   GVY  +G+VDFY+NYG  QPGC     PSC   KA KYLT
Sbjct  197  ERLCETDAEYVQIIHTSNILGVYSKIGTVDFYMNYGSHQPGCGRFFSPSCSHTKAVKYLT 256
Query  238  ECIKEECCLISTPWFKYFSTPKPISQC-RDTCVCVGLNAKSYPARGAFYAPVEANAPYCH 296
            ECIK ECCLI TPW KYFSTPKPISQC +DTCVCVGLNAKSYPARG+FY PVEA APYCH
Sbjct  257  ECIKHECCLIGTPWKKYFSTPKPISQCTKDTCVCVGLNAKSYPARGSFYVPVEATAPYCH 316
Query  297  NEGIKL 302
            NEGIKL
Sbjct  317  NEGIKL 322

Sequence Alignment: 8. Allergen Name: Dol m 1.02 Sequence ID: P53357

 Score = 240.6 bits 1027,  Expect = 5e-65
 Identities = 147/296 49%, Positives = 196/296 66%, Gaps = 7/296 2%
Query  1    GMSPDCTFNEKDIVFYVYSRDKRDGIILKKDSLTNYDLFTKSITVSKQVVFLIHGFLTSX 60
            G+ P+C +  ++I F + +R+ RDG+ L    L N  +F  S   SK+V FLIHGF++S 
Sbjct  1    GILPECKLVPEEISFVLSTRENRDGVYLTLQKLKNGKMFKNSDLSSKKVPFLIHGFISSA 60
Query  61   XXXXXXSLSGALIEGDDFLVMSVDWKKXXXXXXXXXXGALGYSKXASIKDALGTYVADFT 120
                   ++ AL++ DD +V+S+DW+             +GY K      A+G Y+ADF+
Sbjct  61   TNKNYADMTRALLDKDDIMVISIDWRDGACSNEFALLKFIGYPKAVENTRAVGKYIADFS 120
Query  121  KLKLGKYKVLRXXXRGIGHSLGAHTSGFAGKEVQKLKLGKYKEIIGLDPAGPSFLTSKCP 180
            K+ + KYKVL    R IGHSLGA+ +GFAGKE Q++KLGKY EIIGLDPAGPSF    CP
Sbjct  121  KILIQKYKVLLENIRLIGHSLGAQIAGFAGKEFQRFKLGKYPEIIGLDPAGPSFKKKDCP 180
Query  181  DRLCESGTDYTQILHTSXXXGVYYNVGSVDFYVNYGKSQPGCNE---PSCXXXKATKYLT 237
            +R+CE+   Y QILHTS   G    +G+VDFY+N G +QPGC      +C   +A KYLT
Sbjct  181  ERICETDAHYVQILHTSSNLGTERTLGTVDFYINDGSNQPGCTYIIGETCSHTRAVKYLT 240
Query  238  ECIKEECCLISTPWFKYFSTPKPISQC-RDTCVCVGLNAKSYPARGAFYAPVEANAPYCH 296
            ECI+ ECCLI  P  K    P+P+S+C R+ CVCVGLNAK YP +G+FY PVEA AP+C+
Sbjct  241  ECIRRECCLIGVPQSK---NPQPVSKCTRNECVCVGLNAKEYPKKGSFYVPVEAKAPFCN 297
Query  297  NEG 299
            N G
Sbjct  298  NNG 300

Sequence Alignment: 9. Allergen Name: Vesp v 1.0101 Sequence ID: C0HLL3

 Score = 231.5 bits 987,  Expect = 3e-62
 Identities = 144/299 48%, Positives = 195/299 65%, Gaps = 8/299 2%
Query  1    GMSPDCTFNEKDIVFYVYSRDKRDGIILKKDSLTNYDLFTKSITVSKQVVFLIHGFLTSX 60
            G+ P C +  + I F + +R+ R+G+ L  DSL    ++ KS   S QVVFLIHGF++S 
Sbjct  1    GLLPKCKLVPEQISFILSTRENRNGVFLTLDSLKKGGILNKSDLSSTQVVFLIHGFISSA 60
Query  61   XXXXXXSLSGALIEGDDFLVMSVDWKKXXXXXXXXXXGALGYSKXASIKDALGTYVADFT 120
                   ++ AL+E +D +V+S+DW+             +GY K       +G Y+ADF+
Sbjct  61   NNSNYMDMTKALLEKNDCMVISIDWRNGACTNEFQILKFIGYPKAVENTRTVGKYIADFS 120
Query  121  KLKLGKYKVLRXXXRGIGHSLGAHTSGFAGKEVQKLKLGKYKEIIGLDPAGPSFLTSKCP 180
            KL + KYKV     R IGHSLGA+ +GFAGKE QK+KLGKY EIIGLDPAGP F ++ C 
Sbjct  121  KLLMQKYKVSLANIRLIGHSLGAQIAGFAGKEYQKFKLGKYPEIIGLDPAGPLFKSNDCS 180
Query  181  DRLCESGTDYTQILHTSXXXGVYYNVGSVDFYVNYGKSQPGCNEP----SCXXXKATKYL 236
             R+CE+   Y QI+HTS   G    +G+VDFY+N G +QPGC       +C   +A +Y+
Sbjct  181  QRICETDAHYVQIIHTSNNLGTERTLGTVDFYMNNGYNQPGCYYSFIGETCSHTRAVQYF 240
Query  237  TECIKEECCLISTPWFKYFSTPKPISQC-RDTCVCVGLNAKSYPARGAFYAPVEANAPYC 295
            TECI+ ECCLI  P  K    P+P+S+C R+ CVCVGLNAK YP  G+FY PVE+ APYC
Sbjct  241  TECIRHECCLIGVPQSK---NPQPVSKCTRNECVCVGLNAKRYPKTGSFYVPVESKAPYC 297
Query  296  HNEGIKL 302
            +N+G K+
Sbjct  298  NNKGKKI 304

Sequence Alignment: 10. Allergen Name: Ves v 1 Sequence ID: P49369

 Score = 214.4 bits 912,  Expect = 5e-57
 Identities = 134/292 45%, Positives = 185/292 63%, Gaps = 8/292 2%
Query  4    PDCTFNEKDIVFYVYSRDKRDGIILKKDSLTNYDLFTKSITVSKQVVFLIHGFLTSXXXX 63
            P C FN   +   + +R+ R+  +    +L N+  F K  T+++ VVF+ HGF +S    
Sbjct  38   PKCPFNSDTVSIIIETRENRNRDLYTLQTLQNHPEFKKK-TITRPVVFITHGFTSSASET 96
Query  64   XXXSLSGALIEGDDFLVMSVDWKKXXXXXXXXXXGALGYSKXASIKDALGTYVADFTKLK 123
               +L+ AL++ D+++V+S+DW+             L Y   A     +G Y+A  T+  
Sbjct  97   NFINLAKALVDKDNYMVISIDWQTAACTNEAAGLKYLYYPTAARNTRLVGQYIATITQKL 156
Query  124  LGKYKVLRXXXRGIGHSLGAHTSGFAGKEVQKLKLGKYKEIIGLDPAGPSFLTSKCPDRL 183
            +  YK+     R IGHSLGAH SGFAGK+VQ+LKLGKY EIIGLDPA PSF ++ C +RL
Sbjct  157  VKHYKISMANIRLIGHSLGAHASGFAGKKVQELKLGKYSEIIGLDPARPSFDSNHCSERL 216
Query  184  CESGTDYTQILHTSXXXGVYYNVGSVDFYVNYGKSQPGCNE---PSCXXXKATKYLTECI 240
            CE+  +Y QI+HTS   G    +G+VDFY+N GK+QPGC       C   +A  Y+ ECI
Sbjct  217  CETDAEYVQIIHTSNYLGTEKTLGTVDFYMNNGKNQPGCGRFFSEVCSHSRAVIYMAECI 276
Query  241  KEECCLISTPWFKYFSTPKPISQC-RDTCVCVGLNAKSYPARGAFYAPVEANAPYCHNEG 299
            K ECCLI  P  K   + +PIS C +  CVCVGLNAK YP+RG+FY PVE+ AP+C+N+G
Sbjct  277  KHECCLIGIPKSK---SSQPISSCTKQECVCVGLNAKKYPSRGSFYVPVESTAPFCNNKG 333

Sequence Alignment: 11. Allergen Name: Dol m 1.0101 Sequence ID: Q06478

 Score = 213.0 bits 906,  Expect = 1e-56
 Identities = 133/290 45%, Positives = 178/290 61%, Gaps = 8/290 2%
Query  6    CTFNEKDIVFYVYSRDKRDGIILKKDSLTNYDLFTKSITVSKQVVFLIHGFLTSXXXXXX 65
            C F+   +     +R+ R       D++  ++ F KSI + + VVF+ HGF +S      
Sbjct  21   CPFSNDTVKMIFLTRENRKHDFYTLDTMNRHNEFKKSI-IKRPVVFITHGFTSSATEKNF 79
Query  66   XSLSGALIEGDDFLVMSVDWKKXXXXXXXXXXGALGYSKXASIKDALGTYVADFTKLKLG 125
             ++S AL+   DFL++ VDW+             + Y         +G ++A   K  + 
Sbjct  80   VAMSEALMHTGDFLIIMVDWRMAACTDEYPGLKYMFYKAAVGNTRLVGNFIAMIAKKLVE 139
Query  126  KYKVLRXXXRGIGHSLGAHTSGFAGKEVQKLKLGKYKEIIGLDPAGPSFLTSKCPDRLCE 185
            +YKV     R +GHSLGAH SGFAGK VQ+LKLGK+ EIIGLDPAGPSF  + C +R+CE
Sbjct  140  QYKVPMTNIRLVGHSLGAHISGFAGKRVQELKLGKFSEIIGLDPAGPSFKKNDCSERICE 199
Query  186  SGTDYTQILHTSXXXGVYYNVGSVDFYVNYGKSQPGCNE---PSCXXXKATKYLTECIKE 242
            +   Y QILHTS   G    +G+VDFY+N G +QPGC      +C   +A KY+TECI+ 
Sbjct  200  TDAHYVQILHTSSNLGTERTLGTVDFYINNGSNQPGCRYIIGETCSHTRAVKYFTECIRR 259
Query  243  ECCLISTPWFKYFSTPKPISQC-RDTCVCVGLNAKSYPARGAFYAPVEANAPYCHNEG 299
            ECCLI  P  K    P+P+S+C R+ CVCVGLNAK YP RG+FY PVEA APYC+N G
Sbjct  260  ECCLIGVPQSK---NPQPVSKCTRNECVCVGLNAKKYPKRGSFYVPVEAEAPYCNNNG 314

Sequence Alignment: 12. Allergen Name: Ves m 1 Sequence ID: P51528

 Score = 211.5 bits 899,  Expect = 3e-56
 Identities = 133/292 45%, Positives = 184/292 63%, Gaps = 8/292 2%
Query  4    PDCTFNEKDIVFYVYSRDKRDGIILKKDSLTNYDLFTKSITVSKQVVFLIHGFLTSXXXX 63
            P C FN   +   + +R+ R+  +    +L N+  F K  T+++ VVF+ HGF +S    
Sbjct  2    PKCPFNSDTVSIIIETRENRNRDLYTLQTLQNHPEFKKK-TITRPVVFITHGFTSSASEK 60
Query  64   XXXSLSGALIEGDDFLVMSVDWKKXXXXXXXXXXGALGYSKXASIKDALGTYVADFTKLK 123
               +L+ AL++ D+++V+S+DW+               Y   AS    +G Y+A  T+  
Sbjct  61   NFINLAKALVDKDNYMVISIDWQTAACTNEYPGLKYAYYPTAASNTRLVGQYIATITQKL 120
Query  124  LGKYKVLRXXXRGIGHSLGAHTSGFAGKEVQKLKLGKYKEIIGLDPAGPSFLTSKCPDRL 183
            +  YK+     R IGHSLGAH SGFAGK VQ+LKLGKY EIIGLDPA PSF ++ C +RL
Sbjct  121  VKDYKISMANIRLIGHSLGAHVSGFAGKRVQELKLGKYSEIIGLDPARPSFDSNHCSERL 180
Query  184  CESGTDYTQILHTSXXXGVYYNVGSVDFYVNYGKSQPGCNE---PSCXXXKATKYLTECI 240
            CE+  +Y QI+HTS   G    +G+VDFY+N GK+ PGC       C   +A  Y+ ECI
Sbjct  181  CETDAEYVQIIHTSNYLGTEKILGTVDFYMNNGKNNPGCGRFFSEVCSHTRAVIYMAECI 240
Query  241  KEECCLISTPWFKYFSTPKPISQC-RDTCVCVGLNAKSYPARGAFYAPVEANAPYCHNEG 299
            K ECCLI  P  K   + +PIS+C +  CVCVGLNAK YP+RG+FY PVE+ AP+C+N+G
Sbjct  241  KHECCLIGIPRSK---SSQPISRCTKQECVCVGLNAKKYPSRGSFYVPVESTAPFCNNKG 297

Sequence Alignment: 13. Allergen Name: Vesp c 1.0101 Sequence ID: ACA00159

 Score = 209.9 bits 892,  Expect = 1e-55
 Identities = 133/290 45%, Positives = 184/290 63%, Gaps = 9/290 3%
Query  6    CTFNEKDIVFYVYSRDKRDGIILKKDSLTNYDLFTKSITVSKQVVFLIHGFLTSXXXXXX 65
            C +++  +   V +R+ +       D++ N++ F  +IT+ K  VF+ HGF +S      
Sbjct  4    CPYSDDTVKMIVLTRENKKYDFYTLDTIKNHNEFKDTITL-KPHVFITHGFTSSATAENF 62
Query  66   XSLSGALIEGDDFLVMSVDWKKXXXXXXXXXXGALGYSKXASIKDALGTYVADFTKLKLG 125
              ++ AL++  ++LV+  DW+               Y   AS    +G Y+A  TK+ + 
Sbjct  63   VVMAKALLDKGNYLVILTDWRMAACTNEIAGLKLAYYPYAASNTRLVGNYIATVTKMLVQ 122
Query  126  KYKVLRXXXRGIGHSLGAHTSGFAGKEVQKLKLGKYKEIIGLDPAGPSFLTSKCPDRLCE 185
            KY V     R IGHSLGAH SGFAGK+VQ+L LGKY EIIGLDPAGPSF ++ C  R+CE
Sbjct  123  KYNVPMANIRLIGHSLGAHISGFAGKKVQELGLGKYPEIIGLDPAGPSFKSNDCSQRICE 182
Query  186  SGTDYTQILHTSXXXGVYYNVGSVDFYVNYGKSQPGCNEP----SCXXXKATKYLTECIK 241
            +  +Y QI+HTS   G    +G+VDFY+N G +QPGC  P    +C   +A KY+TECIK
Sbjct  183  TDANYVQIIHTSNRLGTERTLGTVDFYMNNGYNQPGCGLPIIGETCSHTRAVKYFTECIK 242
Query  242  EECCLISTPWFKYFSTPKPISQC-RDTCVCVGLNAKSYPARGAFYAPVEANAPYCHNEG 299
             ECCLI  P  K    P+P+S+C R+ CVCVGLNAK+YP  G+FY PVE+ APYC+N+G
Sbjct  243  HECCLIGVPKSK---NPQPVSKCTRNECVCVGLNAKTYPKTGSFYVPVESKAPYCNNKG 298

Sequence Alignment: 14. Allergen Name: Ves s 1.0101 Sequence ID: 3989146

 Score = 201.7 bits 856,  Expect = 3e-53
 Identities = 134/287 46%, Positives = 173/287 60%, Gaps = 12/287 4%
Query  6    CTFNEKDIVFYVYSRDKRDGIILKKDSLTNYDLFTKSITVSKQVVFLIHGFLTSXXXXXX 65
            C F++  +   + +R+ R+       +L N+D F K   +++ VVF+ HGF +S      
Sbjct  4    CPFSDDTVAMVIVTRENRNRDFYTLQTLRNHDEFKKK-AITRPVVFITHGFTSSATVESF 62
Query  66   XSLSGALIEGDDFLVMSVDWKKXXXXXXXXXXGALGYSKXASIKDALGTYVADFTKLKLG 125
              L  A++E     V   DW+           G L Y    S    +G Y+A  TK  + 
Sbjct  63   VDLQTAILEXXXXKVTVSDWR---VAACNRTTGLLYYVTAVSNTRLVGRYIATVTKKLVT 119
Query  126  KYKVLRXXXRGIGHSLGAHTSGFAGKEVQKLKLGKYKEIIGLDPAGPSFLTSKCPDRLCE 185
             Y V     R IGHSLGAH SGFAGKEVQKLKL KY EIIGLDPAGPSF ++ C +RLC+
Sbjct  120  DYNVSMADIRLIGHSLGAHVSGFAGKEVQKLKLEKYSEIIGLDPAGPSFESNDCAERLCK 179
Query  186  SGTDYTQILHTSXXXGVYYNVGSVDFYVNYGKSQPGCN----EPSCXXXKATKYLTECIK 241
            +   Y QI+HTS   G+  ++G VDFYVN G +QPGC     +  C   +A  Y+TECIK
Sbjct  180  TDAHYVQIIHTSKKFGIEKSIGHVDFYVNQGNNQPGCGIIPLKDVCSHSRAITYMTECIK 239
Query  242  EECCLISTPWFKYFSTPKPISQC-RDTCVCVGLNAKSYPARGAFYAPVEANAPYCHNEG 299
             ECCLI  P  K   + K IS C R  CVCVGL AKSYP  G+FY PVE+ AP+C+N+G
Sbjct  240  RECCLIGIPQSK---SSKSISSCTRQECVCVGLKAKSYPNTGSFYVPVESTAPFCNNKG 295

Sequence Alignment: 15. Allergen Name: Sol i 1.0101 Sequence ID: AAT95008

 Score = 87.2 bits 354,  Expect = 1e-18
 Identities = 84/284 29%, Positives = 135/284 47%, Gaps = 27/284 9%
Query  2    MSPDCTFNEKDIVFYVYSRDKRDGIILKKDSLTNYDLFTKSITVSKQVVFLIHGFLTSXX 61
            +   C +     +  VY  + R    ++  +L N     + I  S  VVF+ HGF +S  
Sbjct  36   LKQSCVYGNSSYI-NVYLYNSR----FQGKNLGNQQS-CQDINASLPVVFITHGFTSSAQ 89
Query  62   XXXXXSLSGALIE-GDDFLVMSVDWKKXXXXXXXXXXGALGYSKXASIKDALGTYVADFT 120
                  L+ A+++ G   ++  VDW +              Y+  AS    +G  +A +T
Sbjct  90   VSTFKDLANAFVQKGHTAFI--VDWSEAACTDGLPGVQFAEYNAAASNTYDIGQLMAKYT 147
Query  121  KLKLGKYKVLRXXXRGIGHSLGAHTSGFAGKEVQKLKLGKYKEIIGLDPAGPSFLTSKCP 180
               + K K+     + +GHSLG+H  GFA K V+KL       I+ LDPA PSF ++KC 
Sbjct  148  VDLMNKCKIPLNNIQYVGHSLGSHVCGFAAKHVKKLINKTMPYILALDPADPSFGSNKCG 207
Query  181  DRLCESGTDYTQILHTSXXXGVYYNV-GSVDFYVNYGKSQPGCN--EPSCXXXKATKYLT 237
            +R+C+S      ++ TS   G+  N+ G +    + GKSQP C+  +  C   ++  Y T
Sbjct  208  ERICKSDAKRIVVFKTSIL-GIGENIIGHLLIVFDGGKSQPACSWYDVPCSHSESIVYAT 266
Query  238  ECIKEECCLISTPW-------------FKYFSTPKPISQCRDTCVCVGLNAKSYPARGAF 284
              +   C  ++ PW             ++ F++  P     DT  CV LN   +     F
Sbjct  267  GMVSGRCQHLAVPWTAQQRINPIQWKFWRVFTSNIPAYPTSDTTNCVVLNTNVFKNDNTF 326
Query  285  YAPVEANAPYC 295
                 A  P C
Sbjct  327  EGEYHA-FPDC 336

Sequence Alignment: 16. Allergen Name: Pol g 1.0101 Sequence ID: P83542

 Score = 60.4 bits 215,  Expect = 1e-11
 Identities = 31/42 73%, Positives = 38/42 90%, Gaps = 0/42 0%
Query  1    GMSPDCTFNEKDIVFYVYSRDKRDGIILKKDSLTNYDLFTKS 42
            G++PDCTFNEKDI ++VYSRDKR+GIILKK+ L NYDLF +S
Sbjct  1    GITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFKES 42

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.