The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

GTRLLLIIVSVLAATRRMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVGHG
APGGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRR
GDLERAAASLPAFCNVDIPNGTGGVCYWLGYTPRTPRTGH
Sequence Info Allergen Name Length Opt Bits Score E Value
BAA07711 Ory s TAI 160 1155 153.9 2e-39
BAA02000 Ory s TAI 166 1101 147.3 2e-37
BAA01998 Ory s TAI 165 1049 140.9 1.7e-35
BAA07710 Ory s TAI 166 1025 137.9 1.3e-34
BAA01997 Ory s TAI 162 865 118.3 1.1e-28
BAA07713 Ory s TAI 160 832 114.2 1.7e-27
BAA01996 Ory s TAI 157 817 112.4 6.1e-27
BAA07712 Ory s TAI 157 783 108.2 1.1e-25
BAA07773 Ory s TAI 109 720 100.3 1.8e-23
BAA07772 Ory s TAI 111 695 97.2 1.6e-22
BAA07774 Ory s TAI 113 691 96.7 2.2e-22
AAB99797 Ory s TAI 157 574 82.5 5.9e-18
P16968 Hor v 1 146 510 74.6 1.3e-15
P16968 Hor v 15.0101 146 510 74.6 1.3e-15
BAA01999 Ory s TAI 95 412 62.4 4e-12
CAA08836 Hor v 1 152 372 57.7 1.7e-10
CBA13560 Tri a 15.0101 121 367 57.0 2.2e-10
P01083 Tri a TAI 123 365 56.8 2.6e-10
CAI84642 Tri a 28.0101 119 284 46.8 2.5e-07
P01085 Tri a TAI 124 284 46.8 2.6e-07
P01084 Tri a TAI 124 270 45.1 8.6e-07
CAA39099 Tri a TAI 145 185 34.7 0.0013
P01086 Hor v 1 144 184 34.6 0.0014
CAA46705 Hor v 1 148 184 34.6 0.0015
CAA35188 Hor v 1 144 183 34.5 0.0016
CBA13559 Tri a 29.0201 120 179 33.9 0.0019
CAZ76052 Tri a 29.0101 120 179 33.9 0.0019
CAA31794 Hor v 1 147 174 33.4 0.0034
CAA34709 Tri a TAI 143 169 32.8 0.0051
CAA35598 Tri a TAI 145 168 32.6 0.0056
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ory s TAI Sequence ID: BAA07711

 Score = 153.9 bits 1155,  Expect = 2e-39
 Identities = 160/160 100%, Positives = 160/160 100%, Gaps = 0/160 0%
Query  1    GTRLLLIIVSVLAATRRMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVGHG 60
            GTRLLLIIVSVLAATRRMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVGHG
Sbjct  1    GTRLLLIIVSVLAATRRMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVGHG 60
Query  61   APGGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRR 120
            APGGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRR
Sbjct  61   APGGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRR 120
Query  121  GDLERAAASLPAFCNVDIPNGTGGVCYWLGYTPRTPRTGH 160
            GDLERAAASLPAFCNVDIPNGTGGVCYWLGYTPRTPRTGH
Sbjct  121  GDLERAAASLPAFCNVDIPNGTGGVCYWLGYTPRTPRTGH 160

Sequence Alignment: 2. Allergen Name: Ory s TAI Sequence ID: BAA02000

 Score = 147.3 bits 1101,  Expect = 2e-37
 Identities = 154/156 98%, Positives = 154/156 98%, Gaps = 1/156 0%
Query  4    LLLIIVSVLAATRRMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVGHGAPG 63
            LLLIIVSVLAAT  MADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVGHGAPG
Sbjct  11   LLLIIVSVLAATATMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVGHGAPG 70
Query  64   GAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDL 123
            GAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDL
Sbjct  71   GAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDL 130
Query  124  ERAAASLPAFCNVDIPNGTGGVCYWLGYTPRTPRTGH 160
            ERAAASLPAFCNVDIPNGTGGVCYWLGY PRTPRTGH
Sbjct  131  ERAAASLPAFCNVDIPNGTGGVCYWLGY-PRTPRTGH 166

Sequence Alignment: 3. Allergen Name: Ory s TAI Sequence ID: BAA01998

 Score = 140.9 bits 1049,  Expect = 2e-35
 Identities = 149/155 96%, Positives = 151/155 97%, Gaps = 2/155 1%
Query  4    LLLIIVSVLAATRRMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVGHGAPG 63
            LLLIIVSVLAAT RMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVG  +PG
Sbjct  11   LLLIIVSVLAATTRMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVGTRSPG 70
Query  64   GAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDL 123
             AVDEQL QDCCR+LAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDL
Sbjct  71   -AVDEQLAQDCCRELAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDL 129
Query  124  ERAAASLPAFCNVDIPNGTGGVCYWLGYTPRTPRTGH 160
            ERAAASLPAFCNVDIPNGTGGVCYWLGY PRTPRTGH
Sbjct  130  ERAAASLPAFCNVDIPNGTGGVCYWLGY-PRTPRTGH 165

Sequence Alignment: 4. Allergen Name: Ory s TAI Sequence ID: BAA07710

 Score = 137.9 bits 1025,  Expect = 1e-34
 Identities = 145/156 92%, Positives = 146/156 93%, Gaps = 1/156 0%
Query  4    LLLIIVSVLAATRRMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVGHGAPG 63
            LLLIIVSVLAAT  MADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCV    P 
Sbjct  11   LLLIIVSVLAATGPMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVATAHPA 70
Query  64   GAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDL 123
               +EQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDL
Sbjct  71   ARGNEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDL 130
Query  124  ERAAASLPAFCNVDIPNGTGGVCYWLGYTPRTPRTGH 160
            ERAAASLPAFCNVDIPNGTGGVCYWLGY PRTPRTGH
Sbjct  131  ERAAASLPAFCNVDIPNGTGGVCYWLGY-PRTPRTGH 166

Sequence Alignment: 5. Allergen Name: Ory s TAI Sequence ID: BAA01997

 Score = 118.3 bits 865,  Expect = 1e-28
 Identities = 121/151 80%, Positives = 135/151 89%, Gaps = 7/151 4%
Query  4    LLLIIVSVLAATR-RMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVGHGAP 62
            LLL+++SVLAA    MADHH+   VYS GE+C+PG+ YP YSLP+CR +V+RQCVG GA 
Sbjct  11   LLLVVLSVLAAAMATMADHHQ---VYSPGEQCRPGISYPTYSLPQCRTLVRRQCVGRGA- 66
Query  63   GGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGD 122
              A DEQ+ QDCCRQLAAVDD WCRC AL+HM+ GIYRELGAT+ GHPMAEVFPGCRRGD
Sbjct  67   -SAADEQVWQDCCRQLAAVDDGWCRCGALDHMLSGIYRELGATEAGHPMAEVFPGCRRGD 125
Query  123  LERAAASLPAFCNVDIPNGTGGVCYWLGYTPRTPRTGH 160
            LERAAASLPAFCNVDIPNG GGVCYWLGY PRTPRTGH
Sbjct  126  LERAAASLPAFCNVDIPNGPGGVCYWLGY-PRTPRTGH 162

Sequence Alignment: 6. Allergen Name: Ory s TAI Sequence ID: BAA07713

 Score = 114.2 bits 832,  Expect = 2e-27
 Identities = 116/147 78%, Positives = 128/147 87%, Gaps = 3/147 2%
Query  4    LLLIIVSVLAATRRMAD-HHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVGHGAP 62
            LLL +VSVLAAT  MA+ HH+DQVVY+    CQPGMGYPMY LPRCRA+VKRQCVG G  
Sbjct  11   LLLAVVSVLAATATMAEYHHQDQVVYTPAPLCQPGMGYPMYPLPRCRALVKRQCVGRGTA 70
Query  63   GGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGD 122
              A  EQ+R+DCCRQLAAVDDSWCRC A++HM+GGIYRELGA DVGHPM+EVF GCRRGD
Sbjct  71   AAA--EQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMSEVFRGCRRGD 128
Query  123  LERAAASLPAFCNVDIPNGTGGVCYWLGYT 152
            LERAAASLPAFCNVDIPNG GGVCYWL  +
Sbjct  129  LERAAASLPAFCNVDIPNGGGGVCYWLARS 158

Sequence Alignment: 7. Allergen Name: Ory s TAI Sequence ID: BAA01996

 Score = 112.4 bits 817,  Expect = 6e-27
 Identities = 116/144 80%, Positives = 128/144 88%, Gaps = 6/144 4%
Query  4    LLLIIVSVLAATRRMAD-HHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVGHGAP 62
            LLL +VSVLAAT  MA+ HH+DQVVY+   RCQPGMGYPMYSLPRCRA+VKRQC G    
Sbjct  11   LLLAVVSVLAATATMAEYHHQDQVVYTRA-RCQPGMGYPMYSLPRCRALVKRQCRG---- 65
Query  63   GGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGD 122
              A  EQ+R+DCCRQLAAVDDSWCRC A++HM+GGIYRELGA DVGHPM+EVF GCRRGD
Sbjct  66   SAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMSEVFRGCRRGD 125
Query  123  LERAAASLPAFCNVDIPNGTGGVCYWLGYT 152
            LERAAASLPAFCNVDIPNG GGVCYWL  +
Sbjct  126  LERAAASLPAFCNVDIPNGGGGVCYWLARS 155

Sequence Alignment: 8. Allergen Name: Ory s TAI Sequence ID: BAA07712

 Score = 108.2 bits 783,  Expect = 1e-25
 Identities = 108/142 76%, Positives = 122/142 85%, Gaps = 4/142 2%
Query  4    LLLIIVSVLAATRRMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVGHGAPG 63
            LL+++VSVLAAT  MADHH++QVVY+ G+ CQPG+GYP Y LPRCRA VKRQCV   APG
Sbjct  11   LLVVVVSVLAATTTMADHHQEQVVYTPGQLCQPGIGYPTYPLPRCRAFVKRQCV---APG 67
Query  64   GAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDL 123
              +DEQ+R+ CCRQLA +D SWCRC ALNHM+  IYRE  A D GHPMAEVF GCRRGD+
Sbjct  68   -TLDEQVRRGCCRQLAGIDSSWCRCDALNHMLRIIYREERAADAGHPMAEVFRGCRRGDI 126
Query  124  ERAAASLPAFCNVDIPNGTGGVCYWL 149
            ERAAASLPAFCNVDIPNG GGVCYWL
Sbjct  127  ERAAASLPAFCNVDIPNGVGGVCYWL 152

Sequence Alignment: 9. Allergen Name: Ory s TAI Sequence ID: BAA07773

 Score = 100.3 bits 720,  Expect = 2e-23
 Identities = 101/108 93%, Positives = 102/108 94%, Gaps = 2/108 1%
Query  51   VVKRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHP 110
            VVKRQCV     GGA DEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHP
Sbjct  2    VVKRQCVATRRTGGA-DEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHP 60
Query  111  MAEVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYTPRTPRTGH 160
            MAEVFPGCRRGDLERA A+LPAFCNVDIPNGTGGVCYWLGY PRTPRTGH
Sbjct  61   MAEVFPGCRRGDLERARATLPAFCNVDIPNGTGGVCYWLGY-PRTPRTGH 109

Sequence Alignment: 10. Allergen Name: Ory s TAI Sequence ID: BAA07772

 Score = 97.2 bits 695,  Expect = 2e-22
 Identities = 97/111 87%, Positives = 97/111 87%, Gaps = 1/111 0%
Query  49   RAVVKRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVG 108
            R  VKRQCV    P     EQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVG
Sbjct  1    RHEVKRQCVATTHPAAPGTEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVG 60
Query  109  HPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYTPRTPRTGH 160
            HPMAEVFPGCRRGDLER   SLPAFCNVDIPNGTGGVCYWLGY PRTPRTGH
Sbjct  61   HPMAEVFPGCRRGDLERRRRSLPAFCNVDIPNGTGGVCYWLGY-PRTPRTGH 111

Sequence Alignment: 11. Allergen Name: Ory s TAI Sequence ID: BAA07774

 Score = 96.7 bits 691,  Expect = 2e-22
 Identities = 96/107 89%, Positives = 98/107 91%, Gaps = 1/107 0%
Query  53   KRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA 112
            +RQCVG         +QLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA
Sbjct  7    QRQCVGPRRTRRRWTQQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA 66
Query  113  EVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYTPRTPRTGH 160
            EVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGY PRTPRTGH
Sbjct  67   EVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGY-PRTPRTGH 113

Sequence Alignment: 12. Allergen Name: Ory s TAI Sequence ID: AAB99797

 Score = 82.5 bits 574,  Expect = 6e-18
 Identities = 88/144 61%, Positives = 101/144 70%, Gaps = 6/144 4%
Query  4    LLLIIVSVLAATRRMAD-HHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVGHGAP 62
            LLL +VSVLAAT  MA+ HH+DQVVY+ G  CQPGMGYPMY L R   V +   +G   P
Sbjct  11   LLLAVVSVLAATATMAEYHHQDQVVYTPGPLCQPGMGYPMYPL-RVAGVGEAPLLGRARP 69
Query  63   GGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGD 122
                   +  DCCRQ+  VD SWCRC A++HM+GGIYRELGA DVGHPM+EVF GCRRG 
Sbjct  70   R---RRAVPGDCCRQFPPVDYSWCRCEAISHMLGGIYRELGAPDVGHPMSEVFRGCRRGT 126
Query  123  LERAAASLPAFCNVDIPNGTGGVCYWLGYT 152
               A    P    VDIPNG GGVCYWL  +
Sbjct  127  WS-ARRRAPGVLQVDIPNGGGGVCYWLARS 155

Sequence Alignment: 13. Allergen Name: Hor v 1 Sequence ID: P16968

 Score = 74.6 bits 510,  Expect = 1e-15
 Identities = 76/126 60%, Positives = 90/126 71%, Gaps = 10/126 7%
Query  26   VVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSW 85
            V  S GE C PGMGYP+Y +PRCRA+VK QC G     G V E +++DCCRQ+AA+ D W
Sbjct  12   VSNSPGEWCWPGMGYPVYPFPRCRALVKSQCAG-----GQVVESIQKDCCRQIAAIGDEW 66
Query  86   CRCSALNHMVGGIYRELGAT--DVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPN--G 141
            C C AL  M G +Y+ELG    D    +AEVFPGCR   ++RA ASLPA CN  IPN  G
Sbjct  67   CICGALGSMRGSMYKELGVALADDKATVAEVFPGCRTEVMDRAVASLPAVCNQYIPNTNG 126
Query  142  TGGVCYWLGYTPRTPR 157
            T GVCYWL Y  + PR
Sbjct  127  TDGVCYWLSYY-QPPR 141

Sequence Alignment: 14. Allergen Name: Hor v 15.0101 Sequence ID: P16968

 Score = 74.6 bits 510,  Expect = 1e-15
 Identities = 76/126 60%, Positives = 90/126 71%, Gaps = 10/126 7%
Query  26   VVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSW 85
            V  S GE C PGMGYP+Y +PRCRA+VK QC G     G V E +++DCCRQ+AA+ D W
Sbjct  12   VSNSPGEWCWPGMGYPVYPFPRCRALVKSQCAG-----GQVVESIQKDCCRQIAAIGDEW 66
Query  86   CRCSALNHMVGGIYRELGAT--DVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPN--G 141
            C C AL  M G +Y+ELG    D    +AEVFPGCR   ++RA ASLPA CN  IPN  G
Sbjct  67   CICGALGSMRGSMYKELGVALADDKATVAEVFPGCRTEVMDRAVASLPAVCNQYIPNTNG 126
Query  142  TGGVCYWLGYTPRTPR 157
            T GVCYWL Y  + PR
Sbjct  127  TDGVCYWLSYY-QPPR 141

Sequence Alignment: 15. Allergen Name: Ory s TAI Sequence ID: BAA01999

 Score = 62.4 bits 412,  Expect = 4e-12
 Identities = 59/84 70%, Positives = 71/84 84%, Gaps = 6/84 7%
Query  4    LLLIIVSVLAATR-RMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVGHGAP 62
            LLL+++SVLAA    MADHH+   VYS GE+C+PG+ YP YSLP+CR +V+RQCVG GA 
Sbjct  11   LLLVVLSVLAAAMATMADHHQ---VYSPGEQCRPGISYPTYSLPQCRTLVRRQCVGRGA- 66
Query  63   GGAVDEQLRQDCCRQLAAVDDSWCRCSALN 92
              A DEQ+ QDCCRQLAAVDD WCRC AL+
Sbjct  67   -SAADEQVWQDCCRQLAAVDDGWCRCGALD 95

Sequence Alignment: 16. Allergen Name: Hor v 1 Sequence ID: CAA08836

 Score = 57.7 bits 372,  Expect = 2e-10
 Identities = 53/107 49%, Positives = 73/107 68%, Gaps = 11/107 10%
Query  34   CQPGMGYPMYSLPRCRAVVKRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNH 93
            C P MG+ +  L RCRA+VK +CVG+  P     E + +DCC+++A + + WCRC  L  
Sbjct  37   CDPEMGHKVSPLTRCRALVKLECVGNRVP-----EDVLRDCCQEVANISNEWCRCGDLGS 91
Query  94   MVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPN---GTGGVCYW 148
            M+  +Y  LG   VG    EVFPGC++  ++   A +PA+CNV IPN   GT GVCYW
Sbjct  92   MLRSVYAALG---VGGGPEEVFPGCQKDVMKLLVAGVPALCNVPIPNEAAGTRGVCYW 146

Sequence Alignment: 17. Allergen Name: Tri a 15.0101 Sequence ID: CBA13560

 Score = 57.0 bits 367,  Expect = 2e-10
 Identities = 56/109 51%, Positives = 75/109 68%, Gaps = 12/109 11%
Query  34   CQPGMGYPMYSLPRCRAVVKRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNH 93
            C P  GY + +L  CRA+VK QCVG   P     E + +DCC+QLA V++ WCRC  L+ 
Sbjct  7    CDPATGYKVSALTGCRAMVKLQCVGSQVP-----EAVLRDCCQQLADVNNEWCRCEDLSS 61
Query  94   MVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTG---GVCYWLG 150
            M+  +Y+ELGA + G    EV+PGCR+  ++  AAS+P    V IPN +G   GVCYW  
Sbjct  62   MLRSVYQELGARE-GK---EVLPGCRKEVMKLTAASVPEVRKVPIPNPSGDRAGVCYWAA 117
Query  151  Y 151
            Y
Sbjct  118  Y 118

Sequence Alignment: 18. Allergen Name: Tri a TAI Sequence ID: P01083

 Score = 56.8 bits 365,  Expect = 3e-10
 Identities = 55/109 50%, Positives = 75/109 68%, Gaps = 14/109 12%
Query  34   CQPGMGYPMYSLPRCRAVVKRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNH 93
            C P  GY + +L  CRA+VK QCVG   P     E + +DCC+QLA +++ WCRC  L+ 
Sbjct  7    CNPATGYKVSALTGCRAMVKLQCVGSQVP-----EAVLRDCCQQLADINNEWCRCGDLSS 61
Query  94   MVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTG---GVCY--W 148
            M+  +Y+ELG  + G    EV+PGCR+  ++  AAS+P  C V IPN +G   GVCY  W
Sbjct  62   MLRSVYQELGVRE-GK---EVLPGCRKEVMKLTAASVPEVCKVPIPNPSGDRAGVCYGDW 117
Query  149  LGY 151
              Y
Sbjct  118  AAY 120

Sequence Alignment: 19. Allergen Name: Tri a 28.0101 Sequence ID: CAI84642

 Score = 46.8 bits 284,  Expect = 3e-07
 Identities = 45/106 42%, Positives = 66/106 62%, Gaps = 11/106 10%
Query  34   CQPGMGYPMYSLPRCRAVVKRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNH 93
            C PG  + + +LP CR +++ QC G   P     E + +DCC+QLA + + WCRC AL  
Sbjct  1    CYPGQAFQVPALPACRPLLRLQCNGSQVP-----EAVLRDCCQQLAHISE-WCRCGALYS 54
Query  94   MVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDI---PNGTGG-VC 146
            M+  +Y+E GA + G+     FP CRR  ++  AAS+ A C + I    +G G  VC
Sbjct  55   MLDSMYKEHGAQE-GQAGTGAFPRCRREVVKLTAASITAVCRLPIVVDASGDGAYVC 110

Sequence Alignment: 20. Allergen Name: Tri a TAI Sequence ID: P01085

 Score = 46.8 bits 284,  Expect = 3e-07
 Identities = 45/106 42%, Positives = 66/106 62%, Gaps = 11/106 10%
Query  34   CQPGMGYPMYSLPRCRAVVKRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNH 93
            C PG  + + +LP CR +++ QC G   P     E + +DCC+QLA + + WCRC AL  
Sbjct  6    CYPGQAFQVPALPACRPLLRLQCNGSQVP-----EAVLRDCCQQLAHISE-WCRCGALYS 59
Query  94   MVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDI---PNGTGG-VC 146
            M+  +Y+E GA + G+     FP CRR  ++  AAS+ A C + I    +G G  VC
Sbjct  60   MLDSMYKEHGAQE-GQAGTGAFPRCRREVVKLTAASITAVCRLPIVVDASGDGAYVC 115

Sequence Alignment: 21. Allergen Name: Tri a TAI Sequence ID: P01084

 Score = 45.1 bits 270,  Expect = 9e-07
 Identities = 44/106 41%, Positives = 65/106 61%, Gaps = 11/106 10%
Query  34   CQPGMGYPMYSLPRCRAVVKRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNH 93
            C PG  + + +LP CR ++K QC G   P     E + +DCC+QLA + + W RC AL  
Sbjct  6    CYPGQAFQVPALPGCRPLLKLQCNGSQVP-----EAVLRDCCQQLADISE-WPRCGALYS 59
Query  94   MVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDI---PNGTGG-VC 146
            M+  +Y+E G ++ G+     FP CRR  ++  AAS+ A C + I    +G G  VC
Sbjct  60   MLDSMYKEHGVSE-GQAGTGAFPSCRREVVKLTAASITAVCRLPIVVDASGDGAYVC 115

Sequence Alignment: 22. Allergen Name: Tri a TAI Sequence ID: CAA39099

 Score = 34.7 bits 185,  Expect = 0.001
 Identities = 47/115 40%, Positives = 62/115 53%, Gaps = 29/115 25%
Query  2    TRLLL--IIVSVLAATRRMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVGH 59
            T LLL  ++VSV+AA              + G  C PGMG P   L  CR  V +Q  G 
Sbjct  8    THLLLAAVLVSVFAAAA------------ATGPYCYPGMGLPSNPLEGCREYVAQQTCGV 55
Query  60   GAPGGAVDEQL----RQDCCRQLAAVDDSW-CRCSALNHMVGGIYRELGATDVGHPMAEV 114
            G  G  V  +     R  CC++L   D S  CRC A+ + +G        +D    + + 
Sbjct  56   GIVGSPVSTEPGNTPRDRCCKEL--YDASQHCRCEAVRYFIG------RTSDPNSGVLKD 107
Query  115  FPGCRRGDLERAAASL--PAFCNV 136
            +PGC R      A  L  P  CNV
Sbjct  108  LPGCPREPQRDFAKVLVTPGHCNV 131

Sequence Alignment: 23. Allergen Name: Hor v 1 Sequence ID: P01086

 Score = 34.6 bits 184,  Expect = 0.001
 Identities = 40/117 34%, Positives = 61/117 52%, Gaps = 10/117 8%
Query  29   SLGERCQPGMGYPMYSLPRCRAVVKRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRC 88
            S+G+ C PG   P   L  CR  V  Q + H  P   +   +++ CC +L+A+  ++CRC
Sbjct  24   SFGDSCAPGDALPHNPLRACRTYVVSQ-ICHQGPR-LLTSDMKRRCCDELSAIP-AYCRC 80
Query  89   SALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASL--PAFCNVDIPNGTGGVC 146
             AL  ++ G+    GA + G    +  P C R      AA+L  P  CN+   +G+   C
Sbjct  81   EALRIIMQGVVTWQGAFE-GAYFKDS-PNCPRERQTSYAANLVTPQECNLGTIHGSA-YC 137
Query  147  YWL--GY 151
              L  GY
Sbjct  138  PELQPGY 144

Sequence Alignment: 24. Allergen Name: Hor v 1 Sequence ID: CAA46705

 Score = 34.6 bits 184,  Expect = 0.001
 Identities = 40/117 34%, Positives = 61/117 52%, Gaps = 10/117 8%
Query  29   SLGERCQPGMGYPMYSLPRCRAVVKRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRC 88
            S+G+ C PG   P   L  CR  V  Q + H  P   +   +++ CC +L+A+  ++CRC
Sbjct  24   SFGDSCAPGDALPHNPLRACRTYVVSQ-ICHQGPR-LLTSDMKRRCCDELSAIP-AYCRC 80
Query  89   SALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASL--PAFCNVDIPNGTGGVC 146
             AL  ++ G+    GA + G    +  P C R      AA+L  P  CN+   +G+   C
Sbjct  81   EALRIIMQGVVTWQGAFE-GAYFKDS-PNCPRERQTSYAANLVTPQECNLGTIHGSA-YC 137
Query  147  YWL--GY 151
              L  GY
Sbjct  138  PELQPGY 144

Sequence Alignment: 25. Allergen Name: Hor v 1 Sequence ID: CAA35188

 Score = 34.5 bits 183,  Expect = 0.002
 Identities = 36/109 33%, Positives = 57/109 52%, Gaps = 7/109 6%
Query  29   SLGERCQPGMGYPMYSLPRCRAVVKRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRC 88
            S+G+ C PG   P   L  CR  V  Q + H  P   +   +++ CC +L+A+  ++CRC
Sbjct  24   SFGDSCAPGDALPHNPLRACRTYVVSQ-ICHQGPR-LLTSDMKRRCCDELSAIP-AYCRC 80
Query  89   SALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASL--PAFCNVDIPNGT 142
             AL  ++ G+    GA + G    +  P C R      AA+L  P  CN+   +G+
Sbjct  81   EALRIIMQGVVTWQGAFE-GAYFKDS-PNCPRERQTSYAANLVTPQECNLGTIHGS 134

Sequence Alignment: 26. Allergen Name: Tri a 29.0201 Sequence ID: CBA13559

 Score = 33.9 bits 179,  Expect = 0.002
 Identities = 37/98 37%, Positives = 49/98 50%, Gaps = 15/98 15%
Query  31   GERCQPGMGYPMYSLPRCRAVVKRQCVGHGAPGGAVDEQL----RQDCCRQLAAVDDSW- 85
            G  C PGMG P   L  CR  V +Q  G G  G  V  +     R  CC++L   D S  
Sbjct  2    GPYCYPGMGLPSNPLEGCREYVAQQTCGVGIVGSPVSTEPGNTPRDRCCKEL--YDASQH 59
Query  86   CRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASL--PAFCNV 136
            C C A+ + +G        +D    + + +PGC R     +A  L  P  CNV
Sbjct  60   CWCEAVRYFIG------RTSDPNSGVLKDLPGCPREPQRDSAKVLVTPGHCNV 106

Sequence Alignment: 27. Allergen Name: Tri a 29.0101 Sequence ID: CAZ76052

 Score = 33.9 bits 179,  Expect = 0.002
 Identities = 38/98 38%, Positives = 50/98 51%, Gaps = 15/98 15%
Query  31   GERCQPGMGYPMYSLPRCRAVVKRQCVGHGAPGGAVDEQL----RQDCCRQLAAVDDSW- 85
            G  C  GMG P+  L  CR  V +Q  G    G AV  +     R  CC++L   D S  
Sbjct  2    GPYCYAGMGLPINPLEGCREYVAQQTCGISISGSAVSTEPGNTPRDRCCKEL--YDASQH 59
Query  86   CRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASL--PAFCNV 136
            CRC A+ + +G   R    +D    + + +PGC R      A  L  P  CNV
Sbjct  60   CRCEAVRYFIG---RR---SDPNSSVLKDLPGCPREPQRDFAKVLVTPGHCNV 106

Sequence Alignment: 28. Allergen Name: Hor v 1 Sequence ID: CAA31794

 Score = 33.4 bits 174,  Expect = 0.003
 Identities = 44/122 36%, Positives = 65/122 53%, Gaps = 18/122 14%
Query  7    IIVSVLAATRRMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRA-VVKRQCVGHGAPGGA 65
            +++SVLA      +  KD+        CQ G+ +P   L  C   V+KR C G G P   
Sbjct  14   VLLSVLAVAAATLESVKDE--------CQLGVDFPHNPLATCHTYVIKRVC-GRG-PSRP 63
Query  66   VDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDLER 125
            +   +++ CCR+LAAV D  CRC AL  ++ G+    G    G  + +    C R +   
Sbjct  64   M--LVKERCCRELAAVPDH-CRCEALRILMDGVRTPEGRVVEGR-LGDRRD-CPREEQRA 118
Query  126  AAASL--PAFCNVDIPNGTG 143
             AA+L   A CN+      G
Sbjct  119  FAATLVTAAECNLSSVQAPG 138

Sequence Alignment: 29. Allergen Name: Tri a TAI Sequence ID: CAA34709

 Score = 32.8 bits 169,  Expect = 0.005
 Identities = 38/106 35%, Positives = 54/106 50%, Gaps = 14/106 13%
Query  27   VYSLG-ERCQPGMGYPMYSLPRCRAVVKRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSW 85
            V ++G E C P M   +  LP CR  V++Q      PG       +Q CC +LA +    
Sbjct  22   VAAIGNEDCTPWMSTLITPLPSCRDYVEQQACRIETPGSPY--LAKQQCCGELANIPQQ- 78
Query  86   CRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRG---DLERAAASLPAFCNVDIPNGT 142
            CRC AL + +G   R     D    M   +PGC R    D+ R   + P +CN+   + T
Sbjct  79   CRCQALRYFMGPKSRP----DQSGLME--LPGCPREVQMDFVRILVT-PGYCNLTTVHNT 131

Sequence Alignment: 30. Allergen Name: Tri a TAI Sequence ID: CAA35598

 Score = 32.6 bits 168,  Expect = 0.006
 Identities = 37/98 37%, Positives = 49/98 50%, Gaps = 15/98 15%
Query  31   GERCQPGMGYPMYSLPRCRAVVKRQCVGHGAPGGAVDEQL----RQDCCRQLAAVDDSW- 85
            G  C  GMG P+  L  CR  V +Q  G    G AV  +     R  CC++L   D S  
Sbjct  27   GPYCYAGMGLPINPLEGCREYVAQQTCGISISGSAVSTEPGNTPRDRCCKEL--YDASQH 84
Query  86   CRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASL--PAFCNV 136
            CRC A+ + +G   R    +D    + + +PGC R      A  L     CNV
Sbjct  85   CRCEAVRYFIG---RR---SDPNSSVLKDLPGCPREPQRDFAKVLVTSGHCNV 131

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.