The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE
GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF
HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN
Sequence Info Allergen Name Length Opt Bits Score E Value
Q08407 Cor a 1 159 1020 238.8 5.3e-65
CAA50327 Cor a 1.0101 160 1020 238.8 5.4e-65
CAA50328 Cor a 1.0102 160 1003 235.0 7.7e-64
CAA50325 Cor a 1.0103 160 999 234.1 1.4e-63
CAA50326 Cor a 1.0104 160 977 229.1 4.5e-62
ABZ81040 Car b 1.0109 160 941 220.9 1.3e-59
ABZ81043 Car b 1.0112 160 937 220.0 2.4e-59
ABZ81041 Car b 1.0110 160 936 219.8 2.8e-59
ADK39021 Ost c 1.0101 160 936 219.8 2.8e-59
ABZ81044 Car b 1.0113 160 933 219.1 4.5e-59
ABZ81042 Car b 1.0111 160 932 218.9 5.3e-59
CAA47357 Car b 1.0102 159 926 217.5 1.3e-58
CAB02206 Car b 1.0103 160 925 217.3 1.6e-58
CAB02209 Car b 1.0106 160 925 217.3 1.6e-58
CAB02207 Car b 1.0104 160 924 217.1 1.9e-58
CAB02208 Car b 1.0105 160 913 214.6 1e-57
CAB02213 Car b 1.0107 160 911 214.1 1.4e-57
P38949 Car b 1 159 908 213.5 2.3e-57
CAB02215 Car b 1.0108 160 901 211.9 6.8e-57
P38950 Car b 1 159 888 208.9 5.2e-56
P38948 Aln g 1 159 807 190.6 1.7e-50
AAB24432 Aln g 1 160 807 190.6 1.7e-50
CAB02216 Car b 1.0301 161 806 190.4 2e-50
Q39427 Bet v 1.0205 160 803 189.7 3.2e-50
CAA96548 Cor a 1.0201 160 802 189.5 3.8e-50
CAB02217 Car b 1.0302 161 802 189.5 3.8e-50
P43186 Bet v 1.0204 160 799 188.8 6e-50
CAA04828.1 Bet v 1.0206 159 796 188.1 9.6e-50
CAA54421 Bet v 1.0201 160 794 187.7 1.3e-49
P43184 Bet v 1.0203 160 792 187.2 1.8e-49
CAA54481 Bet v 1.0202 160 783 185.2 7.4e-49
CAB02160 Bet v 1.0113 160 780 184.5 1.2e-48
CAB02159 Bet v 1.0112 160 775 183.4 2.6e-48
CAA54484 Bet v 1.0104 160 775 183.4 2.6e-48
CAA33887 Bet v 1.0101 160 775 183.4 2.6e-48
CAB02156 Bet v 1.0109 160 774 183.1 3e-48
CAB02161 Bet v 1.0114 160 773 182.9 3.6e-48
CAA54487 Bet v 1.0106 160 771 182.5 4.9e-48
CAA54482 Bet v 1.0102 160 767 181.6 9.1e-48
CAA54483 Bet v 1.0103 160 766 181.3 1.1e-47
CAA04827.1 Bet v 1.0116 159 764 180.9 1.4e-47
CAA07329.1 Bet v 1.0118 160 763 180.7 1.7e-47
CAA07323.1 Bet v 1.0117 160 762 180.4 2e-47
CAA54489 Bet v 1.0107 160 762 180.4 2e-47
CAB02155 Bet v 1.0108 160 761 180.2 2.3e-47
CAB02157 Bet v 1.0110 160 760 180.0 2.7e-47
CAA54485 Bet v 1.0105 160 756 179.1 5.1e-47
CAB02158 Bet v 1.0111 160 753 178.4 8.2e-47
CAA96547 Bet v 1.0115 160 753 178.4 8.2e-47
ACF75030.1 Bet v 1.0207 150 748 177.3 1.6e-46
ABC41615.1 Bet v 1.0119 150 711 168.9 5.4e-44
CAA54696.1 Bet v 1.0301 160 698 166.0 4.6e-43
CAA96549 Cor a 1.0301 160 689 163.9 1.9e-42
CAA96535 Mal d 1.0401 160 685 163.0 3.5e-42
APD76154 Jug r 5.0101 160 682 162.3 5.6e-42
CAA96536 Mal d 1.0402 160 672 160.1 2.7e-41
ACJ23864 Fag s 1.0101 160 670 159.6 3.7e-41
CAD10374 Cas s 1 160 669 159.4 4.3e-41
CAA96537 Mal d 1.0403 160 668 159.2 5.1e-41
AAD48405 Cor a 1.0401 161 659 157.1 2.1e-40
AAG40331 Cor a 1.0404 161 659 157.1 2.1e-40
AAG40329 Cor a 1.0402 161 655 156.2 3.9e-40
AAG40330 Cor a 1.0403 161 652 155.5 6.3e-40
ABZ81046 Que a 1.0301 160 632 151.0 1.4e-38
Q2I6V8 Pru p 1.0101 160 630 150.6 2e-38
O24248 Pru av 1 160 628 150.1 2.7e-38
AUH28179 Que m 1.0101 160 609 145.8 5.3e-37
Q256S7 Fra a 1 160 609 145.8 5.3e-37
Q3T923 Fra a 1 160 607 145.4 7.2e-37
CAA96534 Mal d 1.0301 159 605 144.9 9.8e-37
Q256S2 Fra a 1 160 603 144.5 1.4e-36
O50001 Pru ar 1 160 602 144.2 1.6e-36
Q256S6 Fra a 1 160 600 143.8 2.2e-36
AAK13027 Mal d 1.0302 159 597 143.1 3.4e-36
AAO25113 Mal d 1.0304 159 592 142.0 7.5e-36
Q256S4 Fra a 1 159 588 141.1 1.4e-35
ABZ81047 Que a 1.0401 160 584 140.2 2.7e-35
B6CQS9 Pru du 1.0101 160 584 140.2 2.7e-35
CAD32318 Mal d 1.0208 158 583 139.9 3.1e-35
AAB01362 Mal d 1.0201 159 583 139.9 3.1e-35
AAD26545 Mal d 1.0202 159 583 139.9 3.1e-35
AAD13683 Mal d 1.0206 159 582 139.7 3.6e-35
AAK13028 Mal d 1.0303 159 580 139.3 4.9e-35
AAD26548 Mal d 1.0204 159 579 139.0 5.8e-35
AAK13030 Mal d 1.0207 159 577 138.6 7.9e-35
AAD26546 Mal d 1.0103 159 577 138.6 7.9e-35
AAD26547 Mal d 1.0203 159 577 138.6 7.9e-35
AAD29671 Mal d 1.0108 159 575 138.1 1.1e-34
AAD26558 Mal d 1.0205 159 575 138.1 1.1e-34
AAD26552 Mal d 1.0104 159 573 137.7 1.5e-34
O65200 Pyr c 1 159 572 137.4 1.7e-34
AFN42528 Can s 5.0101 161 572 137.4 1.8e-34
CAA58646 Mal d 1.0101 159 571 137.2 2e-34
AAD26555 Mal d 1.0107 159 570 137.0 2.4e-34
AAD26553 Mal d 1.0105 159 569 136.8 2.8e-34
AAD26554 Mal d 1.0106 159 569 136.8 2.8e-34
AAK13029 Mal d 1.0109 159 565 135.9 5.2e-34
CAA88833 Mal d 1.0102 159 563 135.4 7.1e-34
QGS84240 Que i 1.0101 159 558 134.3 1.6e-33
CAM31908 Act c 8.0101 159 553 133.1 3.4e-33
ABZ81045 Que a 1.0201 159 550 132.5 5.5e-33
QOL10866 Que ac 1.0101 159 550 132.5 5.5e-33
Q0Z8U9 Rub i 1.0101 137 505 122.4 5.1e-30
CAM31909 Act d 8.0101 157 501 121.4 1.2e-29
CAA42646 Gly m 4 158 470 114.4 1.5e-27
NP_001275580 Sola l 4.0201 160 454 110.7 1.9e-26
AHC08073 Sola l 4.0101 160 444 108.5 9.1e-26
P25985 Pha v 1 155 439 107.4 1.9e-25
CAA43637 Pha v 1 156 439 107.4 1.9e-25
CAA43636 Pha v 1 155 435 106.5 3.6e-25
AAQ91847 Ara h 8.0101 157 435 106.5 3.6e-25
EF436550 Ara h 8.0201 153 420 103.1 3.7e-24
CAA75803 Lyc e 4.0101 178 402 98.9 7.8e-23
CAA67246 Pet c PR10 155 400 98.5 8.7e-23
P92918 Api g 1.0201 159 400 98.5 9e-23
AAB92255 Tar o RAP 157 398 98.1 1.2e-22
Q2VU97 Vig r 1.0101 155 395 97.4 1.9e-22
AAL76932 Dau c 1.0201 154 394 97.2 2.2e-22
P49372 Api g 1 154 374 92.7 5.1e-21
CAB03716 Dau c 1.0104 154 365 90.6 2.1e-20
CAB06416 Dau c 1.0105 154 362 90.0 3.3e-20
BAA13604 Dau c 1.0102 154 359 89.3 5.3e-20
AAB01092 Dau c 1.0101 168 357 88.8 8.3e-20
CAB03715 Dau c 1.0103 154 346 86.3 4.1e-19
Q5ULZ4 Fra a 1.0101 100 254 65.8 3.9e-13
P85126 Que a 1.0101 50 194 52.8 1.7e-09
Q9ZWP8 Vig r 6.0101 155 162 44.7 1.4e-06
Q9S8Q4 Cas s 1 24 97 31.3 0.0023
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Cor a 1 Sequence ID: Q08407

 Score = 238.8 bits 1020,  Expect = 5e-65
 Identities = 159/159 100%, Positives = 159/159 100%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE
Sbjct  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF
Sbjct  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN
Sbjct  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159

Sequence Alignment: 2. Allergen Name: Cor a 1.0101 Sequence ID: CAA50327

 Score = 238.8 bits 1020,  Expect = 5e-65
 Identities = 159/159 100%, Positives = 159/159 100%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE
Sbjct  2    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF
Sbjct  62   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN
Sbjct  122  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 3. Allergen Name: Cor a 1.0102 Sequence ID: CAA50328

 Score = 235.0 bits 1003,  Expect = 8e-64
 Identities = 157/159 98%, Positives = 157/159 98%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE
Sbjct  2    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GSRYKYVKERVDEVDNTNF YSYTVIEGDVLGDKLEKVC ELKIVAAPGGGSILKISSKF
Sbjct  62   GSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSILKISSKF 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN
Sbjct  122  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 4. Allergen Name: Cor a 1.0103 Sequence ID: CAA50325

 Score = 234.1 bits 999,  Expect = 1e-63
 Identities = 156/159 98%, Positives = 157/159 98%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYE ET SVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE
Sbjct  2    GVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF
Sbjct  62   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            HAKGDHEINAEE+KGAKEMAEKLLRAVETYLLAHSAEYN
Sbjct  122  HAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 5. Allergen Name: Cor a 1.0104 Sequence ID: CAA50326

 Score = 229.1 bits 977,  Expect = 5e-62
 Identities = 154/159 96%, Positives = 154/159 96%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYEVETPSVI AARLFKSYVLDGDKLIPKVAPQAITSVENV GNGGPGTIKNITFGE
Sbjct  2    GVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFGE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GSRYKYVKERVDEVDNTNF YSYTVIEGDVLGDKLEKVC ELKIVAAPGGGS LKISSKF
Sbjct  62   GSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSKF 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN
Sbjct  122  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 6. Allergen Name: Car b 1.0109 Sequence ID: ABZ81040

 Score = 220.9 bits 941,  Expect = 1e-59
 Identities = 145/159 91%, Positives = 152/159 95%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYE ETPSVIPAARLFKSYVLDGDKLIPKVAPQAI+SVENV GNGGPGTIKNITF E
Sbjct  2    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS +K+VKERVDEVDN NF Y+YTVIEGDVLGDKLEKV HELKIVAAPGGGSILKISSKF
Sbjct  62   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSKF 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            HAKGDHE+NAEEMKGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  122  HAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 7. Allergen Name: Car b 1.0112 Sequence ID: ABZ81043

 Score = 220.0 bits 937,  Expect = 2e-59
 Identities = 144/159 90%, Positives = 152/159 95%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYE ETPSVIPAARLFKSYVLDGDKLIPKVAPQAI+SVENV GNGGPGTIKNITF E
Sbjct  2    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS +K+VKERVDEVDN NF Y+YTVIEGDVLGDKLEKV HELKIVAAPGGGSI+KISSKF
Sbjct  62   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            HAKGDHE+NAEEMKGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  122  HAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 8. Allergen Name: Car b 1.0110 Sequence ID: ABZ81041

 Score = 219.8 bits 936,  Expect = 3e-59
 Identities = 143/159 89%, Positives = 152/159 95%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYE ETPSVIPAARLFKSYVLDGDKLIPKVAPQAI+SVENV GNGGPGTIKNITF E
Sbjct  2    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS +K+VKERVDEVDN NF Y+YTVIEGDVLGDKLEKV HELKIVAAPGGGS++KISSKF
Sbjct  62   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSVVKISSKF 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            HAKGDHE+NAEEMKGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  122  HAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 9. Allergen Name: Ost c 1.0101 Sequence ID: ADK39021

 Score = 219.8 bits 936,  Expect = 3e-59
 Identities = 144/159 90%, Positives = 151/159 94%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYE ETPSVIPAARLFKSYVLDGDKLIPKVAPQAI+ VENV GNGGPGTIKNITF E
Sbjct  2    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFAE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS +K+VKERVDEVDN NF Y+YTVIEGDVLGDKLEKV HELKIVAAPGGGSILKISSKF
Sbjct  62   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSKF 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            HAKGDHE+NAEEMKGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  122  HAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 10. Allergen Name: Car b 1.0113 Sequence ID: ABZ81044

 Score = 219.1 bits 933,  Expect = 5e-59
 Identities = 144/159 90%, Positives = 151/159 94%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYE ETPSVIPAARLFKSYVLDGDKLIPKVAPQAI+SVENV GNGGPGTIKNITF E
Sbjct  2    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            G  +K+VKERVDEVDN NF YSYTVIEGDVLGDKLEKV HELKIVAAPGGGSI+KISSKF
Sbjct  62   GIPFKFVKERVDEVDNANFKYSYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            HAKGDHE+NAEEMKGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  122  HAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 11. Allergen Name: Car b 1.0111 Sequence ID: ABZ81042

 Score = 218.9 bits 932,  Expect = 5e-59
 Identities = 143/159 89%, Positives = 152/159 95%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYE ETPSVIPAARLFKSYVLDGDKLIPKVAPQAI+SVENV GNGGPGTIKNITF E
Sbjct  2    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS +K+VKERVDEVDN NF Y+YTVIEGDVLGDKLEKV HELKIVAAPGGGSI+KISSKF
Sbjct  62   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            HAKGDHE+NAE+MKGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  122  HAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 12. Allergen Name: Car b 1.0102 Sequence ID: CAA47357

 Score = 217.5 bits 926,  Expect = 1e-58
 Identities = 143/159 89%, Positives = 151/159 94%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYE ETPSVIPAARLFKSYVLDGDKLIPKVAPQAI+SVENV GNGGPGTIKNITF E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 60
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS +K+VKERVDEVDN NF Y+YTVIEGDVLGDKLEKV HELKIVAAPGGGSI+KISSKF
Sbjct  61   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            HAKG HE+NAEEMKGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 13. Allergen Name: Car b 1.0103 Sequence ID: CAB02206

 Score = 217.3 bits 925,  Expect = 2e-58
 Identities = 142/159 89%, Positives = 151/159 94%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYE ETPSVIPAARLFKSYVLDGDKLIPKVAPQAI+SVENV GNGGPGTIKNITF E
Sbjct  2    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS +K+VKERVDEVDN NF Y+YTVIEGDVLGDKLEKV HELKIVAAPGGGSI+KISSKF
Sbjct  62   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            HAKGDHE+NAE+MKGAKEMAEKLLRAVE+YLLAH+ EYN
Sbjct  122  HAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 14. Allergen Name: Car b 1.0106 Sequence ID: CAB02209

 Score = 217.3 bits 925,  Expect = 2e-58
 Identities = 143/159 89%, Positives = 151/159 94%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYE ETPSVIPAARLFKSYVLD DKLIPKVAPQAI+SVENV GNGGPGTIKNITF E
Sbjct  2    GVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS +K+VKERVDEVDN NF Y+YTVIEGDVLGDKLEKV HELKIVAAPGGGSI+KISSKF
Sbjct  62   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            HAKGDHE+NAEEMKGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  122  HAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 15. Allergen Name: Car b 1.0104 Sequence ID: CAB02207

 Score = 217.1 bits 924,  Expect = 2e-58
 Identities = 142/159 89%, Positives = 150/159 94%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYE ETPSVIPAARLFKSYVLDGDKLIPKVAPQAI+SVENV GNGGPGTIKNITF E
Sbjct  2    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS +K+VKERVDEVDN NF Y+YTVIEGDVLGD LEKV HELKIVAAPGGGSI+KISSKF
Sbjct  62   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDNLEKVSHELKIVAAPGGGSIVKISSKF 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            HAKGDHE+NAEEMKGAKEMAEKLLRAVE+YLLAH+ EYN
Sbjct  122  HAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 16. Allergen Name: Car b 1.0105 Sequence ID: CAB02208

 Score = 214.6 bits 913,  Expect = 1e-57
 Identities = 141/159 88%, Positives = 150/159 94%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYE ETPSVIPAARLFKSYVLD DKLIPKVAPQAI+SVENV GNGGPGTIKNITF E
Sbjct  2    GVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS +K+VKERVDEVDN NF Y+YTVIEGDVLGDKLEKV HELKIVAAPGGGSI+KISSKF
Sbjct  62   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            HAKGDHE+NAE+MKGAKEMAEKLLRAVE+YLLAH+ EYN
Sbjct  122  HAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 17. Allergen Name: Car b 1.0107 Sequence ID: CAB02213

 Score = 214.1 bits 911,  Expect = 1e-57
 Identities = 142/159 89%, Positives = 149/159 93%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYE ETPSVIPAARLFKSYVLD DKLIPKVAPQAI+SVENV GNGGPGTIKNITF E
Sbjct  2    GVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS +K+VKERVDEVDN NF +SYTVIEGDVLGDKLEKV  ELKIVAAPGGGSILKIS KF
Sbjct  62   GSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELKIVAAPGGGSILKISGKF 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            HAKGDHE+NAEEMKGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  122  HAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 18. Allergen Name: Car b 1 Sequence ID: P38949

 Score = 213.5 bits 908,  Expect = 2e-57
 Identities = 140/159 88%, Positives = 149/159 93%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYE ETPSVIPAARLFKSYVLDGDKLIPKVAPQ I+SVENV GNGGPGTIKNITF E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAE 60
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            G  +K+VKERVDEVDN NF Y+YTVIEGDVLGDKLEKV HELKIVAAPGGGSI+KISSKF
Sbjct  61   GIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            HAKG HE+NAE+MKGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  121  HAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 19. Allergen Name: Car b 1.0108 Sequence ID: CAB02215

 Score = 211.9 bits 901,  Expect = 7e-57
 Identities = 140/159 88%, Positives = 148/159 93%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYE ETPSV+PAARLFKSYVLD DKLIPKVAPQAI+SVENV GNGGPGTIKNITF E
Sbjct  2    GVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS +K+VKERVDEVDN NF +SYTVIEGDVLGDKLEKV  EL IVAAPGGGSILKIS KF
Sbjct  62   GSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGKF 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            HAKGDHE+NAEEMKGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  122  HAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 20. Allergen Name: Car b 1 Sequence ID: P38950

 Score = 208.9 bits 888,  Expect = 5e-56
 Identities = 135/159 84%, Positives = 150/159 94%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYE ET SVIPAARLFK+++LDG+KLIPKV+PQA++SVENVEGNGGPGTIK ITF E
Sbjct  1    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 60
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS  KYVKERV+E+D+TNF Y+YTVIEGDVLGDKLEKV HELKIVAAPGGGSI+KISSKF
Sbjct  61   GSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            HAKG HE+NAEEMKGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 21. Allergen Name: Aln g 1 Sequence ID: P38948

 Score = 190.6 bits 807,  Expect = 2e-50
 Identities = 121/159 76%, Positives = 140/159 88%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYE ETPSVIPAARLFK+++LDGDKL+PKVAP+A++SVEN+EGNGGPGTIK ITF E
Sbjct  1    GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPE 60
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS +KYVKERVDEVD  NF YS++VIEG  +GD LEKVC+E+KIVAAP GGSILKIS+KF
Sbjct  61   GSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKF 120
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KGDHEINAE++K  KE A  LL+AVE+YLLAHS  YN
Sbjct  121  HTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 159

Sequence Alignment: 22. Allergen Name: Aln g 1 Sequence ID: AAB24432

 Score = 190.6 bits 807,  Expect = 2e-50
 Identities = 121/159 76%, Positives = 140/159 88%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYE ETPSVIPAARLFK+++LDGDKL+PKVAP+A++SVEN+EGNGGPGTIK ITF E
Sbjct  2    GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS +KYVKERVDEVD  NF YS++VIEG  +GD LEKVC+E+KIVAAP GGSILKIS+KF
Sbjct  62   GSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKF 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KGDHEINAE++K  KE A  LL+AVE+YLLAHS  YN
Sbjct  122  HTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 160

Sequence Alignment: 23. Allergen Name: Car b 1.0301 Sequence ID: CAB02216

 Score = 190.4 bits 806,  Expect = 2e-50
 Identities = 120/159 75%, Positives = 140/159 88%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYE ET SVIPAARLFK+++LDG+KLIPKV+PQA++SVENVEGNGGPGTIK ITF E
Sbjct  2    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS  KYVKERV+EVD+TNF YSYTVIEG  +GDK+EK+C+E+KIVAAP GGSILKI+SK+
Sbjct  62   GSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSKY 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KGDHE+ AE +KG KE  E LL+ VE YLLAH+AEYN
Sbjct  122  HTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 24. Allergen Name: Bet v 1.0205 Sequence ID: Q39427

 Score = 189.7 bits 803,  Expect = 3e-50
 Identities = 120/159 75%, Positives = 137/159 86%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYE ET SVIPAARLFK+++LDGD LIPKVAPQAI+SVEN+EGNGGPGTIK ITF E
Sbjct  2    GVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS +KYVKERVDEVD+ NF YSY++IEG  LGD LEK+C+E+K+VA P GGSILKIS+K+
Sbjct  62   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNKY 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KGDHE+ AE MK  KE AE LLRAVE+YLLAHS  YN
Sbjct  122  HTKGDHEMKAEHMKAIKEKAEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 25. Allergen Name: Cor a 1.0201 Sequence ID: CAA96548

 Score = 189.5 bits 802,  Expect = 4e-50
 Identities = 119/159 74%, Positives = 140/159 88%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYE E+ SVIPAARLFK+++LDG+ LIPKVAPQA++SVENVEGNGGPGTIK ITF E
Sbjct  2    GVFNYETESTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFSE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS +KYVKERV+EVD+TNF YSYTVIEG  +GDK+EK+C+E+KIVAAP GGSILKIS+K+
Sbjct  62   GSPFKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKISNKY 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KGDHE++AE +KG KE  E L+RAVE YLLAHS  YN
Sbjct  122  HTKGDHEVDAEHIKGGKEKVEGLFRAVEAYLLAHSDAYN 160

Sequence Alignment: 26. Allergen Name: Car b 1.0302 Sequence ID: CAB02217

 Score = 189.5 bits 802,  Expect = 4e-50
 Identities = 120/159 75%, Positives = 139/159 87%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYE ET SVIPAARLFK+++LDG+ LIPKVAPQA++SVENVEGNGGPGTIK ITF E
Sbjct  2    GVFNYEAETTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFSE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS  KYVKERV+EVD+TNF YSYTVIEG  +GDK+EK+C+E+KIVAAP GGSILKI+SK+
Sbjct  62   GSPVKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKITSKY 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KGDHE+ AE +KG KE  E LL+ VE YLLAH+AEYN
Sbjct  122  HTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 27. Allergen Name: Bet v 1.0204 Sequence ID: P43186

 Score = 188.8 bits 799,  Expect = 6e-50
 Identities = 120/159 75%, Positives = 136/159 85%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYE ET SVIPAARLFK+++LDGD LIPKVAPQAI+SVEN+EGNGGPGTIK ITF E
Sbjct  2    GVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS +KYVKERVDEVD+ NF YSY++IEG  LGD LEK+C+E+KIVA P GGSILKIS+K+
Sbjct  62   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKY 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KGDHE+ AE MK  KE  E LLRAVE+YLLAHS  YN
Sbjct  122  HTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 28. Allergen Name: Bet v 1.0206 Sequence ID: CAA04828.1

 Score = 188.1 bits 796,  Expect = 1e-49
 Identities = 119/159 74%, Positives = 136/159 85%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYE ET SVIPAARLFK+++LDGD LIPKVAPQAI+SVEN+EGNGGPGTIK ITF E
Sbjct  1    GVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 60
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS +KYVKERVDEVD+ NF YSY++IEG  LGD LEK+C+E+K+VA P GGSILKIS+K+
Sbjct  61   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNKY 120
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KGDHE+ AE MK  KE  E LLRAVE+YLLAHS  YN
Sbjct  121  HTKGDHEMKAEHMKAIKEKGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 29. Allergen Name: Bet v 1.0201 Sequence ID: CAA54421

 Score = 187.7 bits 794,  Expect = 1e-49
 Identities = 119/159 74%, Positives = 136/159 85%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYE ET SVIPAARLFK+++L+GD LIPKVAPQAI+SVEN+EGNGGPGTIK ITF E
Sbjct  2    GVFNYETETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS +KYVKERVDEVD+ NF YSY++IEG  LGD LEK+C+E+KIVA P GGSILKIS+K+
Sbjct  62   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKY 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KGDHE+ AE MK  KE  E LLRAVE+YLLAHS  YN
Sbjct  122  HTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 30. Allergen Name: Bet v 1.0203 Sequence ID: P43184

 Score = 187.2 bits 792,  Expect = 2e-49
 Identities = 119/159 74%, Positives = 136/159 85%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYE ET SVIPAARLFK+++L+GD LIPKVAPQAI+SVEN+EGNGGPGTIK ITF E
Sbjct  2    GVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS +KYVKERVDEVD+ NF YSY++IEG  LGD LEK+C+E+KIVA P GGSILKIS+K+
Sbjct  62   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKY 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KGDHE+ AE MK  KE  E LLRAVE+YLLAHS  YN
Sbjct  122  HTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 31. Allergen Name: Bet v 1.0202 Sequence ID: CAA54481

 Score = 185.2 bits 783,  Expect = 7e-49
 Identities = 118/159 74%, Positives = 136/159 85%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYE ET SVIPAARLFK+++L+GD LIPKVAPQAI+SVEN+EGNGGPGTIK ITF E
Sbjct  2    GVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS +KYVKERVDEVD+ NF YSY++IEG  LGD LEK+C+E+KIVA P GGSILKIS+K+
Sbjct  62   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKY 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KGD+E+ AE MK  KE  E LLRAVE+YLLAHS  YN
Sbjct  122  HTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 32. Allergen Name: Bet v 1.0113 Sequence ID: CAB02160

 Score = 184.5 bits 780,  Expect = 1e-48
 Identities = 115/159 72%, Positives = 138/159 86%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYE ET SVIPAARLFK+++LDGD L+PKVAPQAI+SVEN+EGNGGPGTIK I+F E
Sbjct  2    GVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            G  +KYVK+RVDEVD+TNF Y+Y+VIEG  +GD LEK+ +E+KIVA P GGSILKIS+K+
Sbjct  62   GFPFKYVKDRVDEVDHTNFKYNYSVIEGGPMGDTLEKISNEIKIVATPDGGSILKISNKY 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KGDHE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  122  HTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 33. Allergen Name: Bet v 1.0112 Sequence ID: CAB02159

 Score = 183.4 bits 775,  Expect = 3e-48
 Identities = 115/159 72%, Positives = 137/159 86%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAI+SVEN+EGNGGPGTIK I+F E
Sbjct  2    GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            G  +KYVK+RVDEVD+TNF Y+Y+VIEG  +GD LEK+ +E+KIVA P GGSILKIS+K+
Sbjct  62   GLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKY 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KGDHE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  122  HTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 34. Allergen Name: Bet v 1.0104 Sequence ID: CAA54484

 Score = 183.4 bits 775,  Expect = 3e-48
 Identities = 114/159 71%, Positives = 137/159 86%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYE+E  SVIPAARLFK+++LDGD L PKVAPQAI+SVEN+EGNGGPGTIK I+F E
Sbjct  2    GVFNYEIEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            G  +KYVK+RVDEVD+TNF YSY+VIEG  +GD LEK+ +E+KIVA P GGSILKI++K+
Sbjct  62   GFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNKY 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KGDHE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  122  HTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 35. Allergen Name: Bet v 1.0101 Sequence ID: CAA33887

 Score = 183.4 bits 775,  Expect = 3e-48
 Identities = 115/159 72%, Positives = 137/159 86%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAI+SVEN+EGNGGPGTIK I+F E
Sbjct  2    GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            G  +KYVK+RVDEVD+TNF Y+Y+VIEG  +GD LEK+ +E+KIVA P GGSILKIS+K+
Sbjct  62   GFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKY 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KGDHE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  122  HTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 36. Allergen Name: Bet v 1.0109 Sequence ID: CAB02156

 Score = 183.1 bits 774,  Expect = 3e-48
 Identities = 115/159 72%, Positives = 137/159 86%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAI+SVEN+EGNGGPGTIK I+F E
Sbjct  2    GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            G  +KYVK+RVDEVD+TNF Y+Y+VIEG  +GD LEK+ +E+KIVA P GGSILKIS+K+
Sbjct  62   GFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGSILKISNKY 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KGDHE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  122  HTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 37. Allergen Name: Bet v 1.0114 Sequence ID: CAB02161

 Score = 182.9 bits 773,  Expect = 4e-48
 Identities = 115/159 72%, Positives = 137/159 86%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAI+SVEN+EGNGGPGTIK I+F E
Sbjct  2    GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            G  +KYVK+RVDEVD+TNF Y+Y+VIEG  +GD LEK+ +E+KIVA P GGSILKIS+K+
Sbjct  62   GFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKY 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KGDHE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  122  HTKGDHEVKAEQVKASKEMRETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 38. Allergen Name: Bet v 1.0106 Sequence ID: CAA54487

 Score = 182.5 bits 771,  Expect = 5e-48
 Identities = 114/159 71%, Positives = 136/159 85%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYE E  SVIPAARLFK+++LDGD L PKVAPQAI+SVEN+EGNGGPGTIK I+F E
Sbjct  2    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            G  +KYVK+RVDEVD+TNF YSY+VIEG  +GD LEK+ +E+KIVA P GGSILKI++K+
Sbjct  62   GFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNKY 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KGDHE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  122  HTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 39. Allergen Name: Bet v 1.0102 Sequence ID: CAA54482

 Score = 181.6 bits 767,  Expect = 9e-48
 Identities = 112/159 70%, Positives = 137/159 86%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYE+ET SVIPAARLFK+++LDGD L+PKVAPQAI+SVEN+EGNGGPGTIK I F E
Sbjct  2    GVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFPE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            G  +KYVK+RVDEVD+TNF Y+Y+VIEG  +GD LEK+ +E+KIVA P GG +LKIS+K+
Sbjct  62   GFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNKY 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KG+HE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  122  HTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 40. Allergen Name: Bet v 1.0103 Sequence ID: CAA54483

 Score = 181.3 bits 766,  Expect = 1e-47
 Identities = 114/159 71%, Positives = 135/159 84%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYE E  SVIPAARLFK+++LDGD L PKVAPQAI+SVEN+EGNGGPGTIK I+F E
Sbjct  2    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            G  +KYVK RVDEVD+TNF YSY+VIEG  +GD LEK+ +E+KIVA P GGSILKI++K+
Sbjct  62   GIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNKY 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KGDHE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  122  HTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 41. Allergen Name: Bet v 1.0116 Sequence ID: CAA04827.1

 Score = 180.9 bits 764,  Expect = 1e-47
 Identities = 113/159 71%, Positives = 135/159 84%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYE E  SVIPAARLFK+++LDGD L PKVAPQAI+SVEN+EGNGGPGTIK I+F E
Sbjct  1    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 60
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            G  +KYVK+RVDEVD+ NF YSY++IEG  +GD LEK+ +E+KIVA P GGSILKIS+K+
Sbjct  61   GIPFKYVKDRVDEVDHANFKYSYSLIEGGPVGDTLEKISNEIKIVATPDGGSILKISNKY 120
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KGDHE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  HTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 42. Allergen Name: Bet v 1.0118 Sequence ID: CAA07329.1

 Score = 180.7 bits 763,  Expect = 2e-47
 Identities = 114/159 71%, Positives = 135/159 84%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYE ET SVIPAARLFK+++LDGD LIPKVAPQAI+SVEN+EGNGGPGTIK I+F E
Sbjct  2    GVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            G  +KYVK+RVDEVD+TNF Y+Y+VIEG  +GD LEK+ +E+K+VA P GGSIL+IS+K+
Sbjct  62   GFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNKY 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KGDHE+ AE MK  KE  E LLRAVE+YLLAHS  YN
Sbjct  122  HTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 43. Allergen Name: Bet v 1.0117 Sequence ID: CAA07323.1

 Score = 180.4 bits 762,  Expect = 2e-47
 Identities = 112/159 70%, Positives = 136/159 85%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAI+SVEN+EGNGGPGTIK I+F E
Sbjct  2    GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            G  +KYVK+RVDEVD+TNF Y+Y+VIEG  +GD LEK+ +E+KIVA P GG +LKIS+K+
Sbjct  62   GFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNKY 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KG+HE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  122  HTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 44. Allergen Name: Bet v 1.0107 Sequence ID: CAA54489

 Score = 180.4 bits 762,  Expect = 2e-47
 Identities = 111/159 69%, Positives = 136/159 85%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYE E  SVIPAAR+FK+++LDGDKL+PKVAPQAI+SVEN+EGNGGPGTIK I F E
Sbjct  2    GVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGGPGTIKKINFPE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            G  +KYVK+RVDEVD+TNF Y+Y+VIEG  +GD LEK+ +E+KIVA P GG +LKIS+K+
Sbjct  62   GFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNKY 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KG+HE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  122  HTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 45. Allergen Name: Bet v 1.0108 Sequence ID: CAB02155

 Score = 180.2 bits 761,  Expect = 2e-47
 Identities = 112/159 70%, Positives = 136/159 85%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAI+SVEN+EGNGGPGTIK I+F E
Sbjct  2    GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            G  +KYVK+RVDEVD+TNF Y+Y+VIEG  +GD LEK+ +E+KIVA P GG +LKIS+K+
Sbjct  62   GFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNKY 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KG+HE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  122  HTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 46. Allergen Name: Bet v 1.0110 Sequence ID: CAB02157

 Score = 180.0 bits 760,  Expect = 3e-47
 Identities = 112/159 70%, Positives = 136/159 85%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAI+SVEN+EGNGGPGTIK I+F E
Sbjct  2    GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            G  +KYVK+RVDEVD+TNF Y+Y+VIEG  +GD LEK+ +E+KIVA P GG +LKIS+K+
Sbjct  62   GFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNKY 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KG+HE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  122  HTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 47. Allergen Name: Bet v 1.0105 Sequence ID: CAA54485

 Score = 179.1 bits 756,  Expect = 5e-47
 Identities = 112/159 70%, Positives = 136/159 85%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYE ET SVIPAARLFK+++L+GD LIPKVAPQAI+SVEN+EGNGGPGTIK I F E
Sbjct  2    GVFNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKINFPE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            G  +KYVK+RVDEVD+TNF Y+Y+VIEG  +GD LEK+ +E+KIVA P GG +LKIS+K+
Sbjct  62   GFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNKY 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KG+HE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  122  HTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 48. Allergen Name: Bet v 1.0111 Sequence ID: CAB02158

 Score = 178.4 bits 753,  Expect = 8e-47
 Identities = 111/159 69%, Positives = 135/159 84%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAI+SVEN+EGNGGPGTIK I+F  
Sbjct  2    GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPG 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            G  +KYVK+RVDEVD+TNF Y+Y+VIEG  +GD LEK+ +E+KIVA P GG +LKIS+K+
Sbjct  62   GLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNKY 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KG+HE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  122  HTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 49. Allergen Name: Bet v 1.0115 Sequence ID: CAA96547

 Score = 178.4 bits 753,  Expect = 8e-47
 Identities = 113/159 71%, Positives = 134/159 84%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAI+SVEN+EGNGGPGTIK I+F E
Sbjct  2    GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            G  +KYVK+RVDEV + NF YSY+VIEG  +GD LEK+ +E+KIVA P G SILKIS+K+
Sbjct  62   GFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNKY 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KGDHE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  122  HTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 50. Allergen Name: Bet v 1.0207 Sequence ID: ACF75030.1

 Score = 177.3 bits 748,  Expect = 2e-46
 Identities = 112/150 74%, Positives = 129/150 86%, Gaps = 0/150 0%
Query  3    FNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGEGS 62
            FNYE ET SVIPAARLFK+++L+GD LIPKVAPQAI+SVEN+EGNGGPGTIK ITF EGS
Sbjct  1    FNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPEGS 60
Query  63   RYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKFHA 122
             +KYVKERVDEVD+ NF YSY++IEG  LGD LEK+C+E+KIVA P GGSILKIS+K+H 
Sbjct  61   PFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHT 120
Query  123  KGDHEINAEEMKGAKEMAEKLLRAVETYLL 152
            KGDHE+ AE MK  KE  E LLRAVE+YLL
Sbjct  121  KGDHEMKAEHMKAIKEKGEALLRAVESYLL 150

Sequence Alignment: 51. Allergen Name: Bet v 1.0119 Sequence ID: ABC41615.1

 Score = 168.9 bits 711,  Expect = 5e-44
 Identities = 105/150 70%, Positives = 128/150 85%, Gaps = 0/150 0%
Query  3    FNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGEGS 62
            FNYE ET SVIPAARLFK+++LDGD L PKVAPQAI+SV+N+EGNGGPGTIK I F EG 
Sbjct  1    FNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVQNIEGNGGPGTIKKINFPEGF 60
Query  63   RYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKFHA 122
             +KYVK+RVDEVD+TNF Y+Y+VIEG  +GD LEK+ +E+KIVA P GG ILKIS+K+H 
Sbjct  61   PFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCILKISNKYHT 120
Query  123  KGDHEINAEEMKGAKEMAEKLLRAVETYLL 152
            KG+HE+ AE++K +KEM E LLRAVE+YLL
Sbjct  121  KGNHEVKAEQVKASKEMGETLLRAVESYLL 150

Sequence Alignment: 52. Allergen Name: Bet v 1.0301 Sequence ID: CAA54696.1

 Score = 166.0 bits 698,  Expect = 5e-43
 Identities = 104/159 65%, Positives = 125/159 78%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYE E  SVI  ARLFKS+VLD D LIPKVAP+ ++S EN+EGNGGPGTIK ITF E
Sbjct  2    GVFNYEDEATSVIAPARLFKSFVLDADNLIPKVAPENVSSAENIEGNGGPGTIKKITFPE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS +KY+K RVDE+D+ NF Y Y++IEG  LGD LEK+ +E+KIVAAPGGGSILKI+SK+
Sbjct  62   GSHFKYMKHRVDEIDHANFKYCYSIIEGGPLGDTLEKISYEIKIVAAPGGGSILKITSKY 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KGD  +N EE+K  KE    L++AVE YL+AH   YN
Sbjct  122  HTKGDISLNEEEIKAGKEKGAGLFKAVENYLVAHPNAYN 160

Sequence Alignment: 53. Allergen Name: Cor a 1.0301 Sequence ID: CAA96549

 Score = 163.9 bits 689,  Expect = 2e-42
 Identities = 103/159 64%, Positives = 125/159 78%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYE ET SVIP ARLFK +VLD D LIPKVAP+AI S+E +EGNGGPGTIK I F E
Sbjct  2    GVFNYETETTSVIPPARLFKRFVLDSDNLIPKVAPKAIKSIEIIEGNGGPGTIKKICFDE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS + Y+K++V+E+D  NF+Y Y+VIEGD L DKLEK+ +E+KIVA+P GGSILK  SK+
Sbjct  62   GSPFNYIKQKVEEIDQANFSYRYSVIEGDALSDKLEKINYEIKIVASPHGGSILKSISKY 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H  GDHE+  E++K  KE A  L++AVE YLLAHS  YN
Sbjct  122  HTIGDHELKDEQIKAGKEKASGLFKAVEGYLLAHSDAYN 160

Sequence Alignment: 54. Allergen Name: Mal d 1.0401 Sequence ID: CAA96535

 Score = 163.0 bits 685,  Expect = 4e-42
 Identities = 101/159 63%, Positives = 126/159 79%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYE ET SVIPA RLFK+++LDGD LIPK+APQAI S E +EG+GG GTIK +TFGE
Sbjct  2    GVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFGE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS+Y YVK+RV+ +D  NFTYSY++IEGD L DKLEK+ +E K++A+P GGSI+K +S +
Sbjct  62   GSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSHY 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            HAKGD EI  E +K  KE A  L++ +E YLLAHS  YN
Sbjct  122  HAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 55. Allergen Name: Jug r 5.0101 Sequence ID: APD76154

 Score = 162.3 bits 682,  Expect = 6e-42
 Identities = 103/159 64%, Positives = 122/159 76%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVF YE E+ SVIP ARLFK++VLD D LIPKV PQA+ S E +EGNGGPGTIK I FGE
Sbjct  2    GVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFGE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS+YKYVK R D +D  NFTY+Y+VIEGD L DK+EK+ +E KIVA+  GGSILK  S +
Sbjct  62   GSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISHY 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H+KGDHEI  E++K  KE A  L++AVE YLLAH   YN
Sbjct  122  HSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160

Sequence Alignment: 56. Allergen Name: Mal d 1.0402 Sequence ID: CAA96536

 Score = 160.1 bits 672,  Expect = 3e-41
 Identities = 99/159 62%, Positives = 125/159 78%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYE E  SVIPA RLFK+++LDGD LIPK+APQAI S + +EG+GG GTIK +TFGE
Sbjct  2    GVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTKIIEGDGGVGTIKKVTFGE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS+Y YVK+RV+ +D  NFTYSY++IEGD L DKLEK+ +E K++A+P GGSI+K +S +
Sbjct  62   GSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTNSHY 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            HAKGD EI  E +K  KE A  L++ +E YLLAHS  YN
Sbjct  122  HAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 57. Allergen Name: Fag s 1.0101 Sequence ID: ACJ23864

 Score = 159.6 bits 670,  Expect = 4e-41
 Identities = 99/159 62%, Positives = 127/159 79%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVF YE ET +VI  ARLFK++VLD D LIPKVAPQAI S E +EG+GGPGTIK ITFGE
Sbjct  2    GVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFGE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS++ YVK R+DE+DN NFTY+ T+IEGD + + LEK+ +E+K+VA+P GGSILK +SK+
Sbjct  62   GSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSKY 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KGDHEI  +++K  KE A  +++AVE YLLA+ A Y+
Sbjct  122  HTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160

Sequence Alignment: 58. Allergen Name: Cas s 1 Sequence ID: CAD10374

 Score = 159.4 bits 669,  Expect = 4e-41
 Identities = 100/159 62%, Positives = 125/159 78%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVF +E E  S IP  RLFK++VLD D LIPK+AP+AI S E +EGNGGPGTIK ITFGE
Sbjct  2    GVFTHENEITSAIPPGRLFKAFVLDADNLIPKLAPHAIKSAEIIEGNGGPGTIKKITFGE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS++KYVK R+DE+D  NFTY Y+VIEGDV+ + LEK+ +E+KIVA+P GGSILK +SK+
Sbjct  62   GSQFKYVKHRIDEIDQANFTYCYSVIEGDVVNELLEKISYEIKIVASPDGGSILKNTSKY 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KG++EI  E++   KE A  L++AVE YLLAHS  YN
Sbjct  122  HTKGEQEIKEEKVMAGKEKAAGLFKAVEAYLLAHSDAYN 160

Sequence Alignment: 59. Allergen Name: Mal d 1.0403 Sequence ID: CAA96537

 Score = 159.2 bits 668,  Expect = 5e-41
 Identities = 99/159 62%, Positives = 124/159 77%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYE E  SVIPA RLFK+++LDGD LIPK+APQAI S E +EG+GG GTIK +TFGE
Sbjct  2    GVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFGE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS+Y YVK+RV+ +D  NFTYSY++IEGD L DKLEK+ +E K++A+P GGSI+K +S +
Sbjct  62   GSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSHY 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
             AKGD EI  E +K  KE A  L++ +E YLLAHS  YN
Sbjct  122  RAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 60. Allergen Name: Cor a 1.0401 Sequence ID: AAD48405

 Score = 157.1 bits 659,  Expect = 2e-40
 Identities = 101/158 63%, Positives = 122/158 77%, Gaps = 1/158 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVF YE E  SVIP ARLFKS+VLD D LIPKVAPQ  TS EN+EGNGGPGTIK ITF E
Sbjct  2    GVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFAE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAP-GGGSILKISSK 119
            G+ +KY+K +V+E+D+ NF Y Y++IEG  LG  LEK+ +E+K+ AAP GGGSILKI+SK
Sbjct  62   GNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITSK 121
Query  120  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 158
            +H KG+  IN EE+K  KE A  L++AVE YLLAH   Y
Sbjct  122  YHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 61. Allergen Name: Cor a 1.0404 Sequence ID: AAG40331

 Score = 157.1 bits 659,  Expect = 2e-40
 Identities = 101/158 63%, Positives = 123/158 77%, Gaps = 1/158 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVF+YE E  SVIP ARLFKS+VLD D LIPKVAPQ  TS EN+EGNGGPGTIK ITF E
Sbjct  2    GVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFAE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAP-GGGSILKISSK 119
            G+ +KY+K +V+E+D+ NF Y Y++IEG  LG  LEK+ +E+K+ AAP GGGSILKI+SK
Sbjct  62   GNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIPYEIKMAAAPHGGGSILKITSK 121
Query  120  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 158
            +H KG+  IN EE+K  KE A  L++AVE YLLAH   Y
Sbjct  122  YHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 62. Allergen Name: Cor a 1.0402 Sequence ID: AAG40329

 Score = 156.2 bits 655,  Expect = 4e-40
 Identities = 100/158 63%, Positives = 122/158 77%, Gaps = 1/158 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVF+YE E  SVIP ARLFKS+VLD D LIPKVAPQ  T  EN+EGNGGPGTIK ITF E
Sbjct  2    GVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFAE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAP-GGGSILKISSK 119
            GS +KY+K +V+E+D+ NF Y Y++IEG  LG  LEK+ +E+K+ AAP GGGSILKI+SK
Sbjct  62   GSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITSK 121
Query  120  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 158
            +H KG+  I+ EE+K  KE A  L++AVE YLLAH   Y
Sbjct  122  YHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 63. Allergen Name: Cor a 1.0403 Sequence ID: AAG40330

 Score = 155.5 bits 652,  Expect = 6e-40
 Identities = 100/158 63%, Positives = 121/158 76%, Gaps = 1/158 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVF YE E  SVIP ARLFKS+VLD D LIPKVAPQ  T  EN+EGNGGPGTIK ITF E
Sbjct  2    GVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFAE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAP-GGGSILKISSK 119
            GS +KY+K +V+E+D+ NF Y Y++IEG  LG  LEK+ +E+K+ AAP GGGSILKI+SK
Sbjct  62   GSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITSK 121
Query  120  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 158
            +H KG+  I+ EE+K  KE A  L++AVE YLLAH   Y
Sbjct  122  YHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 64. Allergen Name: Que a 1.0301 Sequence ID: ABZ81046

 Score = 151.0 bits 632,  Expect = 1e-38
 Identities = 96/158 60%, Positives = 119/158 75%, Gaps = 0/158 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVF YE E  SVIP ARLFK++VLD D LIPKV PQA+ S E +EGNGGPGTIK ITFGE
Sbjct  2    GVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFGE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS  K+ K R+D +D  NFTYS++VIEGD L DKLE V  E KIVA+P GGSI+K +SK+
Sbjct  62   GSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSKY 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 158
            + KGD ++  E ++G KE A ++++AVE YL+AH   Y
Sbjct  122  QTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159

Sequence Alignment: 65. Allergen Name: Pru p 1.0101 Sequence ID: Q2I6V8

 Score = 150.6 bits 630,  Expect = 2e-38
 Identities = 93/159 58%, Positives = 116/159 72%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVF YE E  S IP  RLFK++VLD D L+PK+APQAI   E +EG+GGPGTIK ITFGE
Sbjct  2    GVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFGE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS+Y YVK ++D +D  N +YSYT+IEGD LGD LEK+ +E K+VA+P GGSI+K +S +
Sbjct  62   GSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSHY 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KGD EI  E +K  KE A  L++ +ETYL  H   YN
Sbjct  122  HTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 66. Allergen Name: Pru av 1 Sequence ID: O24248

 Score = 150.1 bits 628,  Expect = 3e-38
 Identities = 92/159 57%, Positives = 117/159 73%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVF YE E  S IP  RLFK++VLD D L+PK+APQAI   E +EG+GGPGTIK ITFGE
Sbjct  2    GVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFGE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS+Y YVK ++D +D  N++YSYT+IEGD LGD LEK+ +E K+VA+P GGSI+K +S +
Sbjct  62   GSQYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKISYETKLVASPSGGSIIKSTSHY 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KG+ EI  E +K  KE A  L++ +ETYL  H   YN
Sbjct  122  HTKGNVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 67. Allergen Name: Que m 1.0101 Sequence ID: AUH28179

 Score = 145.8 bits 609,  Expect = 5e-37
 Identities = 93/158 58%, Positives = 116/158 73%, Gaps = 0/158 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GV  YE E  SVIP ARLFK++VLD D LIPKV PQA+ S E +EGNGGPGTIK ITFGE
Sbjct  2    GVVAYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFGE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS  K+ K R+D +D  NFT+S++VIEGD L DKLE V  E KIVA+P GGSI+K + K+
Sbjct  62   GSHLKHAKHRIDVIDPENFTFSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTCKY 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 158
            + KGD ++  E ++G KE A  +++AVE YL+AH   Y
Sbjct  122  QTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDGY 159

Sequence Alignment: 68. Allergen Name: Fra a 1 Sequence ID: Q256S7

 Score = 145.8 bits 609,  Expect = 5e-37
 Identities = 90/159 56%, Positives = 116/159 72%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GV+ YE E  S IPA +LFK++VLD D LIPK+APQAI   E +EG+GGPGTIK ITFGE
Sbjct  2    GVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFGE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS Y YVK ++  +D  N TYSY++IEGD L D +EK+ +E K+V+AP GG+I+K +SK+
Sbjct  62   GSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSKY 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KGD EI  E +K  KE A  L++ +E YL  H +EYN
Sbjct  122  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 69. Allergen Name: Fra a 1 Sequence ID: Q3T923

 Score = 145.4 bits 607,  Expect = 7e-37
 Identities = 88/159 55%, Positives = 116/159 72%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GV+ YE E  S IPA +LFK++VLD D LIPK+APQA+   E +EG+GGPGTIK ITFGE
Sbjct  2    GVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFGE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS Y YVK ++  +D  N TYSY++IEGD L D +EK+ +E K+V+AP GG+++K +SK+
Sbjct  62   GSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSKY 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KGD EI  E +K  KE A  L++ +E YL  H +EYN
Sbjct  122  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 70. Allergen Name: Mal d 1.0301 Sequence ID: CAA96534

 Score = 144.9 bits 605,  Expect = 1e-36
 Identities = 91/158 57%, Positives = 114/158 72%, Gaps = 1/158 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVFNYE E  SVIP ARLF ++VLD D LIPK+APQA+ S E +EG+GG GTIK I FGE
Sbjct  2    GVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFGE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS Y YVK R+D VD  NF Y Y+VIEGD + + +EK+ +E K+VA+ G GS++K +S +
Sbjct  62   GSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSHY 120
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H K D EI  E +K  KE A  L++ +E YLLAHS  YN
Sbjct  121  HTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159

Sequence Alignment: 71. Allergen Name: Fra a 1 Sequence ID: Q256S2

 Score = 144.5 bits 603,  Expect = 1e-36
 Identities = 88/159 55%, Positives = 116/159 72%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GV+ YE E  S IPA +LFK++VLD D LIPK+APQA+   E +EG+GGPGTIK ITFGE
Sbjct  2    GVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFGE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS Y YVK ++  +D  N TYSY++IEGD L + +EK+ +E K+V+AP GG+I+K +SK+
Sbjct  62   GSHYGYVKHKIHSIDKVNHTYSYSLIEGDALSENIEKIDYETKLVSAPHGGTIIKTTSKY 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KGD EI  E +K  KE A  L++ +E YL  H +EYN
Sbjct  122  HTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 72. Allergen Name: Pru ar 1 Sequence ID: O50001

 Score = 144.2 bits 602,  Expect = 2e-36
 Identities = 89/159 55%, Positives = 117/159 73%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVF YE E  SVIP  +LFK+++LD D LIPKVAP A+   E +EG+GG GTIK +TFGE
Sbjct  2    GVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFGE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS+Y YVK RVD +D  N++YSYT+IEGD L D +E + +++K+VA+P GGSI+K +S +
Sbjct  62   GSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSHY 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KGD EI  E++K  KE A  L++ VE YLLA+   YN
Sbjct  122  HTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160

Sequence Alignment: 73. Allergen Name: Fra a 1 Sequence ID: Q256S6

 Score = 143.8 bits 600,  Expect = 2e-36
 Identities = 89/159 55%, Positives = 115/159 72%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            G + YE E  S IPA +LFK++VLD D LIPK+APQAI   E +EG+GGPGTIK ITFGE
Sbjct  2    GGYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFGE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS Y YVK ++  +D  N TYSY++IEGD L D +EK+ +E K+V+AP GG+I+K +SK+
Sbjct  62   GSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSKY 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KGD EI  E +K  KE A  L++ +E YL  H +EYN
Sbjct  122  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 74. Allergen Name: Mal d 1.0302 Sequence ID: AAK13027

 Score = 143.1 bits 597,  Expect = 3e-36
 Identities = 90/158 56%, Positives = 112/158 70%, Gaps = 1/158 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVF YE E  SVIP ARLF ++VLD D LIPK+APQA+ S E +EG+GG GTIK I FGE
Sbjct  2    GVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFGE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS Y YVK R+D VD  NF Y Y+VIEGD + + +EK+ +E K+VAA G GS++K +S +
Sbjct  62   GSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSHY 120
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KGD EI  E +K  KE A  L++ +E YLL H   YN
Sbjct  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159

Sequence Alignment: 75. Allergen Name: Mal d 1.0304 Sequence ID: AAO25113

 Score = 142.0 bits 592,  Expect = 8e-36
 Identities = 89/158 56%, Positives = 112/158 70%, Gaps = 1/158 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVF YE E  SVIP ARLF ++VLD D LIPK+APQA+ S E +EG+GG GTIK I FGE
Sbjct  2    GVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFGE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS Y YVK R+D VD  NF Y Y+VIEGD + + +EK+ +E K+VA+ G GS++K +S +
Sbjct  62   GSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSHY 120
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KGD EI  E +K  KE A  L++ +E YLL H   YN
Sbjct  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159

Sequence Alignment: 76. Allergen Name: Fra a 1 Sequence ID: Q256S4

 Score = 141.1 bits 588,  Expect = 1e-35
 Identities = 88/158 55%, Positives = 115/158 72%, Gaps = 1/158 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GV+ YE E  S IPA +LFK++VLD D LIPK+APQA+   E +EG+GGPGTIK ITFGE
Sbjct  2    GVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFGE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS Y YVK ++  +D  N TYSY++IEGD L D +EK+ +E K+V+AP G +I+K +SK+
Sbjct  62   GSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSKY 120
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KGD EI  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159

Sequence Alignment: 77. Allergen Name: Que a 1.0401 Sequence ID: ABZ81047

 Score = 140.2 bits 584,  Expect = 3e-35
 Identities = 92/158 58%, Positives = 113/158 71%, Gaps = 0/158 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVF +E +  SVI  ARLFK+  LD D LI KV PQAI S E +EGNGGPGTIK ITFGE
Sbjct  2    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFGE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS  K+ K R+D +D  NFTYS++VIEGD L DKLE V  E KIVA+P GGSI K +SK+
Sbjct  62   GSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIAKSTSKY 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 158
            + KGD ++  E ++G KE A  +++AVE YL+AH   Y
Sbjct  122  QTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDLY 159

Sequence Alignment: 78. Allergen Name: Pru du 1.0101 Sequence ID: B6CQS9

 Score = 140.2 bits 584,  Expect = 3e-35
 Identities = 84/159 52%, Positives = 117/159 73%, Gaps = 0/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            G+F Y  E+ SVIP  RLFK+ VL+ D LIPK+APQ++ S E VEG+GG GTIK I+FGE
Sbjct  2    GIFTYTDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFGE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS Y YVK ++D +D  NF Y+Y+++EGD L DK+EK+ +E+K+VA+  GGS++K +S +
Sbjct  62   GSHYSYVKHQIDGLDKDNFVYNYSLVEGDALSDKVEKISYEIKLVASADGGSVIKSTSNY 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KGD EI  E++K  KE A  L++ +E YL+A+   YN
Sbjct  122  HTKGDVEIKEEDVKAGKEKATGLFKLIENYLVANPDAYN 160

Sequence Alignment: 79. Allergen Name: Mal d 1.0208 Sequence ID: CAD32318

 Score = 139.9 bits 583,  Expect = 3e-35
 Identities = 90/158 56%, Positives = 114/158 72%, Gaps = 1/158 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GV+ YE E  S IP  RLFK++VLD D LIPK+APQAI   E +EG+GGPGTIK ITFGE
Sbjct  1    GVYTYENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 60
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS+Y YVK ++D VD  N++Y+YT+IEGD L D +EKV +E K+VA+ G GSI+K  S +
Sbjct  61   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISHY 119
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KGD EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  120  HTKGDVEIMEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 158

Sequence Alignment: 80. Allergen Name: Mal d 1.0201 Sequence ID: AAB01362

 Score = 139.9 bits 583,  Expect = 3e-35
 Identities = 89/158 56%, Positives = 114/158 72%, Gaps = 1/158 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E +EG+GGPGTIK ITFGE
Sbjct  2    GVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS+Y YVK ++D VD  N++Y+YT+IEGD L D +EKV +E K+VA+ G GSI+K  S +
Sbjct  62   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISHY 120
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KGD EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 81. Allergen Name: Mal d 1.0202 Sequence ID: AAD26545

 Score = 139.9 bits 583,  Expect = 3e-35
 Identities = 89/158 56%, Positives = 114/158 72%, Gaps = 1/158 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E +EG+GGPGTIK ITFGE
Sbjct  2    GVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS+Y YVK ++D VD  N++Y+YT+IEGD L D +EKV +E K+VA+ G GSI+K  S +
Sbjct  62   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISHY 120
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KGD EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 82. Allergen Name: Mal d 1.0206 Sequence ID: AAD13683

 Score = 139.7 bits 582,  Expect = 4e-35
 Identities = 89/158 56%, Positives = 113/158 71%, Gaps = 1/158 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GV+ +E E  S IP  RLFK +VLD D LIPK+APQAI   E +EG+GGPGTIK ITFGE
Sbjct  2    GVYTFENEYTSEIPPPRLFKGFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS+Y YVK ++D VD  N++Y+YT+IEGD L D +EKV +E K+VA+ G GSI+K  S +
Sbjct  62   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISHY 120
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KGD EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 83. Allergen Name: Mal d 1.0303 Sequence ID: AAK13028

 Score = 139.3 bits 580,  Expect = 5e-35
 Identities = 87/158 55%, Positives = 111/158 70%, Gaps = 1/158 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVF YE E  SVIP ARL+ ++VLD D LIPK+APQA+ S E +EG+GG GTIK I FGE
Sbjct  2    GVFTYEFEFTSVIPPARLYNAFVLDADNLIPKIAPQAVKSTEILEGDGGVGTIKKINFGE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS Y YVK ++D VD  NF Y Y+VIEGD + + +EK+ +E K+VA+ G GS++K  S +
Sbjct  62   GSTYSYVKHKIDGVDKDNFVYQYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSISHY 120
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KGD EI  E +K  KE A  L++ +E YLL H   YN
Sbjct  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHHDAYN 159

Sequence Alignment: 84. Allergen Name: Mal d 1.0204 Sequence ID: AAD26548

 Score = 139.0 bits 579,  Expect = 6e-35
 Identities = 88/158 55%, Positives = 114/158 72%, Gaps = 1/158 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E +EG+GGPGTIK ITFGE
Sbjct  2    GVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS+Y YVK ++D VD  N++Y+YT+IEGD L D +EKV +E K++A+ G GSI+K  S +
Sbjct  62   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLMAS-GSGSIIKSISHY 120
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KGD EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 85. Allergen Name: Mal d 1.0207 Sequence ID: AAK13030

 Score = 138.6 bits 577,  Expect = 8e-35
 Identities = 88/158 55%, Positives = 113/158 71%, Gaps = 1/158 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E +EG+GGPGT K ITFGE
Sbjct  2    GVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTTKKITFGE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS+Y YVK ++D VD  N++Y+YT+IEGD L D +EKV +E K+VA+ G GSI+K  S +
Sbjct  62   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISHY 120
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KGD EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 86. Allergen Name: Mal d 1.0103 Sequence ID: AAD26546

 Score = 138.6 bits 577,  Expect = 8e-35
 Identities = 87/158 55%, Positives = 113/158 71%, Gaps = 1/158 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GV+ +E E  S IP +RLFK++VLD D LIPK+APQAI   E +EGNGGPGTIK ITFGE
Sbjct  2    GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS+Y YVK R+D +D  +++YSYT+IEGD L D +EK+ +E K+VA  G GS +K  S +
Sbjct  62   GSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISHY 120
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KG+ EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 87. Allergen Name: Mal d 1.0203 Sequence ID: AAD26547

 Score = 138.6 bits 577,  Expect = 8e-35
 Identities = 88/158 55%, Positives = 114/158 72%, Gaps = 1/158 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E +EG+GGPGTIK ITFGE
Sbjct  2    GVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS+Y YVK ++D VD  N++Y+YT+IEGD L D +EKV +E K+VA+ G GSI+K  S +
Sbjct  62   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISHY 120
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KGD EI  E +K  KE A  L++ +E++L  H   YN
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESHLKGHPDAYN 159

Sequence Alignment: 88. Allergen Name: Mal d 1.0108 Sequence ID: AAD29671

 Score = 138.1 bits 575,  Expect = 1e-34
 Identities = 87/158 55%, Positives = 113/158 71%, Gaps = 1/158 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GV+ +E E  S IP +RLFK++VLD D LIPK+APQAI   E +EGNGGPGTIK ITFGE
Sbjct  2    GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS+Y YVK R+D +D  +++YSYT+IEGD L D +EK+ +E K+VA  G GS +K  S +
Sbjct  62   GSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISHY 120
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KG+ EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 89. Allergen Name: Mal d 1.0205 Sequence ID: AAD26558

 Score = 138.1 bits 575,  Expect = 1e-34
 Identities = 88/158 55%, Positives = 113/158 71%, Gaps = 1/158 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E +EG+GGPGTIK ITFGE
Sbjct  2    GVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS+Y YVK ++D VD  N++Y+YT+IEGD L D +EKV +E K+VA+ G GSI+K  S +
Sbjct  62   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISHY 120
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KGD EI  E +   KE A  L++ +E+YL  H   YN
Sbjct  121  HTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 90. Allergen Name: Mal d 1.0104 Sequence ID: AAD26552

 Score = 137.7 bits 573,  Expect = 1e-34
 Identities = 87/158 55%, Positives = 112/158 70%, Gaps = 1/158 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E +EGNGGPGTIK ITFGE
Sbjct  2    GVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS+Y YVK R+D +D  +++YSYT+IEGD L D +EK+ +E K+VA  G GS +K  S +
Sbjct  62   GSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISHY 120
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KG+ EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 91. Allergen Name: Pyr c 1 Sequence ID: O65200

 Score = 137.4 bits 572,  Expect = 2e-34
 Identities = 87/158 55%, Positives = 113/158 71%, Gaps = 1/158 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            G++ +E E  S IP  RLFK++VLD D LIPK+APQAI   E +EGNGGPGTIK ITFGE
Sbjct  2    GLYTFENEFTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGNGGPGTIKKITFGE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS+Y YVK RVD +D  +++Y+YT+IEGD L D +EK+ +E K+VA+ G GS +K  S +
Sbjct  62   GSQYGYVKHRVDSIDEASYSYAYTLIEGDALTDTIEKISYEAKLVAS-GSGSTIKSISHY 120
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KGD EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  121  HTKGDIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 92. Allergen Name: Can s 5.0101 Sequence ID: AFN42528

 Score = 137.4 bits 572,  Expect = 2e-34
 Identities = 83/159 52%, Positives = 119/159 74%, Gaps = 1/159 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVF YE E  S I  ARLFK++VLDGD L+PK+APQA+  VE +EGNGG GTIK ITFG+
Sbjct  2    GVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGGVGTIKKITFGQ 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVL-GDKLEKVCHELKIVAAPGGGSILKISSK 119
            G  +KYVK +++ +D  ++TYSY++IEGD L G++LEK+ HE K+VA+  GG+++K  SK
Sbjct  62   GVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKITHESKLVASGDGGNVIKTVSK 121
Query  120  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            +++ GD ++N E++K  ++ A ++L+ VE YL  H   YN
Sbjct  122  YYSAGDAQVNEEKVKEGEKQATQMLKTVEAYLKDHPEAYN 161

Sequence Alignment: 93. Allergen Name: Mal d 1.0101 Sequence ID: CAA58646

 Score = 137.2 bits 571,  Expect = 2e-34
 Identities = 87/158 55%, Positives = 113/158 71%, Gaps = 1/158 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GV+ +E E  S IP +RLFK++VLD D LIPK+APQAI   E +EGNGGPGTIK ITFGE
Sbjct  2    GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS+Y YVK R+D +D  +++YSYT+IEGD L D +EK+ +E K+VA  G GS +K  S +
Sbjct  62   GSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISHY 120
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KG+ EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  121  HTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 94. Allergen Name: Mal d 1.0107 Sequence ID: AAD26555

 Score = 137.0 bits 570,  Expect = 2e-34
 Identities = 86/158 54%, Positives = 112/158 70%, Gaps = 1/158 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GV+ +E E  S IP +RLFK++VLD D LIPK+APQAI   E +EGNGGPGTIK ITFGE
Sbjct  2    GVYTFENEYTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS+Y YVK R+D +D  +++YSYT+IEGD L D +EK+ +E K+VA  G GS +K  S +
Sbjct  62   GSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISHY 120
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KG+ EI  E +K  K  A  L++ +E+YL  H   YN
Sbjct  121  HTKGNIEIKEEHVKAGKAKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 95. Allergen Name: Mal d 1.0105 Sequence ID: AAD26553

 Score = 136.8 bits 569,  Expect = 3e-34
 Identities = 87/158 55%, Positives = 112/158 70%, Gaps = 1/158 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GV  +E E  S IP +RLFK++VLD D LIPK+APQAI   E +EGNGGPGTIK ITFGE
Sbjct  2    GVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS+Y YVK R+D +D  +++YSYT+IEGD L D +EK+ +E K+VA  G GS +K  S +
Sbjct  62   GSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISHY 120
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KG+ EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 96. Allergen Name: Mal d 1.0106 Sequence ID: AAD26554

 Score = 136.8 bits 569,  Expect = 3e-34
 Identities = 86/158 54%, Positives = 112/158 70%, Gaps = 1/158 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GV+ +E E  S IP +RLFK++VLD D LIPK+APQAI   E +EGNGGPGTIK ITFGE
Sbjct  2    GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS+Y YVK R+D +D  +++YSYT+IEGD L D +E + +E K+VA  G GS +K  S +
Sbjct  62   GSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIENISYETKLVAC-GSGSTIKSISHY 120
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KG+ EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 97. Allergen Name: Mal d 1.0109 Sequence ID: AAK13029

 Score = 135.9 bits 565,  Expect = 5e-34
 Identities = 87/158 55%, Positives = 112/158 70%, Gaps = 1/158 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GV  +E E  S IP +RLFK++VLD D LIPK+APQAI   E +EGNGGPGTIK ITFGE
Sbjct  2    GVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS+Y YVK R+D +D  +++YSYT+IEGD L D +EK+ +E K+VA  G GS +K  S +
Sbjct  62   GSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISHY 120
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KG+ EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  121  HTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 98. Allergen Name: Mal d 1.0102 Sequence ID: CAA88833

 Score = 135.4 bits 563,  Expect = 7e-34
 Identities = 85/158 53%, Positives = 112/158 70%, Gaps = 1/158 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GV+ +E E  S IP +RLFK++VLD D LIPK+APQAI   E +EGNGGPGTIK ITFGE
Sbjct  2    GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS+Y YVK R+D +D  +++YSYT+IEGD L D +EK+ +E K+VA  G G+ +K  S +
Sbjct  62   GSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGATIKSISHY 120
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            H KG+ EI  E +K  KE    L++ +E+YL  H   YN
Sbjct  121  HPKGNIEIKEEHVKVGKEKGHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 99. Allergen Name: Que i 1.0101 Sequence ID: QGS84240

 Score = 134.3 bits 558,  Expect = 2e-33
 Identities = 87/157 55%, Positives = 112/157 71%, Gaps = 1/157 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GV  +E +  SVIP ARLFK++VLD D LIPKV PQAI S+E +EGNGGPGTIK ITFGE
Sbjct  2    GVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFGE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
             S++KY K R+D +D  N TYS++VIEGD L D +  V  E+K VA+P GGSI K ++K+
Sbjct  62   ASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVSTEIKFVASPDGGSIKKSTTKY 120
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 158
            + KGD ++  E+++   E    L +AVE YLLAH   Y
Sbjct  121  QTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158

Sequence Alignment: 100. Allergen Name: Act c 8.0101 Sequence ID: CAM31908

 Score = 133.1 bits 553,  Expect = 3e-33
 Identities = 81/154 52%, Positives = 116/154 75%, Gaps = 0/154 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GV  Y++E PS +P  +L+K+++LDGD L+PKV P+AI  V+ +EG+G  GTIK +TFGE
Sbjct  2    GVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFGE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS +K VK+RVD +D  N+TYSYT+IEGDVL +K+E + + +KIVA P GGSI K  S +
Sbjct  62   GSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSIY 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 154
              KGD +++ EE+K  KE A ++++A+E YLLA+
Sbjct  122  TTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLAN 155

Sequence Alignment: 101. Allergen Name: Que a 1.0201 Sequence ID: ABZ81045

 Score = 132.5 bits 550,  Expect = 5e-33
 Identities = 87/157 55%, Positives = 112/157 71%, Gaps = 1/157 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVF +E +  SVI  ARLFK+  LD D LI KV PQAI S E +EGNGGPGTIK ITFGE
Sbjct  2    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFGE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
             S++KY K R+D +D  N TYS++VIEGD L   +E V  E+K VA+P GGSI+K ++K+
Sbjct  62   ASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTKY 120
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 158
            + KGD ++  E+++ A E A  LL+AVE YL+AH   Y
Sbjct  121  QTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158

Sequence Alignment: 102. Allergen Name: Que ac 1.0101 Sequence ID: QOL10866

 Score = 132.5 bits 550,  Expect = 5e-33
 Identities = 83/158 52%, Positives = 113/158 71%, Gaps = 1/158 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GV+NYE +  SVIP ARLFK++VLD D LI KV P+A+ S E +EGNGGPGTIK  TFGE
Sbjct  2    GVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFGE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
             S+ KY K R+D +D  N +YS++VIEG+ L D +  +  E+K VA+P GGSI+K ++K+
Sbjct  62   ASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTKY 120
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            + KG  ++  E+++ A E    L++AVE YLLAH   YN
Sbjct  121  QTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159

Sequence Alignment: 103. Allergen Name: Rub i 1.0101 Sequence ID: Q0Z8U9

 Score = 122.4 bits 505,  Expect = 5e-30
 Identities = 73/134 54%, Positives = 102/134 76%, Gaps = 1/134 0%
Query  11   SVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGEGSRYKYVKER 70
            SVIP  +LFK++VLD D LIPK+APQA+ SVE +EG+GG GT+K I +GEG+ + YVK +
Sbjct  3    SVIPPPKLFKAFVLDADNLIPKIAPQAVKSVEIIEGDGGVGTVKKIHLGEGTEHSYVKHK 62
Query  71   VDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKFHAKGDHEINA 130
            +D +D  NF YSY++ EGD LGDK+EK+ +E+K+VA+ G GSI+K +S +H KG  EI  
Sbjct  63   IDGLDKVNFVYSYSITEGDALGDKIEKISYEIKLVAS-GRGSIIKTTSHYHCKGGAEIKE 121
Query  131  EEMKGAKEMAEKLLR 145
            E++K  KE A  L++
Sbjct  122  EQVKDGKERAAGLFK 136

Sequence Alignment: 104. Allergen Name: Act d 8.0101 Sequence ID: CAM31909

 Score = 121.4 bits 501,  Expect = 1e-29
 Identities = 78/153 50%, Positives = 107/153 69%, Gaps = 1/153 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            G   Y++E PS I A ++FK++VLDGD +IPK  P+AIT V+ +EG+GG GTIK  TFGE
Sbjct  2    GAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGGVGTIKLTTFGE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS +K VK R+D +D  NFTYSY++IEG  L D +E + + +KIVA P GG I K  S +
Sbjct  62   GSVHKSVKHRIDGLDKENFTYSYSIIEGGAL-DVFESISYHIKIVATPDGGCICKNRSIY 120
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 154
              K D +++ EE+K  KE A  +++ VE YLLA+
Sbjct  121  TPKCDAQVSEEEIKAGKERASGIFKKVEAYLLAN 154

Sequence Alignment: 105. Allergen Name: Gly m 4 Sequence ID: CAA42646

 Score = 114.4 bits 470,  Expect = 2e-27
 Identities = 76/157 48%, Positives = 103/157 65%, Gaps = 2/157 1%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVF +E E  S +  A L+K+ V D D +IPK A  +  SVENVEGNGGPGTIK ITF E
Sbjct  2    GVFTFEDEINSPVAPATLYKALVTDADNVIPK-ALDSFKSVENVEGNGGPGTIKKITFLE 60
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
                K+V  +++ +D  N+ YSY+V+ G  L D  EK+  + K+VA P GGS  K++ K+
Sbjct  61   DGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVKY 120
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
              KGD E N +E+K  K  A+ L++A+E YLLAH  +YN
Sbjct  121  ETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHP-DYN 158

Sequence Alignment: 106. Allergen Name: Sola l 4.0201 Sequence ID: NP_001275580

 Score = 110.7 bits 454,  Expect = 2e-26
 Identities = 68/158 43%, Positives = 103/158 65%, Gaps = 0/158 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GV  +  E+ + I   RLFK  VLD D L+PK+  + + S+E VEG+GG G+IK + F E
Sbjct  2    GVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFVE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            G   KY+K ++  +D+ N+   Y++IEGDVLGDKLE + +++K  AA  GG + K ++++
Sbjct  62   GGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTEY 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 158
            H KGDH ++ EE    K  A  L++A+E YLLA+ + Y
Sbjct  122  HTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159

Sequence Alignment: 107. Allergen Name: Sola l 4.0101 Sequence ID: AHC08073

 Score = 108.5 bits 444,  Expect = 9e-26
 Identities = 64/158 40%, Positives = 101/158 63%, Gaps = 0/158 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GV  Y  E+ + I   RLFK+ VLD D L+PK+  Q + + E +EG+GG G+IK + F E
Sbjct  2    GVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFVE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            G   KY+K ++  +D+ N+   Y++IEGD+LG+KLE + +++K  A   GG + K ++++
Sbjct  62   GGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTEY 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 158
            H KGDH ++ EE    +E    + +AVE YLLA+ + Y
Sbjct  122  HTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159

Sequence Alignment: 108. Allergen Name: Pha v 1 Sequence ID: P25985

 Score = 107.4 bits 439,  Expect = 2e-25
 Identities = 65/154 42%, Positives = 98/154 63%, Gaps = 0/154 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVF +E +T S +  A L+K+   D D + PK  P +  SVE VEGNGGPGTIK I+F E
Sbjct  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
                K+V  +++ +D  N+ YSY+++ G  L +  EK+  + K+   P GGS++K+S  +
Sbjct  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 154
            H+KGD   N +E+K  K  ++ L++AVE YLLA+
Sbjct  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154

Sequence Alignment: 109. Allergen Name: Pha v 1 Sequence ID: CAA43637

 Score = 107.4 bits 439,  Expect = 2e-25
 Identities = 65/154 42%, Positives = 98/154 63%, Gaps = 0/154 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVF +E +T S +  A L+K+   D D + PK  P +  SVE VEGNGGPGTIK I+F E
Sbjct  2    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
                K+V  +++ +D  N+ YSY+++ G  L +  EK+  + K+   P GGS++K+S  +
Sbjct  62   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 154
            H+KGD   N +E+K  K  ++ L++AVE YLLA+
Sbjct  122  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155

Sequence Alignment: 110. Allergen Name: Pha v 1 Sequence ID: CAA43636

 Score = 106.5 bits 435,  Expect = 4e-25
 Identities = 66/152 43%, Positives = 100/152 65%, Gaps = 1/152 0%
Query  2    VFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGEG 61
            VF +E +T S +  A L+K+ V D D ++PK A  +  SVE VEGNGGPGTIK I+F E 
Sbjct  3    VFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFVED 61
Query  62   SRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKFH 121
               K+V  +++E+D  N+ YSY+++ G  L D  EK+  + K+   P GGS++K+S K+H
Sbjct  62   GETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIKYH 121
Query  122  AKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 154
            +KGD   N +E+K  K  ++ L++ +E YLLA+
Sbjct  122  SKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154

Sequence Alignment: 111. Allergen Name: Ara h 8.0101 Sequence ID: AAQ91847

 Score = 106.5 bits 435,  Expect = 4e-25
 Identities = 67/156 42%, Positives = 99/156 63%, Gaps = 2/156 1%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GVF +E E  S +P A+L+ + + D D + PK+    + SVE VEGNGGPGTIK +T  E
Sbjct  2    GVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIVE 59
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
                K++  +V+ +D  N+ Y+Y+V+ G  L    EK+  E K+V  P GGSI K++ K+
Sbjct  60   DGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLKY 119
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 158
            H KGD + + EE+K  K   E L+RA+E Y+LA+  +Y
Sbjct  120  HTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157

Sequence Alignment: 112. Allergen Name: Ara h 8.0201 Sequence ID: EF436550

 Score = 103.1 bits 420,  Expect = 4e-24
 Identities = 66/152 43%, Positives = 100/152 65%, Gaps = 2/152 1%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GV  +E E+ S +P A+LFK+ V+DGD+L PK+ P AI S+E VEGNGGPGT+K +T  E
Sbjct  2    GVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIP-AIQSIEIVEGNGGPGTVKKVTAVE 60
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
              +  YV  ++D +D   +TY YT+  G  + + LEKV  + K+ AA GG  I K+S  F
Sbjct  61   DGKTSYVLHKIDAIDEATYTYDYTISGGTGFQEILEKVSFKTKLEAADGGSKI-KVSVTF 119
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 154
            H KGD  +  E  +  K+ ++ +++A+E Y+L++
Sbjct  120  HTKGDAPLPDEVHQDVKQKSQGIFKAIEGYVLSN 153

Sequence Alignment: 113. Allergen Name: Lyc e 4.0101 Sequence ID: CAA75803

 Score = 98.9 bits 402,  Expect = 8e-23
 Identities = 58/141 41%, Positives = 91/141 64%, Gaps = 1/141 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GV  Y  E+ + I   RLFK+ VLD D L+PK+  Q + + E +EG+GG G+IK + F E
Sbjct  2    GVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFVE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            G   KY+K ++  +D+ N+   Y++IEGD+LG+KLE + +++K  A   GG + K ++++
Sbjct  62   GGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTEY 121
Query  121  HAKGDHEINAEEMK-GAKEMAE 141
            H KGDH ++ EE   G +E  E
Sbjct  122  HTKGDHVVSEEEHNVGRRENHE 143

Sequence Alignment: 114. Allergen Name: Pet c PR10 Sequence ID: CAA67246

 Score = 98.5 bits 400,  Expect = 9e-23
 Identities = 62/154 40%, Positives = 97/154 62%, Gaps = 0/154 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GV   EV   S +PAA+LFK+  LD D L+P+V P AI   E +EG+GG GT+K +T+G+
Sbjct  2    GVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLGD 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
             S YK +K+++D +D   FT+SY++I+GD+L   ++ + + L  V    GG     ++ F
Sbjct  62   ASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAVF 121
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 154
            + KGD  +  E +K A +    +++AVE YLLA+
Sbjct  122  NTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155

Sequence Alignment: 115. Allergen Name: Api g 1.0201 Sequence ID: P92918

 Score = 98.5 bits 400,  Expect = 9e-23
 Identities = 63/153 41%, Positives = 100/153 65%, Gaps = 1/153 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GV    VE PS + A ++++ ++LD D + PKV PQ I SVE +EG+GG GT+K + +GE
Sbjct  2    GVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLGE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
             + Y  +K++VD +D   + Y+YT I GD+L D LE V +E+ +V    GG I+K ++ +
Sbjct  62   ATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNEF-VVVPTDGGCIVKNTTIY 120
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 154
            + KGD  +  +++K A E +   ++AVE YLLA+
Sbjct  121  NTKGDAVLPEDKIKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 116. Allergen Name: Tar o RAP Sequence ID: AAB92255

 Score = 98.1 bits 398,  Expect = 1e-22
 Identities = 59/149 39%, Positives = 94/149 63%, Gaps = 0/149 0%
Query  6    EVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGEGSRYK 65
            E E  S +  + +FK++V+D D + PK  P+   S++ +EG+GG GTIK+IT+ +G  + 
Sbjct  5    EFEITSSLSPSNIFKAFVIDFDTIAPKAEPETYKSIKTIEGDGGVGTIKSITYSDGVPFT 64
Query  66   YVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKFHAKGD 125
              K +VD +D+ NF+ SYT+ EGDVL   +E   H LK + +  GGS+ K S  F  KGD
Sbjct  65   SSKHKVDAIDSNNFSISYTIFEGDVLMGIIESGTHHLKFLPSADGGSVYKHSMVFKCKGD 124
Query  126  HEINAEEMKGAKEMAEKLLRAVETYLLAH 154
             ++  E +   KE  +K ++A+ETY+++H
Sbjct  125  AKLTDENVSLMKEGLKKTFKAIETYVISH 153

Sequence Alignment: 117. Allergen Name: Vig r 1.0101 Sequence ID: Q2VU97

 Score = 97.4 bits 395,  Expect = 2e-22
 Identities = 63/152 41%, Positives = 94/152 61%, Gaps = 1/152 0%
Query  2    VFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGEG 61
            VF ++ +  S +  A L+ +   D D +IPK A  +  SVE VEGNGGPGTIK I+F E 
Sbjct  3    VFTFDDQATSPVAPATLYNALAKDADNIIPK-AVGSFQSVEIVEGNGGPGTIKKISFVED 61
Query  62   SRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKFH 121
               K+V  +++ VD  N+ YSY+++ G  L D  EK+  + KI     GGS++K++  +H
Sbjct  62   GETKFVLHKIESVDEANLGYSYSIVGGVALPDTAEKITIDTKISDGADGGSLIKLTISYH 121
Query  122  AKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 154
             KGD   N +E+K  K  ++ L++AVE YLLA+
Sbjct  122  GKGDAPPNEDELKAGKAKSDALFKAVEAYLLAN 154

Sequence Alignment: 118. Allergen Name: Dau c 1.0201 Sequence ID: AAL76932

 Score = 97.2 bits 394,  Expect = 2e-22
 Identities = 61/153 39%, Positives = 101/153 66%, Gaps = 1/153 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GV   EVE PS + A ++++ ++LD D + PKV PQ I SVE +EG+GG GT++ + +GE
Sbjct  2    GVQKTEVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVRLVHLGE 61
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
             + Y  +K++VD +D   + Y+YT I GD+L + LE V +++ +V    GG I+K ++ +
Sbjct  62   ATEYTTMKQKVDVIDKAGLGYTYTTIGGDILVEGLESVVNQF-VVVPTDGGCIVKNTTIY 120
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 154
            + KGD  +  +++K A E +   ++AVE YLLA+
Sbjct  121  NTKGDAVLPEDKVKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 119. Allergen Name: Api g 1 Sequence ID: P49372

 Score = 92.7 bits 374,  Expect = 5e-21
 Identities = 59/153 38%, Positives = 97/153 63%, Gaps = 1/153 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            GV  + +E  S + A ++F+ +V+D D ++PK AP A  SVE ++G+GGPGT+K IT+ +
Sbjct  2    GVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLPD 60
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            G     +  R+D V+   +T+ Y+VI+GD+L   +E + + + +V    GGSI K ++ F
Sbjct  61   GGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAIF 120
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 154
            H KGD  +  E +K A E    L++A+E YL+A+
Sbjct  121  HTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154

Sequence Alignment: 120. Allergen Name: Dau c 1.0104 Sequence ID: CAB03716

 Score = 90.6 bits 365,  Expect = 2e-20
 Identities = 62/153 40%, Positives = 92/153 60%, Gaps = 1/153 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            G  ++ +E  S + A ++F   VLD D +IPK AP A  SV+ V+G+GG GT++ IT+ E
Sbjct  2    GAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLPE 60
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS    +  R D V+   +TY  TVI+GD+L   +E +   L +V    GGSI K ++ F
Sbjct  61   GSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAIF 120
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 154
            H KGD  +  E +K A E    L++A+E YL+A+
Sbjct  121  HTKGDAVVPEENIKFADEQNTALFKAIEAYLIAN 154

Sequence Alignment: 121. Allergen Name: Dau c 1.0105 Sequence ID: CAB06416

 Score = 90.0 bits 362,  Expect = 3e-20
 Identities = 62/153 40%, Positives = 91/153 59%, Gaps = 1/153 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            G  ++ +E  S + A ++F   VLD D +IPK AP A  SVE V+G+GG GT++ IT+ E
Sbjct  2    GAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVE-VKGDGGAGTVRIITLPE 60
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS    +  R D V+   +TY  TVI+GD+L   +E +   L +V    GGSI K ++ F
Sbjct  61   GSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAIF 120
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 154
            H KGD  +  E +K A      L++A+E YL+A+
Sbjct  121  HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 122. Allergen Name: Dau c 1.0102 Sequence ID: BAA13604

 Score = 89.3 bits 359,  Expect = 5e-20
 Identities = 60/153 39%, Positives = 92/153 60%, Gaps = 1/153 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            G  ++ +E  S + A ++F   VLD D +IPK AP A  SV+ V+G+GG GT++ IT+ E
Sbjct  2    GAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLPE 60
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS    +  R D V+   +TY  TVI+GD+L + +E +   + +V    GGSI K ++ F
Sbjct  61   GSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAIF 120
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 154
            H KGD  +  E +K A      L++A+E YL+A+
Sbjct  121  HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 123. Allergen Name: Dau c 1.0101 Sequence ID: AAB01092

 Score = 88.8 bits 357,  Expect = 8e-20
 Identities = 60/153 39%, Positives = 92/153 60%, Gaps = 1/153 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            G  ++ +E  S + A ++F   VLD D +IPK AP A  SV+ V+G+GG GT++ IT+ E
Sbjct  16   GAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLPE 74
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS    +  R D V+   +TY  TVI+GD+L + +E +   + +V    GGSI K ++ F
Sbjct  75   GSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAIF 134
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 154
            H KGD  +  E +K A      L++A+E YL+A+
Sbjct  135  HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 168

Sequence Alignment: 124. Allergen Name: Dau c 1.0103 Sequence ID: CAB03715

 Score = 86.3 bits 346,  Expect = 4e-19
 Identities = 59/153 38%, Positives = 90/153 58%, Gaps = 1/153 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            G  ++ +E  S + A ++F   VLD D +IPK A  A  SVE V+G+GG GT++ IT+ E
Sbjct  2    GAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLPE 60
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
            GS    +  R D V+   ++Y  TVI+GD+L   +E +   + +V    GGSI K ++ F
Sbjct  61   GSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAIF 120
Query  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 154
            H KGD  +  E +K A      L++A+E YL+A+
Sbjct  121  HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 125. Allergen Name: Fra a 1.0101 Sequence ID: Q5ULZ4

 Score = 65.8 bits 254,  Expect = 4e-13
 Identities = 48/89 53%, Positives = 63/89 70%, Gaps = 17/89 19%
Query  54   KNITFGEGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSI 113
            K ITFGEGS+Y YVK                 +EGD L D LEK+ +E K+V+AP   +I
Sbjct  12   KKITFGEGSQYGYVK-----------------VEGDALSDTLEKIDYETKLVSAPSSSTI 54
Query  114  LKISSKFHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159
            +K +SK+H KGD EI  E +K  KE A  L++ +E YL  H +EYN
Sbjct  55   IKTTSKYHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHPSEYN 100

Sequence Alignment: 126. Allergen Name: Que a 1.0101 Sequence ID: P85126

 Score = 52.8 bits 194,  Expect = 2e-09
 Identities = 31/50 62%, Positives = 35/50 70%, Gaps = 0/50 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGP 50
            GVF +E +  SVI  ARLFK+  LD D LI KV PQAI S E +EGNGGP
Sbjct  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50

Sequence Alignment: 127. Allergen Name: Vig r 6.0101 Sequence ID: Q9ZWP8

 Score = 44.7 bits 162,  Expect = 1e-06
 Identities = 42/146 28%, Positives = 70/146 47%, Gaps = 13/146 8%
Query  3    FNYEVETPSVIPA--ARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
            FN + E    + A  A L K ++     ++PKV P+ +  V+ +EG+GG GTI    F  
Sbjct  5    FNTQTELSVRLEALWAVLSKDFIT----VVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
Query  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
                 Y +E + E D ++      VIEG  L   L      +K+       +++ +   +
Sbjct  61   EVSPSYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISY 120
Query  121  HAKGDHEINAEEMKGAKEMAEKLL---RAVETYLLAHSA 156
                DH+ + EE     + ++  L   R +E YL   SA
Sbjct  121  ----DHDSDIEEKVTPTKTSQSTLMYLRRLERYLSNGSA 155

Sequence Alignment: 128. Allergen Name: Cas s 1 Sequence ID: Q9S8Q4

 Score = 31.3 bits 97,  Expect = 0.002
 Identities = 15/24 62%, Positives = 19/24 79%, Gaps = 0/24 0%
Query  1    GVFNYEVETPSVIPAARLFKSYVL 24
            GVF +E +  SVIP ARLFK++VL
Sbjct  1    GVFTHESQETSVIPPARLFKAFVL 24

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.