The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Input Sequence

IAKVPPGPNITATYGDKWLDAKSTWYGKPTGA
Sequence Info Allergen Name Length Opt Bits Score E Value
Q7M1X6 Ant o 1.0101 32 230 70.0 1.5e-15
Q7M1X8 Dac g 1.0101 34 224 68.3 4.9e-15
CAA10140 Hol l 1 263 230 70.3 9.4e-15
CAA10520 Poa p a 263 230 70.3 9.4e-15
CAA93121 Hol l 1.0102 248 225 68.9 2.4e-14
P43216 Hol l 1 265 225 68.9 2.5e-14
AAA63278 Lol p 1.0102 252 224 68.6 2.9e-14
P14946 Lol p 1 263 224 68.6 3e-14
AAA63279 Lol p 1.0101 263 224 68.6 3e-14
P43213 Phl p 1 263 224 68.6 3e-14
CAB63699 Lol p 1.0103 263 224 68.6 3e-14
Q41260 Pha a 1 269 224 68.6 3.1e-14
CAA81613 Phl p 1.0101 263 216 66.4 1.4e-13
AAF72983 Ory s 1 267 189 58.8 2.8e-11
AAF72991 Ory s 1 267 182 56.8 1.1e-10
ACA23876 Pas n 1.0101 265 171 53.7 9.4e-10
P58738 Zea m 1 269 168 52.9 1.7e-09
AAK96255 Cyn d 1.0201 244 157 49.7 1.3e-08
AAF80379 Cyn d 1.0204 244 157 49.7 1.3e-08
A0A4D6FZ45 Uro m 1.0101 262 157 49.8 1.4e-08
AAL14077 Cyn d 1.0202 262 157 49.8 1.4e-08
AAL14079 Cyn d 1.0203 262 157 49.8 1.4e-08
AAL14078 Cyn d 1 262 157 49.8 1.4e-08
AAF72990 Ory s 1 269 154 48.9 2.6e-08
ABC58726 Sor h 1.0101 239 149 47.5 6.3e-08
O04701 Cyn d 1 246 140 45.0 3.7e-07
Q40638 Ory s 1 263 132 42.7 1.9e-06
QCX36431 Zoy m 1.0101 272 131 42.5 2.3e-06
A0A4D6G2J8 Uro m 1.0201 229 116 38.2 3.8e-05
AAF72987 Ory s 1 275 109 36.3 0.00017
AAB61710 Ory s 1 261 99 33.4 0.0012
AAD10496 Tri a ps93 271 97 32.9 0.0018
AAF72988 Ory s 1 327 94 32.1 0.0038
AAF72985 Ory s 1 286 91 31.2 0.006
AAF72984 Ory s 1 268 89 30.6 0.0084
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ant o 1.0101 Sequence ID: Q7M1X6

 Score = 70.0 bits 230,  Expect = 1e-15
 Identities = 32/32 100%, Positives = 32/32 100%, Gaps = 0/32 0%
Query  1    IAKVPPGPNITATYGDKWLDAKSTWYGKPTGA 32
            IAKVPPGPNITATYGDKWLDAKSTWYGKPTGA
Sbjct  1    IAKVPPGPNITATYGDKWLDAKSTWYGKPTGA 32

Sequence Alignment: 2. Allergen Name: Dac g 1.0101 Sequence ID: Q7M1X8

 Score = 68.3 bits 224,  Expect = 5e-15
 Identities = 31/32 96%, Positives = 31/32 96%, Gaps = 0/32 0%
Query  1    IAKVPPGPNITATYGDKWLDAKSTWYGKPTGA 32
            I KVPPGPNITATYGDKWLDAKSTWYGKPTGA
Sbjct  1    IPKVPPGPNITATYGDKWLDAKSTWYGKPTGA 32

Sequence Alignment: 3. Allergen Name: Hol l 1 Sequence ID: CAA10140

 Score = 70.3 bits 230,  Expect = 9e-15
 Identities = 32/32 100%, Positives = 32/32 100%, Gaps = 0/32 0%
Query  1    IAKVPPGPNITATYGDKWLDAKSTWYGKPTGA 32
            IAKVPPGPNITATYGDKWLDAKSTWYGKPTGA
Sbjct  24   IAKVPPGPNITATYGDKWLDAKSTWYGKPTGA 55

Sequence Alignment: 4. Allergen Name: Poa p a Sequence ID: CAA10520

 Score = 70.3 bits 230,  Expect = 9e-15
 Identities = 32/32 100%, Positives = 32/32 100%, Gaps = 0/32 0%
Query  1    IAKVPPGPNITATYGDKWLDAKSTWYGKPTGA 32
            IAKVPPGPNITATYGDKWLDAKSTWYGKPTGA
Sbjct  24   IAKVPPGPNITATYGDKWLDAKSTWYGKPTGA 55

Sequence Alignment: 5. Allergen Name: Hol l 1.0102 Sequence ID: CAA93121

 Score = 68.9 bits 225,  Expect = 2e-14
 Identities = 31/32 96%, Positives = 32/32 100%, Gaps = 0/32 0%
Query  1    IAKVPPGPNITATYGDKWLDAKSTWYGKPTGA 32
            IAKVPPGPNITATYGD+WLDAKSTWYGKPTGA
Sbjct  9    IAKVPPGPNITATYGDEWLDAKSTWYGKPTGA 40

Sequence Alignment: 6. Allergen Name: Hol l 1 Sequence ID: P43216

 Score = 68.9 bits 225,  Expect = 3e-14
 Identities = 31/32 96%, Positives = 32/32 100%, Gaps = 0/32 0%
Query  1    IAKVPPGPNITATYGDKWLDAKSTWYGKPTGA 32
            IAKVPPGPNITATYGD+WLDAKSTWYGKPTGA
Sbjct  26   IAKVPPGPNITATYGDEWLDAKSTWYGKPTGA 57

Sequence Alignment: 7. Allergen Name: Lol p 1.0102 Sequence ID: AAA63278

 Score = 68.6 bits 224,  Expect = 3e-14
 Identities = 31/32 96%, Positives = 31/32 96%, Gaps = 0/32 0%
Query  1    IAKVPPGPNITATYGDKWLDAKSTWYGKPTGA 32
            IAKVPPGPNITA YGDKWLDAKSTWYGKPTGA
Sbjct  13   IAKVPPGPNITAEYGDKWLDAKSTWYGKPTGA 44

Sequence Alignment: 8. Allergen Name: Lol p 1 Sequence ID: P14946

 Score = 68.6 bits 224,  Expect = 3e-14
 Identities = 31/32 96%, Positives = 31/32 96%, Gaps = 0/32 0%
Query  1    IAKVPPGPNITATYGDKWLDAKSTWYGKPTGA 32
            IAKVPPGPNITA YGDKWLDAKSTWYGKPTGA
Sbjct  24   IAKVPPGPNITAEYGDKWLDAKSTWYGKPTGA 55

Sequence Alignment: 9. Allergen Name: Lol p 1.0101 Sequence ID: AAA63279

 Score = 68.6 bits 224,  Expect = 3e-14
 Identities = 31/32 96%, Positives = 31/32 96%, Gaps = 0/32 0%
Query  1    IAKVPPGPNITATYGDKWLDAKSTWYGKPTGA 32
            IAKVPPGPNITA YGDKWLDAKSTWYGKPTGA
Sbjct  24   IAKVPPGPNITAEYGDKWLDAKSTWYGKPTGA 55

Sequence Alignment: 10. Allergen Name: Phl p 1 Sequence ID: P43213

 Score = 68.6 bits 224,  Expect = 3e-14
 Identities = 31/32 96%, Positives = 31/32 96%, Gaps = 0/32 0%
Query  1    IAKVPPGPNITATYGDKWLDAKSTWYGKPTGA 32
            I KVPPGPNITATYGDKWLDAKSTWYGKPTGA
Sbjct  24   IPKVPPGPNITATYGDKWLDAKSTWYGKPTGA 55

Sequence Alignment: 11. Allergen Name: Lol p 1.0103 Sequence ID: CAB63699

 Score = 68.6 bits 224,  Expect = 3e-14
 Identities = 31/32 96%, Positives = 31/32 96%, Gaps = 0/32 0%
Query  1    IAKVPPGPNITATYGDKWLDAKSTWYGKPTGA 32
            IAKVPPGPNITA YGDKWLDAKSTWYGKPTGA
Sbjct  24   IAKVPPGPNITAEYGDKWLDAKSTWYGKPTGA 55

Sequence Alignment: 12. Allergen Name: Pha a 1 Sequence ID: Q41260

 Score = 68.6 bits 224,  Expect = 3e-14
 Identities = 31/32 96%, Positives = 31/32 96%, Gaps = 0/32 0%
Query  1    IAKVPPGPNITATYGDKWLDAKSTWYGKPTGA 32
            IAKVPPGPNITA YGDKWLDAKSTWYGKPTGA
Sbjct  30   IAKVPPGPNITAEYGDKWLDAKSTWYGKPTGA 61

Sequence Alignment: 13. Allergen Name: Phl p 1.0101 Sequence ID: CAA81613

 Score = 66.4 bits 216,  Expect = 1e-13
 Identities = 30/32 93%, Positives = 30/32 93%, Gaps = 0/32 0%
Query  1    IAKVPPGPNITATYGDKWLDAKSTWYGKPTGA 32
            I KVPPGPNITATYGDKWLDAKSTWYGKPT A
Sbjct  24   IPKVPPGPNITATYGDKWLDAKSTWYGKPTAA 55

Sequence Alignment: 14. Allergen Name: Ory s 1 Sequence ID: AAF72983

 Score = 58.8 bits 189,  Expect = 3e-11
 Identities = 24/30 80%, Positives = 27/30 90%, Gaps = 0/30 0%
Query  3    KVPPGPNITATYGDKWLDAKSTWYGKPTGA 32
            KVPPGPNIT +YGDKWL+AK+TWYG P GA
Sbjct  26   KVPPGPNITTSYGDKWLEAKATWYGAPKGA 55

Sequence Alignment: 15. Allergen Name: Ory s 1 Sequence ID: AAF72991

 Score = 56.8 bits 182,  Expect = 1e-10
 Identities = 23/30 76%, Positives = 26/30 86%, Gaps = 0/30 0%
Query  3    KVPPGPNITATYGDKWLDAKSTWYGKPTGA 32
            KVPPGPNITA YG +WL+A+ TWYGKP GA
Sbjct  26   KVPPGPNITAAYGKQWLEARGTWYGKPKGA 55

Sequence Alignment: 16. Allergen Name: Pas n 1.0101 Sequence ID: ACA23876

 Score = 53.7 bits 171,  Expect = 9e-10
 Identities = 22/30 73%, Positives = 24/30 80%, Gaps = 0/30 0%
Query  3    KVPPGPNITATYGDKWLDAKSTWYGKPTGA 32
            KVPPGPNIT  Y  KWL AK+TWYG+P GA
Sbjct  27   KVPPGPNITTNYNGKWLPAKATWYGQPNGA 56

Sequence Alignment: 17. Allergen Name: Zea m 1 Sequence ID: P58738

 Score = 52.9 bits 168,  Expect = 2e-09
 Identities = 21/30 70%, Positives = 24/30 80%, Gaps = 0/30 0%
Query  3    KVPPGPNITATYGDKWLDAKSTWYGKPTGA 32
            KVPPGPNIT  Y  KWL A++TWYG+P GA
Sbjct  28   KVPPGPNITTNYNGKWLTARATWYGQPNGA 57

Sequence Alignment: 18. Allergen Name: Cyn d 1.0201 Sequence ID: AAK96255

 Score = 49.7 bits 157,  Expect = 1e-08
 Identities = 23/27 85%, Positives = 25/27 92%, Gaps = 1/27 3%
Query  6    PGPNITATYGDKWLDAKSTWYGK-PTGA 32
            PGPNITATYGDKWLDAK+T+YG  P GA
Sbjct  6    PGPNITATYGDKWLDAKATFYGSDPRGA 33

Sequence Alignment: 19. Allergen Name: Cyn d 1.0204 Sequence ID: AAF80379

 Score = 49.7 bits 157,  Expect = 1e-08
 Identities = 23/27 85%, Positives = 25/27 92%, Gaps = 1/27 3%
Query  6    PGPNITATYGDKWLDAKSTWYGK-PTGA 32
            PGPNITATYGDKWLDAK+T+YG  P GA
Sbjct  6    PGPNITATYGDKWLDAKATFYGSDPRGA 33

Sequence Alignment: 20. Allergen Name: Uro m 1.0101 Sequence ID: A0A4D6FZ45

 Score = 49.8 bits 157,  Expect = 1e-08
 Identities = 23/27 85%, Positives = 25/27 92%, Gaps = 1/27 3%
Query  6    PGPNITATYGDKWLDAKSTWYGK-PTGA 32
            PGPNITATYGDKWLDAK+T+YG  P GA
Sbjct  24   PGPNITATYGDKWLDAKATFYGSDPRGA 51

Sequence Alignment: 21. Allergen Name: Cyn d 1.0202 Sequence ID: AAL14077

 Score = 49.8 bits 157,  Expect = 1e-08
 Identities = 23/27 85%, Positives = 25/27 92%, Gaps = 1/27 3%
Query  6    PGPNITATYGDKWLDAKSTWYGK-PTGA 32
            PGPNITATYGDKWLDAK+T+YG  P GA
Sbjct  24   PGPNITATYGDKWLDAKATFYGSDPRGA 51

Sequence Alignment: 22. Allergen Name: Cyn d 1.0203 Sequence ID: AAL14079

 Score = 49.8 bits 157,  Expect = 1e-08
 Identities = 23/27 85%, Positives = 25/27 92%, Gaps = 1/27 3%
Query  6    PGPNITATYGDKWLDAKSTWYGK-PTGA 32
            PGPNITATYGDKWLDAK+T+YG  P GA
Sbjct  24   PGPNITATYGDKWLDAKATFYGSDPRGA 51

Sequence Alignment: 23. Allergen Name: Cyn d 1 Sequence ID: AAL14078

 Score = 49.8 bits 157,  Expect = 1e-08
 Identities = 23/27 85%, Positives = 25/27 92%, Gaps = 1/27 3%
Query  6    PGPNITATYGDKWLDAKSTWYGK-PTGA 32
            PGPNITATYGDKWLDAK+T+YG  P GA
Sbjct  24   PGPNITATYGDKWLDAKATFYGSDPRGA 51

Sequence Alignment: 24. Allergen Name: Ory s 1 Sequence ID: AAF72990

 Score = 48.9 bits 154,  Expect = 3e-08
 Identities = 19/30 63%, Positives = 23/30 76%, Gaps = 0/30 0%
Query  3    KVPPGPNITATYGDKWLDAKSTWYGKPTGA 32
            KVPPGPNIT  Y   WL A++TWYG+P G+
Sbjct  28   KVPPGPNITTNYNAPWLPARATWYGQPYGS 57

Sequence Alignment: 25. Allergen Name: Sor h 1.0101 Sequence ID: ABC58726

 Score = 47.5 bits 149,  Expect = 6e-08
 Identities = 21/30 70%, Positives = 23/30 76%, Gaps = 0/30 0%
Query  3    KVPPGPNITATYGDKWLDAKSTWYGKPTGA 32
            KV  G NIT TYG  WL+ K+TWYGKPTGA
Sbjct  3    KVAKGKNITETYGSDWLERKATWYGKPTGA 32

Sequence Alignment: 26. Allergen Name: Cyn d 1 Sequence ID: O04701

 Score = 45.0 bits 140,  Expect = 4e-07
 Identities = 20/27 74%, Positives = 24/27 88%, Gaps = 1/27 3%
Query  6    PGPNITATYGDKWLDAKSTWYGK-PTGA 32
            PGPNITATYG KWL+A++T+YG  P GA
Sbjct  6    PGPNITATYGSKWLEARATFYGSNPRGA 33

Sequence Alignment: 27. Allergen Name: Ory s 1 Sequence ID: Q40638

 Score = 42.7 bits 132,  Expect = 2e-06
 Identities = 17/27 62%, Positives = 21/27 77%, Gaps = 0/27 0%
Query  3    KVPPGPNITATYGDKWLDAKSTWYGKP 29
            KVPPGPNIT +YGDKWL+A+     +P
Sbjct  26   KVPPGPNITTSYGDKWLEARPPGMVRP 52

Sequence Alignment: 28. Allergen Name: Zoy m 1.0101 Sequence ID: QCX36431

 Score = 42.5 bits 131,  Expect = 2e-06
 Identities = 19/27 70%, Positives = 23/27 85%, Gaps = 1/27 3%
Query  6    PGPNITATYGDKWLDAKSTWYGK-PTGA 32
            PGPNITATY ++W DAK+T+YG  P GA
Sbjct  34   PGPNITATYNEEWQDAKATFYGSNPRGA 61

Sequence Alignment: 29. Allergen Name: Uro m 1.0201 Sequence ID: A0A4D6G2J8

 Score = 38.2 bits 116,  Expect = 4e-05
 Identities = 15/16 93%, Positives = 16/16 100%, Gaps = 0/16 0%
Query  17   KWLDAKSTWYGKPTGA 32
            KWLDAK+TWYGKPTGA
Sbjct  3    KWLDAKATWYGKPTGA 18

Sequence Alignment: 30. Allergen Name: Ory s 1 Sequence ID: AAF72987

 Score = 36.3 bits 109,  Expect = 0.0002
 Identities = 15/28 53%, Positives = 20/28 71%, Gaps = 2/28 7%
Query  5    PPGPNIT--ATYGDKWLDAKSTWYGKPTGA 32
            P   N++  + YG  WL A++TWYG PTGA
Sbjct  29   PVNYNVSDASAYGSGWLPARATWYGAPTGA 58

Sequence Alignment: 31. Allergen Name: Ory s 1 Sequence ID: AAB61710

 Score = 33.4 bits 99,  Expect = 0.001
 Identities = 12/19 63%, Positives = 15/19 78%, Gaps = 0/19 0%
Query  14   YGDKWLDAKSTWYGKPTGA 32
            Y + WL AK+TWYG+P GA
Sbjct  27   YTNDWLPAKATWYGQPNGA 45

Sequence Alignment: 32. Allergen Name: Tri a ps93 Sequence ID: AAD10496

 Score = 32.9 bits 97,  Expect = 0.002
 Identities = 12/23 52%, Positives = 15/23 65%, Gaps = 0/23 0%
Query  10   ITATYGDKWLDAKSTWYGKPTGA 32
            +  +Y   WL AK+TWYG P GA
Sbjct  32   VARSYTSGWLPAKATWYGAPNGA 54

Sequence Alignment: 33. Allergen Name: Ory s 1 Sequence ID: AAF72988

 Score = 32.1 bits 94,  Expect = 0.004
 Identities = 11/18 61%, Positives = 14/18 77%, Gaps = 0/18 0%
Query  15   GDKWLDAKSTWYGKPTGA 32
            G  WL+A++TWYG P GA
Sbjct  89   GGGWLNARATWYGAPNGA 106

Sequence Alignment: 34. Allergen Name: Ory s 1 Sequence ID: AAF72985

 Score = 31.2 bits 91,  Expect = 0.006
 Identities = 11/21 52%, Positives = 14/21 66%, Gaps = 0/21 0%
Query  12   ATYGDKWLDAKSTWYGKPTGA 32
            A Y   W  A++TWYG+P GA
Sbjct  49   AVYWGPWTKARATWYGQPNGA 69

Sequence Alignment: 35. Allergen Name: Ory s 1 Sequence ID: AAF72984

 Score = 30.6 bits 89,  Expect = 0.008
 Identities = 16/31 51%, Positives = 20/31 64%, Gaps = 4/31 12%
Query  1    IAKVPPGPNITA---TYGDKWLDAKSTWYGKPTGA 32
            +A   PG N +A   T    W  A++TWYG PTGA
Sbjct  23   VAGARPG-NFSASDFTADPNWEVARATWYGAPTGA 56

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.